F449608

General Info

Members Datasets Scaffolds Average Seq Length
466 279 932 93

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100398815|Ga0070670_1003988153
Length 97
Sequence VTGTESDDTAAWKVEVTSPALKGFRRLPEKAAAAIVEFVTGPLADNPRRLSKPLTNELLGLRTARRGDYRVLFTLDVEDHALYVHRIEHRSDVYKPR

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
177 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
277 2773857933 Frankia sp. BMG5.30 Isolate Nodule
278 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
279 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 0.86
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0.21
Rhizoplane 9.23
Rhizosphere 86.91
Stem 0
Stem Tuber 0
Unclassified 12.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100398815 3300005331 Bacteria 1214
2 rootH2_10253131 3300003320 Bacteria 1941
3 rootL2_10006427 3300003322 Bacteria 44531
4 Ga0070683_101881829 3300005329 Unclassified 575
5 Ga0070666_10063430 3300005335 Bacteria 2505
6 Ga0070666_10624107 3300005335 Unclassified 787
7 Ga0070680_100467504 3300005336 Bacteria 1078
8 Ga0070682_100193840 3300005337 Bacteria 1428
9 Ga0070660_100269814 3300005339 Bacteria 1391
10 Ga0070691_10565366 3300005341 Unclassified 666
11 Ga0070661_100229063 3300005344 Bacteria 1428
12 Ga0070675_100393203 3300005354 Bacteria 1236
13 Ga0070671_100265951 3300005355 Bacteria 1458
14 Ga0070671_101280243 3300005355 Unclassified 646
15 Ga0070709_10022856 3300005434 Bacteria 3664
16 Ga0070709_10025611 3300005434 Bacteria 3487
17 Ga0070714_100045204 3300005435 Bacteria 3731
18 Ga0070714_100095617 3300005435 Unclassified 2609
19 Ga0070714_100396014 3300005435 Bacteria 1304
20 Ga0070714_100421549 3300005435 Bacteria 1264
21 Ga0070714_100716503 3300005435 Bacteria 966
22 Ga0070714_100858441 3300005435 Bacteria 880
23 Ga0070713_100061040 3300005436 Bacteria 3154
24 Ga0070713_100086893 3300005436 Bacteria 2682
25 Ga0070713_100326869 3300005436 Bacteria 1417
26 Ga0070713_100363352 3300005436 Unclassified 1345
27 Ga0070713_100438799 3300005436 Bacteria 1225
28 Ga0070713_100458363 3300005436 Bacteria 1198
29 Ga0070713_100864842 3300005436 Bacteria 868
30 Ga0070710_10021630 3300005437 Bacteria 3355
31 Ga0070710_10043704 3300005437 Bacteria 2483
32 Ga0070710_10045138 3300005437 Bacteria 2448
33 Ga0070711_100003971 3300005439 Bacteria 8693
34 Ga0070711_100046359 3300005439 Bacteria 2961
35 Ga0070711_100061454 3300005439 Unclassified 2615
36 Ga0070711_100295871 3300005439 Bacteria 1285
37 Ga0070711_100391097 3300005439 Bacteria 1126
38 Ga0070711_100680081 3300005439 Bacteria 865
39 Ga0070711_101987679 3300005439 Unclassified 511
40 Ga0070700_101856852 3300005441 Bacteria 520
41 Ga0070694_100635347 3300005444 Bacteria 863
42 Ga0070708_100211360 3300005445 Bacteria 1818
43 Ga0070708_100366263 3300005445 Unclassified 1358
44 Ga0070708_100775734 3300005445 Unclassified 901
45 Ga0070663_100156993 3300005455 Bacteria 1749
46 Ga0070678_101817970 3300005456 Bacteria 575
47 Ga0070681_10741919 3300005458 Bacteria 898
48 Ga0070706_100189663 3300005467 Bacteria 1921
49 Ga0070706_100191263 3300005467 Unclassified 1912
50 Ga0070706_100310103 3300005467 Bacteria 1472
51 Ga0070706_100427007 3300005467 Bacteria 1233
52 Ga0070707_100020624 3300005468 Bacteria 6219
53 Ga0070707_101050285 3300005468 Bacteria 780
54 Ga0070707_101528321 3300005468 Unclassified 634
55 Ga0070698_100001324 3300005471 Bacteria 27582
56 Ga0070698_100098811 3300005471 Bacteria 2892
57 Ga0070698_100552730 3300005471 Bacteria 1091
58 Ga0070684_100149306 3300005535 Bacteria 2117
59 Ga0070697_100231278 3300005536 Unclassified 1577
60 Ga0068853_100139135 3300005539 Bacteria 2178
61 Ga0070686_100691999 3300005544 Bacteria 812
62 Ga0070695_100316240 3300005545 Bacteria 1159
63 Ga0070696_100219310 3300005546 Bacteria 1426
64 Ga0070693_100451496 3300005547 Bacteria 902
65 Ga0070665_100550697 3300005548 Bacteria 1166
66 Ga0070704_100115432 3300005549 Bacteria 2051
67 Ga0070664_100055244 3300005564 Bacteria 3370
68 Ga0068857_101429856 3300005577 Bacteria 673
69 Ga0068854_100789300 3300005578 Bacteria 827
70 Ga0068854_101909411 3300005578 Unclassified 546
71 Ga0068854_102164357 3300005578 Unclassified 514
72 Ga0068856_100219388 3300005614 Bacteria 1917
73 Ga0068856_100275856 3300005614 Unclassified 1698
74 Ga0068852_100239044 3300005616 Bacteria 1735
75 Ga0068852_100552650 3300005616 Bacteria 1152
76 Ga0068859_100778941 3300005617 Bacteria 1045
77 Ga0068859_101800121 3300005617 Bacteria 676
78 Ga0068864_100218495 3300005618 Bacteria 1758
79 Ga0068866_10086699 3300005718 Bacteria 1695
80 Ga0068861_100262602 3300005719 Bacteria 1479
81 Ga0068870_10459558 3300005840 Bacteria 841
82 Ga0068863_100217112 3300005841 Bacteria 1842
83 Ga0068858_100502559 3300005842 Bacteria 1171
84 Ga0068860_100389597 3300005843 Bacteria 1377
85 Ga0081455_10333473 3300005937 Bacteria 1076
86 Ga0081539_10052802 3300005985 Bacteria 2280
87 Ga0070717_10031534 3300006028 Bacteria 4265
88 Ga0070717_10039192 3300006028 Bacteria 3855
89 Ga0070717_10069538 3300006028 Bacteria 2932
90 Ga0070717_10072575 3300006028 Bacteria 2874
91 Ga0070717_10390778 3300006028 Bacteria 1248
92 Ga0070717_10520116 3300006028 Unclassified 1076
93 Ga0070717_10695918 3300006028 Bacteria 923
94 Ga0070717_10970151 3300006028 Bacteria 774
95 Ga0075365_10047393 3300006038 Bacteria 2825
96 Ga0070715_10011373 3300006163 Bacteria 3204
97 Ga0070715_10126248 3300006163 Bacteria 1226
98 Ga0070716_100040309 3300006173 Bacteria 2597
99 Ga0070716_100054543 3300006173 Unclassified 2283
100 Ga0070716_101211950 3300006173 Unclassified 607
101 Ga0070712_100043274 3300006175 Bacteria 3099
102 Ga0070712_100077706 3300006175 Bacteria 2393
103 Ga0070712_100155914 3300006175 Bacteria 1758
104 Ga0097621_100141280 3300006237 Bacteria 2057
105 Ga0097621_100170996 3300006237 Bacteria 1873
106 Ga0068871_100058178 3300006358 Bacteria 3147
107 Ga0068871_100113466 3300006358 Bacteria 2282
108 Ga0068871_101546954 3300006358 Unclassified 627
109 Ga0075433_10094121 3300006852 Bacteria 2651
110 Ga0075434_100004695 3300006871 Bacteria 12345
111 Ga0075434_100021360 3300006871 Bacteria 6291
112 Ga0075434_100333632 3300006871 Bacteria 1537
113 Ga0075436_100025632 3300006914 Bacteria 4058
114 Ga0075436_100135687 3300006914 Bacteria 1727
115 Ga0075436_100479703 3300006914 Bacteria 908
116 Ga0097620_100778911 3300006931 Bacteria 1045
117 Ga0097620_101800284 3300006931 Bacteria 676
118 Ga0075435_100010048 3300007076 Bacteria 6901
119 Ga0075435_100018390 3300007076 Bacteria 5313
120 Ga0099794_10032796 3300007265 Bacteria 2440
121 Ga0105245_10183202 3300009098 Bacteria 2002
122 Ga0105247_10054863 3300009101 Bacteria 2459
123 Ga0105243_10673392 3300009148 Bacteria 1005
124 Ga0105241_10381943 3300009174 Bacteria 1231
125 Ga0105242_10442642 3300009176 Bacteria 1223
126 Ga0105248_10074258 3300009177 Bacteria 3822
127 Ga0105248_10315992 3300009177 Bacteria 1759
128 Ga0105248_12765961 3300009177 Unclassified 560
129 Ga0105237_10223230 3300009545 Bacteria 1884
130 Ga0105238_10334844 3300009551 Bacteria 1501
131 Ga0105249_11981729 3300009553 Bacteria 655
132 Ga0105239_10441274 3300010375 Bacteria 1476
133 Ga0105239_11968775 3300010375 Unclassified 678
134 Ga0105246_10321047 3300011119 Bacteria 1258
135 Ga0157373_10740325 3300013100 Bacteria 722
136 Ga0157371_10129714 3300013102 Bacteria 1794
137 Ga0157370_10207471 3300013104 Bacteria 1816
138 Ga0157369_10093377 3300013105 Bacteria 3212
139 Ga0157374_10254442 3300013296 Bacteria 1729
140 Ga0157378_10132819 3300013297 Bacteria 2306
141 Ga0157378_10727387 3300013297 Bacteria 1014
142 Ga0163162_10109610 3300013306 Bacteria 2858
143 Ga0163162_10560972 3300013306 Bacteria 1270
144 Ga0157372_10150076 3300013307 Bacteria 2689
145 Ga0157375_10026908 3300013308 Bacteria 5369
146 Ga0157375_10069865 3300013308 Bacteria 3520
147 Ga0157379_10162568 3300014968 Bacteria 2015
148 Ga0157376_10082098 3300014969 Bacteria 2769
149 Ga0157376_10500310 3300014969 Bacteria 1194
150 Ga0206349_1263956 3300020075 Bacteria 1342
151 Ga0206354_10337829 3300020081 Bacteria 546
152 Ga0206353_10471335 3300020082 Bacteria 600
153 Ga0213874_10398228 3300021377 Bacteria 535
154 Ga0213875_10010321 3300021388 Bacteria 4678
155 Ga0213875_10248193 3300021388 Bacteria 839
156 Ga0213875_10679073 3300021388 Unclassified 500
157 Ga0224712_10530631 3300022467 Unclassified 571
158 Ga0209759_1017949 3300025256 Bacteria 1725
159 Ga0207692_10003121 3300025898 Bacteria 6429
160 Ga0207692_10014551 3300025898 Bacteria 3440
161 Ga0207692_10691527 3300025898 Unclassified 661
162 Ga0207642_10243277 3300025899 Bacteria 1017
163 Ga0207685_10025410 3300025905 Bacteria 2045
164 Ga0207699_10008827 3300025906 Bacteria 4993
165 Ga0207699_10016683 3300025906 Bacteria 3847
166 Ga0207699_10204567 3300025906 Bacteria 1339
167 Ga0207699_10665743 3300025906 Unclassified 761
168 Ga0207705_10750169 3300025909 Bacteria 758
169 Ga0207684_10003711 3300025910 Bacteria 14789
170 Ga0207684_10161975 3300025910 Bacteria 1927
171 Ga0207684_10200134 3300025910 Bacteria 1723
172 Ga0207684_10243962 3300025910 Bacteria 1550
173 Ga0207684_10326628 3300025910 Unclassified 1322
174 Ga0207684_10401930 3300025910 Bacteria 1178
175 Ga0207654_11361057 3300025911 Bacteria 518
176 Ga0207707_10381040 3300025912 Bacteria 1212
177 Ga0207671_10248993 3300025914 Bacteria 1397
178 Ga0207693_10008049 3300025915 Bacteria 8652
179 Ga0207693_10080371 3300025915 Bacteria 2552
180 Ga0207693_10116423 3300025915 Bacteria 2099
181 Ga0207663_10002702 3300025916 Bacteria 8555
182 Ga0207663_10018358 3300025916 Bacteria 3919
183 Ga0207663_10318277 3300025916 Bacteria 1168
184 Ga0207663_10386775 3300025916 Bacteria 1067
185 Ga0207663_10768483 3300025916 Bacteria 766
186 Ga0207660_10638746 3300025917 Unclassified 868
187 Ga0207662_10016110 3300025918 Bacteria 4214
188 Ga0207657_10113507 3300025919 Bacteria 2235
189 Ga0207649_10301688 3300025920 Bacteria 1171
190 Ga0207652_10258722 3300025921 Bacteria 1570
191 Ga0207646_10005725 3300025922 Bacteria 13033
192 Ga0207646_10889183 3300025922 Bacteria 791
193 Ga0207646_11734380 3300025922 Unclassified 536
194 Ga0207694_10215009 3300025924 Bacteria 1567
195 Ga0207650_10493257 3300025925 Bacteria 1023
196 Ga0207659_10313845 3300025926 Bacteria 1291
197 Ga0207687_10022244 3300025927 Bacteria 4217
198 Ga0207700_10034053 3300025928 Bacteria 3652
199 Ga0207700_10039347 3300025928 Bacteria 3442
200 Ga0207700_10168860 3300025928 Bacteria 1823
201 Ga0207700_10323941 3300025928 Bacteria 1336
202 Ga0207700_10349990 3300025928 Bacteria 1286
203 Ga0207700_10831274 3300025928 Bacteria 826
204 Ga0207664_10008008 3300025929 Bacteria 7348
205 Ga0207664_10009959 3300025929 Bacteria 6696
206 Ga0207664_10036701 3300025929 Bacteria 3788
207 Ga0207664_10618994 3300025929 Bacteria 973
208 Ga0207644_10232840 3300025931 Bacteria 1464
209 Ga0207690_10259177 3300025932 Bacteria 1347
210 Ga0207686_10385762 3300025934 Bacteria 1064
211 Ga0207665_10002888 3300025939 Bacteria 11527
212 Ga0207665_10014771 3300025939 Bacteria 5137
213 Ga0207711_10435550 3300025941 Unclassified 1220
214 Ga0207711_10684910 3300025941 Bacteria 956
215 Ga0207679_10254694 3300025945 Bacteria 1494
216 Ga0207712_10458056 3300025961 Bacteria 1083
217 Ga0207640_10604791 3300025981 Bacteria 928
218 Ga0207677_10622508 3300026023 Bacteria 949
219 Ga0207703_10415749 3300026035 Bacteria 1250
220 Ga0207639_10545044 3300026041 Bacteria 1064
221 Ga0207678_10238009 3300026067 Bacteria 1559
222 Ga0207708_11587116 3300026075 Unclassified 575
223 Ga0207702_10019354 3300026078 Bacteria 5634
224 Ga0207702_10122862 3300026078 Bacteria 2326
225 Ga0207641_10297888 3300026088 Bacteria 1522
226 Ga0207676_11092032 3300026095 Bacteria 788
227 Ga0207674_11123223 3300026116 Bacteria 755
228 Ga0207675_100422170 3300026118 Bacteria 1317
229 Ga0207683_10076326 3300026121 Bacteria 2967
230 Ga0207698_10159538 3300026142 Bacteria 1970
231 Ga0207698_10198514 3300026142 Bacteria 1794
232 Ga0268266_10139675 3300028379 Bacteria 2173
233 Ga0268264_10651311 3300028381 Bacteria 1042
234 Ga0265327_10000177 3300031251 Bacteria 136559
235 Ga0307408_101151712 3300031548 Bacteria 721
236 Ga0307408_101892298 3300031548 Unclassified 572
237 Ga0307405_10227216 3300031731 Bacteria 1373
238 Ga0307405_11129470 3300031731 Bacteria 675
239 Ga0307410_10228202 3300031852 Unclassified 1436
240 Ga0307410_10769961 3300031852 Bacteria 816
241 Ga0307410_11619719 3300031852 Bacteria 572
242 Ga0307407_10176315 3300031903 Bacteria 1413
243 Ga0307407_10345557 3300031903 Unclassified 1052
244 Ga0307412_11529540 3300031911 Bacteria 607
245 Ga0307409_101031557 3300031995 Bacteria 842
246 Ga0307409_101311292 3300031995 Bacteria 749
247 Ga0307416_100385769 3300032002 Bacteria 1433
248 Ga0307416_102558041 3300032002 Bacteria 608
249 Ga0373926_0024216 3300035083 Bacteria 2113
250 Ga0373934_0009605 3300035086 Bacteria 3627
251 Ga0373944_0038795 3300035089 Bacteria 1464
252 Ga0373923_0388028 3300035111 Bacteria 671
253 Ga0373932_0070592 3300035112 Bacteria 1082
254 Ga0373936_0181869 3300035113 Unclassified 923
255 Ga0373939_0016929 3300035114 Bacteria 1929
256 Ga0373939_0485160 3300035114 Bacteria 525
257 Ga0373945_0240559 3300035116 Unclassified 762
258 Ga0373953_0006761 3300035117 Bacteria 3799
259 Ga0373954_0026469 3300035118 Bacteria 2659
260 Ga0373956_0026504 3300035119 Bacteria 2511
261 Ga0373956_0640222 3300035119 Unclassified 508
262 Ga0373957_0003523 3300035120 Bacteria 4640
263 Ga0373943_0065399 3300035170 Bacteria 1828
264 Ga0373946_0042846 3300035171 Bacteria 1863
265 Ga0373946_0347079 3300035171 Unclassified 741
266 Ga0373946_0352045 3300035171 Bacteria 736
267 Ga0373955_0004918 3300035172 Bacteria 5960
268 Ga0373955_0196994 3300035172 Bacteria 1199
269 Ga0373942_0087872 3300035207 Bacteria 932
270 Ga0373924_0032618 3300035410 Bacteria 2099
271 Ga0373931_0058776 3300035691 Bacteria 2066
272 Ga0373931_0640855 3300035691 Unclassified 697
273 Ga0373935_0008073 3300035692 Bacteria 6311
274 Ga0373935_0417486 3300035692 Unclassified 965
275 Ga0373927_0779934 3300035695 Unclassified 631
276 Ga0373933_0002474 3300035724 Bacteria 10393
277 Ga0373947_0073566 3300035725 Bacteria 2100
278 Ga0373947_0489083 3300035725 Unclassified 835
279 Ga0373947_0496710 3300035725 Bacteria 829
280 Ga0373947_0551371 3300035725 Bacteria 785
281 Ga0373937_0003332 3300036401 Bacteria 13487
282 Ga0373925_0054399 3300037068 Bacteria 2994
283 Ga0373925_0091625 3300037068 Bacteria 2324
284 Ga0395900_1217403 3300037418 Unclassified 668
285 Ga0395898_0355631 3300037466 Bacteria 1397
286 Ga0395898_0732695 3300037466 Bacteria 930
287 Ga0395898_0851001 3300037466 Bacteria 851
288 Ga0395898_1382359 3300037466 Bacteria 632
289 Ga0436364_0033240 3300037853 Unclassified 697
290 Ga0436364_0047636 3300037853 Unclassified 1148
291 Ga0436364_0681249 3300037853 Unclassified 1952
292 Ga0436364_0903400 3300037853 Bacteria 4050
293 Ga0436364_1195756 3300037853 Bacteria 3845
294 Ga0395901_0507584 3300038443 Bacteria 1227
295 Ga0395901_0728365 3300038443 Bacteria 987
296 Ga0436365_1758254 3300039437 Bacteria 524
297 Ga0436363_0510064 3300039450 Bacteria 1142
298 Ga0436363_0641316 3300039450 Bacteria 536
299 Ga0451791_0966444 3300041451 Bacteria 1476
300 Ga0451797_0385559 3300041453 Bacteria 613
301 Ga0495592_0015391 3300046454 Bacteria 5801
302 Ga0495592_0147334 3300046454 Bacteria 1631
303 Ga0495629_0006346 3300046459 Bacteria 8773
304 Ga0495641_0032610 3300046461 Bacteria 2477
305 Ga0495651_0060098 3300046462 Bacteria 2912
306 Ga0495651_0712312 3300046462 Unclassified 625
307 Ga0495653_0016514 3300046463 Bacteria 6007
308 Ga0495580_0485195 3300046472 Bacteria 826
309 Ga0495582_0024400 3300046473 Bacteria 3308
310 Ga0495639_0021118 3300046475 Bacteria 2849
311 Ga0495639_0070202 3300046475 Bacteria 1617
312 Ga0495639_0607689 3300046475 Bacteria 562
313 Ga0495662_0007111 3300046476 Bacteria 5553
314 Ga0495664_0044053 3300046477 Bacteria 2644
315 Ga0495664_0094903 3300046477 Bacteria 1795
316 Ga0495608_0009487 3300046511 Bacteria 6799
317 Ga0495618_0065286 3300046514 Unclassified 2313
318 Ga0495618_0365187 3300046514 Unclassified 888
319 Ga0495628_0013150 3300046516 Bacteria 6966
320 Ga0495628_0120991 3300046516 Bacteria 2008
321 Ga0495628_0292511 3300046516 Bacteria 1207
322 Ga0495628_0544243 3300046516 Bacteria 834
323 Ga0495630_0008974 3300046517 Bacteria 7180
324 Ga0495630_0316469 3300046517 Bacteria 1193
325 Ga0495652_0089887 3300046529 Bacteria 2513
326 Ga0495652_0219803 3300046529 Bacteria 1428
327 Ga0495652_0223304 3300046529 Bacteria 1414
328 Ga0495665_0304209 3300046531 Bacteria 816
329 Ga0495640_0130671 3300046533 Bacteria 1625
330 Ga0495586_0163063 3300046535 Bacteria 1257
331 Ga0495587_0006894 3300046536 Bacteria 7387
332 Ga0495587_0741993 3300046536 Unclassified 537
333 Ga0495609_0001500 3300046538 Bacteria 15415
334 Ga0495645_0012252 3300046543 Bacteria 6037
335 Ga0495645_0071809 3300046543 Bacteria 2495
336 Ga0495645_0143748 3300046543 Bacteria 1662
337 Ga0495645_0481476 3300046543 Bacteria 778
338 Ga0495667_0009353 3300046559 Bacteria 6638
339 Ga0495634_0016156 3300046642 Bacteria 5342
340 Ga0495635_0037438 3300046663 Bacteria 3358
341 Ga0495588_0613784 3300046674 Bacteria 569
342 Ga0495657_0011413 3300046675 Bacteria 6640
343 Ga0495599_0007468 3300046678 Bacteria 6627
344 Ga0495599_0290067 3300046678 Bacteria 989
345 Ga0495623_0035059 3300046679 Bacteria 3216
346 Ga0495646_0008780 3300046680 Bacteria 6420
347 Ga0495646_0593450 3300046680 Bacteria 563
348 Ga0495647_0340531 3300046681 Unclassified 681
349 Ga0495658_0043764 3300046683 Bacteria 2506
350 Ga0495613_0591881 3300046689 Bacteria 739
351 Ga0495624_0179548 3300046690 Bacteria 1290
352 Ga0495624_0392287 3300046690 Bacteria 834
353 Ga0495649_0623929 3300046694 Unclassified 531
354 Ga0495600_0005958 3300046809 Bacteria 7378
355 Ga0495581_0003273 3300047315 Bacteria 9292
356 Ga0495581_0061496 3300047315 Bacteria 2170
357 Ga0495581_0202537 3300047315 Bacteria 1161
358 Ga0495604_0016503 3300047317 Bacteria 5904
359 Ga0495604_0332470 3300047317 Bacteria 1013
360 Ga0495604_0843017 3300047317 Bacteria 575
361 Ga0495674_0023142 3300047319 Bacteria 5726
362 Ga0495674_0138870 3300047319 Bacteria 2043
363 Ga0495674_0638557 3300047319 Bacteria 840
364 Ga0495676_0656425 3300047321 Unclassified 680
365 Ga0495680_0010212 3300047322 Bacteria 8383
366 Ga0495680_0261314 3300047322 Bacteria 1224
367 Ga0495680_0733513 3300047322 Bacteria 650
368 Ga0495675_0065329 3300047444 Bacteria 2301
369 Ga0495684_0042168 3300047471 Bacteria 3495
370 Ga0495684_0360592 3300047471 Bacteria 1030
371 Ga0495593_0086245 3300047673 Bacteria 1619
372 Ga0495602_0018531 3300048088 Bacteria 6948
373 Ga0495602_0191314 3300048088 Bacteria 1569
374 Ga0496100_0052351 3300048903 Bacteria 2654
375 Ga0496100_0144632 3300048903 Bacteria 1689
376 Ga0496100_0174549 3300048903 Bacteria 1550
377 Ga0496101_0127427 3300048904 Bacteria 1930
378 Ga0496101_0543561 3300048904 Bacteria 918
379 Ga0496102_0027577 3300048905 Bacteria 5071
380 Ga0496102_0045531 3300048905 Bacteria 3984
381 Ga0496102_0196207 3300048905 Bacteria 1902
382 Ga0496102_0329921 3300048905 Bacteria 1437
383 Ga0496103_0028783 3300048906 Bacteria 3374
384 Ga0496103_0157063 3300048906 Bacteria 1458
385 Ga0496103_0212163 3300048906 Bacteria 1245
386 Ga0496104_0049727 3300048907 Bacteria 3953
387 Ga0496104_0131670 3300048907 Bacteria 2402
388 Ga0496105_0025783 3300048908 Bacteria 4789
389 Ga0496105_0027187 3300048908 Bacteria 4671
390 Ga0496106_0047975 3300048909 Bacteria 3215
391 Ga0496107_0047566 3300048910 Bacteria 3089
392 Ga0496107_0109174 3300048910 Bacteria 2032
393 Ga0496108_0017211 3300048911 Bacteria 5913
394 Ga0496108_0252132 3300048911 Unclassified 1535
395 Ga0496109_0064119 3300048912 Bacteria 3361
396 Ga0496109_0381019 3300048912 Bacteria 1332
397 Ga0496110_0022327 3300048913 Bacteria 5371
398 Ga0496110_0037289 3300048913 Bacteria 4225
399 Ga0496110_1537416 3300048913 Unclassified 575
400 Ga0496110_1552423 3300048913 Bacteria 572
401 Ga0496111_0018932 3300048914 Bacteria 4774
402 Ga0496111_0025303 3300048914 Bacteria 4188
403 Ga0496112_0047617 3300048915 Bacteria 4206
404 Ga0496112_0157953 3300048915 Unclassified 2234
405 Ga0496112_0382114 3300048915 Bacteria 1349
406 Ga0496113_0009467 3300048916 Bacteria 6391
407 Ga0496113_0018642 3300048916 Bacteria 4837
408 Ga0496113_0616970 3300048916 Unclassified 868
409 Ga0496113_0706781 3300048916 Bacteria 804
410 Ga0496114_0033838 3300048917 Bacteria 4214
411 Ga0496114_0150430 3300048917 Bacteria 2019
412 Ga0496115_0115984 3300048918 Bacteria 2202
413 Ga0496115_0432209 3300048918 Bacteria 1065
414 Ga0496115_0943495 3300048918 Bacteria 663
415 Ga0501032_0100036 3300049569 Bacteria 1921
416 Ga0501033_0000814 3300049570 Bacteria 28538
417 Ga0501033_0341859 3300049570 Bacteria 1049
418 Ga0501034_0420975 3300049571 Bacteria 1257
419 Ga0501036_0273792 3300049572 Bacteria 1413
420 Ga0501037_0022438 3300049573 Bacteria 4669
421 Ga0501038_0037427 3300049574 Bacteria 4254
422 Ga0501040_0020658 3300049576 Bacteria 4390
423 Ga0501041_0063324 3300049577 Bacteria 2264
424 Ga0501042_0015333 3300049578 Bacteria 5247
425 Ga0501046_0072811 3300049580 Bacteria 2667
426 Ga0501048_0009599 3300049582 Bacteria 7261
427 Ga0501068_0016865 3300049584 Bacteria 4217
428 Ga0501070_0286525 3300049586 Bacteria 1343
429 Ga0501071_0036184 3300049587 Bacteria 3520
430 Ga0501072_0015028 3300049588 Bacteria 5934
431 Ga0501073_0250656 3300049589 Bacteria 1222
432 Ga0501074_0111106 3300049590 Bacteria 1961
433 Ga0501076_0021965 3300049592 Bacteria 4901
434 Ga0501077_0015968 3300049593 Bacteria 4731
435 Ga0501079_0063559 3300049741 Bacteria 2847
436 Ga0501080_0081458 3300049742 Bacteria 3007
437 Ga0501081_0313662 3300049743 Bacteria 1152
438 Ga0501279_105429 3300049775 Bacteria 512
439 Ga0501035_0059178 3300049822 Bacteria 3412
440 Ga0501044_0004887 3300049823 Bacteria 14977
441 Ga0501044_0192239 3300049823 Bacteria 2003
442 Ga0501045_0203349 3300049824 Bacteria 1475
443 nmdc:mga0yw44_1157260_c1 3300050492 Bacteria 522
444 nmdc:mga08y16_1235983_c1 3300050511 Bacteria 716
445 nmdc:mga0n895_1063411_c1 3300050512 Unclassified 788
446 nmdc:mga0n895_164687_c1 3300050512 Bacteria 2249
447 nmdc:mga0n895_239234_c1 3300050512 Bacteria 1842
448 nmdc:mga0n895_4006_c1 3300050512 Bacteria 11980
449 nmdc:mga0rr50_12013_c1 3300050513 Bacteria 5575
450 nmdc:mga0rr50_38290_c1 3300050513 Bacteria 3469
451 nmdc:mga08x19_17225_c1 3300050514 Bacteria 4418
452 nmdc:mga08x19_32818_c1 3300050514 Bacteria 3274
453 nmdc:mga08x19_672085_c1 3300050514 Unclassified 735
454 nmdc:mga0a205_16620_c1 3300050515 Bacteria 6891
455 nmdc:mga0a205_51255_c1 3300050515 Bacteria 3984
456 Ga0495601_0025366 3300053077 Bacteria 3655
457 Ga0495601_0245469 3300053077 Bacteria 1169
458 Ga0495612_0009011 3300053078 Bacteria 4047
459 Ga0495595_0020095 3300053084 Bacteria 2903
460 Ga0495619_0058359 3300053085 Bacteria 2561
461 Ga0501084_0607001 3300054114 Unclassified 924
462 Ga0501082_0176963 3300060353 Bacteria 1855
463 Ga0530510_0107413 3300061734 Bacteria 2042
464 2774903728 2773857933 Bacteria 5818019
465 2904779289 2904776348 Bacteria 4658726
466 8054472963 8054472261 Bacteria 7464355
467 Ga0070670_100398815
468 rootH2_10253131
469 rootL2_10006427
470 Ga0070683_101881829
471 Ga0070666_10063430
472 Ga0070666_10624107
473 Ga0070680_100467504
474 Ga0070682_100193840
475 Ga0070660_100269814
476 Ga0070691_10565366
477 Ga0070661_100229063
478 Ga0070675_100393203
479 Ga0070671_100265951
480 Ga0070671_101280243
481 Ga0070709_10022856
482 Ga0070709_10025611
483 Ga0070714_100045204
484 Ga0070714_100095617
485 Ga0070714_100396014
486 Ga0070714_100421549
487 Ga0070714_100716503
488 Ga0070714_100858441
489 Ga0070713_100061040
490 Ga0070713_100086893
491 Ga0070713_100326869
492 Ga0070713_100363352
493 Ga0070713_100438799
494 Ga0070713_100458363
495 Ga0070713_100864842
496 Ga0070710_10021630
497 Ga0070710_10043704
498 Ga0070710_10045138
499 Ga0070711_100003971
500 Ga0070711_100046359
501 Ga0070711_100061454
502 Ga0070711_100295871
503 Ga0070711_100391097
504 Ga0070711_100680081
505 Ga0070711_101987679
506 Ga0070700_101856852
507 Ga0070694_100635347
508 Ga0070708_100211360
509 Ga0070708_100366263
510 Ga0070708_100775734
511 Ga0070663_100156993
512 Ga0070678_101817970
513 Ga0070681_10741919
514 Ga0070706_100189663
515 Ga0070706_100191263
516 Ga0070706_100310103
517 Ga0070706_100427007
518 Ga0070707_100020624
519 Ga0070707_101050285
520 Ga0070707_101528321
521 Ga0070698_100001324
522 Ga0070698_100098811
523 Ga0070698_100552730
524 Ga0070684_100149306
525 Ga0070697_100231278
526 Ga0068853_100139135
527 Ga0070686_100691999
528 Ga0070695_100316240
529 Ga0070696_100219310
530 Ga0070693_100451496
531 Ga0070665_100550697
532 Ga0070704_100115432
533 Ga0070664_100055244
534 Ga0068857_101429856
535 Ga0068854_100789300
536 Ga0068854_101909411
537 Ga0068854_102164357
538 Ga0068856_100219388
539 Ga0068856_100275856
540 Ga0068852_100239044
541 Ga0068852_100552650
542 Ga0068859_100778941
543 Ga0068859_101800121
544 Ga0068864_100218495
545 Ga0068866_10086699
546 Ga0068861_100262602
547 Ga0068870_10459558
548 Ga0068863_100217112
549 Ga0068858_100502559
550 Ga0068860_100389597
551 Ga0081455_10333473
552 Ga0081539_10052802
553 Ga0070717_10031534
554 Ga0070717_10039192
555 Ga0070717_10069538
556 Ga0070717_10072575
557 Ga0070717_10390778
558 Ga0070717_10520116
559 Ga0070717_10695918
560 Ga0070717_10970151
561 Ga0075365_10047393
562 Ga0070715_10011373
563 Ga0070715_10126248
564 Ga0070716_100040309
565 Ga0070716_100054543
566 Ga0070716_101211950
567 Ga0070712_100043274
568 Ga0070712_100077706
569 Ga0070712_100155914
570 Ga0097621_100141280
571 Ga0097621_100170996
572 Ga0068871_100058178
573 Ga0068871_100113466
574 Ga0068871_101546954
575 Ga0075433_10094121
576 Ga0075434_100004695
577 Ga0075434_100021360
578 Ga0075434_100333632
579 Ga0075436_100025632
580 Ga0075436_100135687
581 Ga0075436_100479703
582 Ga0097620_100778911
583 Ga0097620_101800284
584 Ga0075435_100010048
585 Ga0075435_100018390
586 Ga0099794_10032796
587 Ga0105245_10183202
588 Ga0105247_10054863
589 Ga0105243_10673392
590 Ga0105241_10381943
591 Ga0105242_10442642
592 Ga0105248_10074258
593 Ga0105248_10315992
594 Ga0105248_12765961
595 Ga0105237_10223230
596 Ga0105238_10334844
597 Ga0105249_11981729
598 Ga0105239_10441274
599 Ga0105239_11968775
600 Ga0105246_10321047
601 Ga0157373_10740325
602 Ga0157371_10129714
603 Ga0157370_10207471
604 Ga0157369_10093377
605 Ga0157374_10254442
606 Ga0157378_10132819
607 Ga0157378_10727387
608 Ga0163162_10109610
609 Ga0163162_10560972
610 Ga0157372_10150076
611 Ga0157375_10026908
612 Ga0157375_10069865
613 Ga0157379_10162568
614 Ga0157376_10082098
615 Ga0157376_10500310
616 Ga0206349_1263956
617 Ga0206354_10337829
618 Ga0206353_10471335
619 Ga0213874_10398228
620 Ga0213875_10010321
621 Ga0213875_10248193
622 Ga0213875_10679073
623 Ga0224712_10530631
624 Ga0209759_1017949
625 Ga0207692_10003121
626 Ga0207692_10014551
627 Ga0207692_10691527
628 Ga0207642_10243277
629 Ga0207685_10025410
630 Ga0207699_10008827
631 Ga0207699_10016683
632 Ga0207699_10204567
633 Ga0207699_10665743
634 Ga0207705_10750169
635 Ga0207684_10003711
636 Ga0207684_10161975
637 Ga0207684_10200134
638 Ga0207684_10243962
639 Ga0207684_10326628
640 Ga0207684_10401930
641 Ga0207654_11361057
642 Ga0207707_10381040
643 Ga0207671_10248993
644 Ga0207693_10008049
645 Ga0207693_10080371
646 Ga0207693_10116423
647 Ga0207663_10002702
648 Ga0207663_10018358
649 Ga0207663_10318277
650 Ga0207663_10386775
651 Ga0207663_10768483
652 Ga0207660_10638746
653 Ga0207662_10016110
654 Ga0207657_10113507
655 Ga0207649_10301688
656 Ga0207652_10258722
657 Ga0207646_10005725
658 Ga0207646_10889183
659 Ga0207646_11734380
660 Ga0207694_10215009
661 Ga0207650_10493257
662 Ga0207659_10313845
663 Ga0207687_10022244
664 Ga0207700_10034053
665 Ga0207700_10039347
666 Ga0207700_10168860
667 Ga0207700_10323941
668 Ga0207700_10349990
669 Ga0207700_10831274
670 Ga0207664_10008008
671 Ga0207664_10009959
672 Ga0207664_10036701
673 Ga0207664_10618994
674 Ga0207644_10232840
675 Ga0207690_10259177
676 Ga0207686_10385762
677 Ga0207665_10002888
678 Ga0207665_10014771
679 Ga0207711_10435550
680 Ga0207711_10684910
681 Ga0207679_10254694
682 Ga0207712_10458056
683 Ga0207640_10604791
684 Ga0207677_10622508
685 Ga0207703_10415749
686 Ga0207639_10545044
687 Ga0207678_10238009
688 Ga0207708_11587116
689 Ga0207702_10019354
690 Ga0207702_10122862
691 Ga0207641_10297888
692 Ga0207676_11092032
693 Ga0207674_11123223
694 Ga0207675_100422170
695 Ga0207683_10076326
696 Ga0207698_10159538
697 Ga0207698_10198514
698 Ga0268266_10139675
699 Ga0268264_10651311
700 Ga0265327_10000177
701 Ga0307408_101151712
702 Ga0307408_101892298
703 Ga0307405_10227216
704 Ga0307405_11129470
705 Ga0307410_10228202
706 Ga0307410_10769961
707 Ga0307410_11619719
708 Ga0307407_10176315
709 Ga0307407_10345557
710 Ga0307412_11529540
711 Ga0307409_101031557
712 Ga0307409_101311292
713 Ga0307416_100385769
714 Ga0307416_102558041
715 Ga0373926_0024216
716 Ga0373934_0009605
717 Ga0373944_0038795
718 Ga0373923_0388028
719 Ga0373932_0070592
720 Ga0373936_0181869
721 Ga0373939_0016929
722 Ga0373939_0485160
723 Ga0373945_0240559
724 Ga0373953_0006761
725 Ga0373954_0026469
726 Ga0373956_0026504
727 Ga0373956_0640222
728 Ga0373957_0003523
729 Ga0373943_0065399
730 Ga0373946_0042846
731 Ga0373946_0347079
732 Ga0373946_0352045
733 Ga0373955_0004918
734 Ga0373955_0196994
735 Ga0373942_0087872
736 Ga0373924_0032618
737 Ga0373931_0058776
738 Ga0373931_0640855
739 Ga0373935_0008073
740 Ga0373935_0417486
741 Ga0373927_0779934
742 Ga0373933_0002474
743 Ga0373947_0073566
744 Ga0373947_0489083
745 Ga0373947_0496710
746 Ga0373947_0551371
747 Ga0373937_0003332
748 Ga0373925_0054399
749 Ga0373925_0091625
750 Ga0395900_1217403
751 Ga0395898_0355631
752 Ga0395898_0732695
753 Ga0395898_0851001
754 Ga0395898_1382359
755 Ga0436364_0033240
756 Ga0436364_0047636
757 Ga0436364_0681249
758 Ga0436364_0903400
759 Ga0436364_1195756
760 Ga0395901_0507584
761 Ga0395901_0728365
762 Ga0436365_1758254
763 Ga0436363_0510064
764 Ga0436363_0641316
765 Ga0451791_0966444
766 Ga0451797_0385559
767 Ga0495592_0015391
768 Ga0495592_0147334
769 Ga0495629_0006346
770 Ga0495641_0032610
771 Ga0495651_0060098
772 Ga0495651_0712312
773 Ga0495653_0016514
774 Ga0495580_0485195
775 Ga0495582_0024400
776 Ga0495639_0021118
777 Ga0495639_0070202
778 Ga0495639_0607689
779 Ga0495662_0007111
780 Ga0495664_0044053
781 Ga0495664_0094903
782 Ga0495608_0009487
783 Ga0495618_0065286
784 Ga0495618_0365187
785 Ga0495628_0013150
786 Ga0495628_0120991
787 Ga0495628_0292511
788 Ga0495628_0544243
789 Ga0495630_0008974
790 Ga0495630_0316469
791 Ga0495652_0089887
792 Ga0495652_0219803
793 Ga0495652_0223304
794 Ga0495665_0304209
795 Ga0495640_0130671
796 Ga0495586_0163063
797 Ga0495587_0006894
798 Ga0495587_0741993
799 Ga0495609_0001500
800 Ga0495645_0012252
801 Ga0495645_0071809
802 Ga0495645_0143748
803 Ga0495645_0481476
804 Ga0495667_0009353
805 Ga0495634_0016156
806 Ga0495635_0037438
807 Ga0495588_0613784
808 Ga0495657_0011413
809 Ga0495599_0007468
810 Ga0495599_0290067
811 Ga0495623_0035059
812 Ga0495646_0008780
813 Ga0495646_0593450
814 Ga0495647_0340531
815 Ga0495658_0043764
816 Ga0495613_0591881
817 Ga0495624_0179548
818 Ga0495624_0392287
819 Ga0495649_0623929
820 Ga0495600_0005958
821 Ga0495581_0003273
822 Ga0495581_0061496
823 Ga0495581_0202537
824 Ga0495604_0016503
825 Ga0495604_0332470
826 Ga0495604_0843017
827 Ga0495674_0023142
828 Ga0495674_0138870
829 Ga0495674_0638557
830 Ga0495676_0656425
831 Ga0495680_0010212
832 Ga0495680_0261314
833 Ga0495680_0733513
834 Ga0495675_0065329
835 Ga0495684_0042168
836 Ga0495684_0360592
837 Ga0495593_0086245
838 Ga0495602_0018531
839 Ga0495602_0191314
840 Ga0496100_0052351
841 Ga0496100_0144632
842 Ga0496100_0174549
843 Ga0496101_0127427
844 Ga0496101_0543561
845 Ga0496102_0027577
846 Ga0496102_0045531
847 Ga0496102_0196207
848 Ga0496102_0329921
849 Ga0496103_0028783
850 Ga0496103_0157063
851 Ga0496103_0212163
852 Ga0496104_0049727
853 Ga0496104_0131670
854 Ga0496105_0025783
855 Ga0496105_0027187
856 Ga0496106_0047975
857 Ga0496107_0047566
858 Ga0496107_0109174
859 Ga0496108_0017211
860 Ga0496108_0252132
861 Ga0496109_0064119
862 Ga0496109_0381019
863 Ga0496110_0022327
864 Ga0496110_0037289
865 Ga0496110_1537416
866 Ga0496110_1552423
867 Ga0496111_0018932
868 Ga0496111_0025303
869 Ga0496112_0047617
870 Ga0496112_0157953
871 Ga0496112_0382114
872 Ga0496113_0009467
873 Ga0496113_0018642
874 Ga0496113_0616970
875 Ga0496113_0706781
876 Ga0496114_0033838
877 Ga0496114_0150430
878 Ga0496115_0115984
879 Ga0496115_0432209
880 Ga0496115_0943495
881 Ga0501032_0100036
882 Ga0501033_0000814
883 Ga0501033_0341859
884 Ga0501034_0420975
885 Ga0501036_0273792
886 Ga0501037_0022438
887 Ga0501038_0037427
888 Ga0501040_0020658
889 Ga0501041_0063324
890 Ga0501042_0015333
891 Ga0501046_0072811
892 Ga0501048_0009599
893 Ga0501068_0016865
894 Ga0501070_0286525
895 Ga0501071_0036184
896 Ga0501072_0015028
897 Ga0501073_0250656
898 Ga0501074_0111106
899 Ga0501076_0021965
900 Ga0501077_0015968
901 Ga0501079_0063559
902 Ga0501080_0081458
903 Ga0501081_0313662
904 Ga0501279_105429
905 Ga0501035_0059178
906 Ga0501044_0004887
907 Ga0501044_0192239
908 Ga0501045_0203349
909 nmdc:mga0yw44_1157260_c1
910 nmdc:mga08y16_1235983_c1
911 nmdc:mga0n895_1063411_c1
912 nmdc:mga0n895_164687_c1
913 nmdc:mga0n895_239234_c1
914 nmdc:mga0n895_4006_c1
915 nmdc:mga0rr50_12013_c1
916 nmdc:mga0rr50_38290_c1
917 nmdc:mga08x19_17225_c1
918 nmdc:mga08x19_32818_c1
919 nmdc:mga08x19_672085_c1
920 nmdc:mga0a205_16620_c1
921 nmdc:mga0a205_51255_c1
922 Ga0495601_0025366
923 Ga0495601_0245469
924 Ga0495612_0009011
925 Ga0495595_0020095
926 Ga0495619_0058359
927 Ga0501084_0607001
928 Ga0501082_0176963
929 Ga0530510_0107413
930 2774903728
931 2904779289
932 8054472963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

14

94

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g5o-assembly1.cif.gz_B the crystal structure of the toxin-antitoxin complex relbe2 (rv2865-2866) from mycobacterium tuberculosis 0.9779 4 84
3g5o-assembly1.cif.gz_B the crystal structure of the toxin-antitoxin complex relbe2 (rv2865-2866) from mycobacterium tuberculosis 0.9662 4 84
3g5o-assembly1.cif.gz_C the crystal structure of the toxin-antitoxin complex relbe2 (rv2865-2866) from mycobacterium tuberculosis 0.9599 5 86
2khe-assembly1.cif.gz_A solution structure of the bacterial toxin rele from thermus thermophilus hb8 0.9168 4 89
3g5o-assembly1.cif.gz_C the crystal structure of the toxin-antitoxin complex relbe2 (rv2865-2866) from mycobacterium tuberculosis 0.8957 5 86
ID Description Score Start End Superfamily
3g5oB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9779 4 84 3.30.2310.20
3g5oB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9662 4 84 3.30.2310.20
af_A0A0P0W3X0_152_455_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.9367 55 84 2.120.10.80
2kheA00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9168 4 89 3.30.2310.20
2kheA00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8783 4 89 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A7I7JUA6-F1-model_v4 Toxin RelG 0.9876 4 83
AF-A0A841NLX8-F1-model_v4 deleted 0.9844 2 91
AF-A0A501NZT0-F1-model_v4 deleted 0.9828 2 85
AF-A0A1B2UCE7-F1-model_v4 deleted 0.9782 21 89
AF-A0A1X6WSU2-F1-model_v4 RelE/StbE replicon stabilization toxin 0.9754 4 89

Map