F449507

General Info

Members Datasets Scaffolds Average Seq Length
465 238 462 105

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100666838|Ga0307409_1006668382
Length 116
Sequence MDEGVVWLTIFILSVFVGIEVISKVSSTLHTPLMSGANAIHGVILLGAIIVTGSTDNDLALVVGLVAIVLAAVNMVGGFLVTDRMLQMFVRKKPGTRGAPPPVDPPNAPGVKGVGR

Samples

Sample ID Description Type Environment
1 2643221615 Nocardioides sp. Root224 Isolate Unclassified
2 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
3 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
4 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
146 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
147 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
148 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
149 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
153 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
154 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
157 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
158 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
161 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
162 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
163 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
164 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
231 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
234 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0.86
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.55
Nodule 0
Rhizoplane 10.75
Rhizosphere 73.55
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1041248 3300000549 Bacteria 547
2 JGI24740J21852_10057100 3300001979 Bacteria 1091
3 JGI24735J21928_10024731 3300002067 Bacteria 1815
4 JGI24735J21928_10094479 3300002067 Bacteria 858
5 JGI24749J21850_1005538 3300002076 Bacteria 1768
6 Ga0070658_10064750 3300005327 Bacteria 2982
7 Ga0070658_10113522 3300005327 Bacteria 2246
8 Ga0070676_10452765 3300005328 Bacteria 903
9 Ga0070683_100056520 3300005329 Bacteria 3644
10 Ga0070683_100122527 3300005329 Bacteria 2457
11 Ga0070683_100565009 3300005329 Bacteria 1088
12 Ga0070670_100428610 3300005331 Bacteria 1170
13 Ga0070677_10194311 3300005333 Bacteria 975
14 Ga0070666_11317060 3300005335 Bacteria 539
15 Ga0070680_100333363 3300005336 Bacteria 1289
16 Ga0070682_100146011 3300005337 Bacteria 1618
17 Ga0068868_100271773 3300005338 Bacteria 1432
18 Ga0068868_101344693 3300005338 Bacteria 665
19 Ga0070660_100010069 3300005339 Bacteria 6669
20 Ga0070660_100363680 3300005339 Bacteria 1193
21 Ga0070687_100942058 3300005343 Bacteria 622
22 Ga0070661_100271354 3300005344 Bacteria 1314
23 Ga0070692_10354595 3300005345 Bacteria 912
24 Ga0070668_100161627 3300005347 Bacteria 1818
25 Ga0070668_100614737 3300005347 Bacteria 952
26 Ga0070675_100011234 3300005354 Bacteria 7011
27 Ga0070675_100453861 3300005354 Bacteria 1150
28 Ga0070671_100323652 3300005355 Bacteria 1314
29 Ga0070674_100016325 3300005356 Bacteria 4654
30 Ga0070688_100803482 3300005365 Bacteria 736
31 Ga0070688_101338159 3300005365 Bacteria 579
32 Ga0070659_100006440 3300005366 Bacteria 8476
33 Ga0070659_101880072 3300005366 Bacteria 537
34 Ga0070667_100228839 3300005367 Bacteria 1657
35 Ga0070667_100571983 3300005367 Bacteria 1040
36 Ga0070705_101261789 3300005440 Bacteria 611
37 Ga0070700_100000740 3300005441 Bacteria 16100
38 Ga0070700_100071374 3300005441 Bacteria 2217
39 Ga0070663_100393742 3300005455 Bacteria 1131
40 Ga0070663_101030324 3300005455 Bacteria 717
41 Ga0070663_101234615 3300005455 Bacteria 658
42 Ga0070663_101884825 3300005455 Bacteria 537
43 Ga0070678_100134050 3300005456 Bacteria 1973
44 Ga0070662_100251457 3300005457 Bacteria 1421
45 Ga0070662_100469973 3300005457 Bacteria 1046
46 Ga0070681_10096346 3300005458 Bacteria 2907
47 Ga0070681_10215408 3300005458 Bacteria 1837
48 Ga0068867_100017913 3300005459 Bacteria 5032
49 Ga0068867_100178568 3300005459 Bacteria 1687
50 Ga0070684_100394899 3300005535 Bacteria 1275
51 Ga0070684_101080977 3300005535 Bacteria 754
52 Ga0068853_101110487 3300005539 Bacteria 763
53 Ga0070672_100013287 3300005543 Bacteria 5811
54 Ga0070672_100253189 3300005543 Bacteria 1483
55 Ga0070693_100372591 3300005547 Bacteria 983
56 Ga0070693_101068995 3300005547 Bacteria 614
57 Ga0070665_100001227 3300005548 Bacteria 31181
58 Ga0070665_101669479 3300005548 Bacteria 645
59 Ga0068855_100209850 3300005563 Bacteria 2189
60 Ga0068855_100838364 3300005563 Bacteria 975
61 Ga0070664_100008827 3300005564 Bacteria 8168
62 Ga0068857_101257593 3300005577 Bacteria 718
63 Ga0068854_100364287 3300005578 Bacteria 1187
64 Ga0068854_100540491 3300005578 Bacteria 987
65 Ga0070702_100002716 3300005615 Bacteria 7731
66 Ga0070702_100204535 3300005615 Bacteria 1309
67 Ga0070702_101498996 3300005615 Bacteria 555
68 Ga0068852_100001760 3300005616 Bacteria 14741
69 Ga0068852_102367937 3300005616 Bacteria 552
70 Ga0068859_101259224 3300005617 Bacteria 815
71 Ga0068864_100226913 3300005618 Bacteria 1726
72 Ga0068864_101683329 3300005618 Bacteria 639
73 Ga0068866_10100929 3300005718 Bacteria 1592
74 Ga0068866_10225273 3300005718 Bacteria 1134
75 Ga0068861_100003636 3300005719 Bacteria 10276
76 Ga0068861_100308295 3300005719 Bacteria 1374
77 Ga0068870_10348264 3300005840 Bacteria 950
78 Ga0068870_10689033 3300005840 Bacteria 704
79 Ga0068863_101023762 3300005841 Bacteria 829
80 Ga0068863_101916723 3300005841 Bacteria 603
81 Ga0068862_100309184 3300005844 Bacteria 1456
82 Ga0068862_101714242 3300005844 Bacteria 637
83 Ga0081455_10768147 3300005937 Bacteria 608
84 Ga0075365_10000217 3300006038 Bacteria 19371
85 Ga0075365_10049880 3300006038 Bacteria 2759
86 Ga0075365_10057198 3300006038 Bacteria 2594
87 Ga0075365_10059058 3300006038 Bacteria 2555
88 Ga0075365_10150713 3300006038 Bacteria 1618
89 Ga0075365_10273029 3300006038 Bacteria 1189
90 Ga0075365_10535114 3300006038 Bacteria 829
91 Ga0075365_10831409 3300006038 Bacteria 651
92 Ga0075365_10840925 3300006038 Bacteria 647
93 Ga0075368_10000161 3300006042 Bacteria 18131
94 Ga0075368_10000549 3300006042 Bacteria 11253
95 Ga0075368_10040181 3300006042 Bacteria 1836
96 Ga0075363_100002462 3300006048 Bacteria 7571
97 Ga0075363_100006094 3300006048 Bacteria 5441
98 Ga0075363_100013161 3300006048 Bacteria 4001
99 Ga0075363_100385112 3300006048 Bacteria 822
100 Ga0075364_10372772 3300006051 Bacteria 973
101 Ga0075364_10493173 3300006051 Bacteria 837
102 Ga0075364_10683630 3300006051 Bacteria 700
103 Ga0075362_10000541 3300006177 Bacteria 11020
104 Ga0075367_10001033 3300006178 Bacteria 11483
105 Ga0075367_10008197 3300006178 Bacteria 5400
106 Ga0075367_10010790 3300006178 Bacteria 4812
107 Ga0075370_10000336 3300006353 Bacteria 16950
108 Ga0075370_10161155 3300006353 Bacteria 1316
109 Ga0068871_101915155 3300006358 Bacteria 564
110 Ga0068871_101936121 3300006358 Bacteria 561
111 Ga0068871_101989998 3300006358 Bacteria 553
112 Ga0068865_101043162 3300006881 Bacteria 718
113 Ga0097620_101258777 3300006931 Bacteria 815
114 Ga0105245_10018413 3300009098 Bacteria 6106
115 Ga0105245_12268464 3300009098 Bacteria 597
116 Ga0105243_10001097 3300009148 Bacteria 24667
117 Ga0105243_10193145 3300009148 Bacteria 1780
118 Ga0105243_12791803 3300009148 Bacteria 529
119 Ga0105241_11173825 3300009174 Bacteria 726
120 Ga0105241_11953203 3300009174 Bacteria 576
121 Ga0105242_11029252 3300009176 Bacteria 833
122 Ga0105242_11513363 3300009176 Bacteria 702
123 Ga0105248_10038508 3300009177 Bacteria 5351
124 Ga0105248_12647887 3300009177 Bacteria 572
125 Ga0105238_10309233 3300009551 Bacteria 1565
126 Ga0105238_11885428 3300009551 Bacteria 630
127 Ga0105238_12688005 3300009551 Bacteria 534
128 Ga0105249_10006479 3300009553 Bacteria 10183
129 Ga0105249_10344876 3300009553 Bacteria 1507
130 Ga0105249_10996915 3300009553 Bacteria 906
131 Ga0105239_10486906 3300010375 Bacteria 1402
132 Ga0105239_11101839 3300010375 Bacteria 914
133 Ga0105239_12393164 3300010375 Bacteria 615
134 Ga0105246_10397723 3300011119 Bacteria 1143
135 Ga0105246_10766512 3300011119 Bacteria 853
136 Ga0157336_1035933 3300012477 Bacteria 515
137 Ga0157371_11300069 3300013102 Bacteria 563
138 Ga0157370_10318436 3300013104 Bacteria 1435
139 Ga0157370_10971053 3300013104 Bacteria 770
140 Ga0157369_11132341 3300013105 Bacteria 800
141 Ga0163162_10843257 3300013306 Bacteria 1032
142 Ga0157372_10087765 3300013307 Bacteria 3530
143 Ga0157372_10947064 3300013307 Bacteria 998
144 Ga0157372_11423932 3300013307 Bacteria 799
145 Ga0157372_11455135 3300013307 Bacteria 789
146 Ga0157375_10159143 3300013308 Bacteria 2399
147 Ga0157375_10585135 3300013308 Bacteria 1276
148 Ga0157375_10786790 3300013308 Bacteria 1101
149 Ga0157375_11219868 3300013308 Bacteria 883
150 Ga0157375_12075170 3300013308 Bacteria 676
151 Ga0163163_10356142 3300014325 Bacteria 1520
152 Ga0163163_10537614 3300014325 Bacteria 1231
153 Ga0163163_11032717 3300014325 Bacteria 885
154 Ga0163163_11435161 3300014325 Bacteria 752
155 Ga0157380_10000905 3300014326 Bacteria 18678
156 Ga0157380_10856754 3300014326 Bacteria 931
157 Ga0157377_10038440 3300014745 Bacteria 2642
158 Ga0157379_10229843 3300014968 Bacteria 1681
159 Ga0157379_10882591 3300014968 Bacteria 847
160 Ga0157376_11023847 3300014969 Bacteria 849
161 Ga0163161_10001854 3300017792 Bacteria 15446
162 Ga0163161_10242720 3300017792 Bacteria 1401
163 Ga0163161_11156324 3300017792 Bacteria 667
164 Ga0207697_10079581 3300025315 Bacteria 1380
165 Ga0207682_10064872 3300025893 Bacteria 1536
166 Ga0207642_10081982 3300025899 Bacteria 1569
167 Ga0207688_10008122 3300025901 Bacteria 5703
168 Ga0207688_10423525 3300025901 Bacteria 828
169 Ga0207647_10024052 3300025904 Bacteria 4019
170 Ga0207647_10104711 3300025904 Bacteria 1676
171 Ga0207645_10936468 3300025907 Bacteria 588
172 Ga0207643_10034345 3300025908 Bacteria 2842
173 Ga0207643_10077268 3300025908 Bacteria 1925
174 Ga0207705_10051474 3300025909 Bacteria 2964
175 Ga0207705_10540678 3300025909 Bacteria 906
176 Ga0207707_10045696 3300025912 Bacteria 3816
177 Ga0207707_10215647 3300025912 Bacteria 1671
178 Ga0207660_10313058 3300025917 Bacteria 1252
179 Ga0207662_10028314 3300025918 Bacteria 3238
180 Ga0207662_10516537 3300025918 Bacteria 824
181 Ga0207657_10032835 3300025919 Bacteria 4684
182 Ga0207657_10676631 3300025919 Bacteria 802
183 Ga0207657_10923580 3300025919 Bacteria 672
184 Ga0207649_10473506 3300025920 Bacteria 949
185 Ga0207649_11007159 3300025920 Bacteria 656
186 Ga0207652_10116892 3300025921 Bacteria 2370
187 Ga0207652_10503956 3300025921 Bacteria 1090
188 Ga0207681_10142427 3300025923 Bacteria 1787
189 Ga0207650_10446297 3300025925 Bacteria 1076
190 Ga0207650_10594133 3300025925 Bacteria 930
191 Ga0207659_10243521 3300025926 Bacteria 1456
192 Ga0207687_10068405 3300025927 Bacteria 2530
193 Ga0207687_10097952 3300025927 Bacteria 2152
194 Ga0207687_10338100 3300025927 Bacteria 1223
195 Ga0207644_10244057 3300025931 Bacteria 1431
196 Ga0207690_10013489 3300025932 Bacteria 4911
197 Ga0207690_11214736 3300025932 Bacteria 630
198 Ga0207690_11704611 3300025932 Bacteria 526
199 Ga0207706_10253501 3300025933 Bacteria 1537
200 Ga0207706_10289420 3300025933 Bacteria 1428
201 Ga0207706_10430605 3300025933 Bacteria 1142
202 Ga0207686_11736481 3300025934 Bacteria 516
203 Ga0207709_10031923 3300025935 Bacteria 3081
204 Ga0207709_10228438 3300025935 Bacteria 1347
205 Ga0207709_10390602 3300025935 Bacteria 1061
206 Ga0207670_10370022 3300025936 Bacteria 1139
207 Ga0207669_10175765 3300025937 Bacteria 1529
208 Ga0207669_10472219 3300025937 Bacteria 998
209 Ga0207669_11402232 3300025937 Bacteria 595
210 Ga0207704_10012013 3300025938 Bacteria 4285
211 Ga0207704_10615948 3300025938 Bacteria 890
212 Ga0207691_10250484 3300025940 Bacteria 1529
213 Ga0207711_10433935 3300025941 Bacteria 1222
214 Ga0207661_10065637 3300025944 Bacteria 2947
215 Ga0207661_10077198 3300025944 Bacteria 2738
216 Ga0207679_10042113 3300025945 Bacteria 3280
217 Ga0207667_10948769 3300025949 Bacteria 850
218 Ga0207712_10011831 3300025961 Bacteria 5563
219 Ga0207668_10291960 3300025972 Bacteria 1342
220 Ga0207668_10760917 3300025972 Bacteria 855
221 Ga0207668_11447591 3300025972 Bacteria 620
222 Ga0207640_10978025 3300025981 Bacteria 743
223 Ga0207640_11390397 3300025981 Bacteria 628
224 Ga0207658_10216510 3300025986 Bacteria 1608
225 Ga0207658_11311148 3300025986 Bacteria 662
226 Ga0207658_12153825 3300025986 Bacteria 506
227 Ga0207677_10857396 3300026023 Bacteria 816
228 Ga0207639_10431147 3300026041 Bacteria 1194
229 Ga0207678_10023921 3300026067 Bacteria 5341
230 Ga0207678_10788096 3300026067 Bacteria 839
231 Ga0207678_10909845 3300026067 Bacteria 778
232 Ga0207678_10974133 3300026067 Bacteria 750
233 Ga0207678_11041974 3300026067 Bacteria 724
234 Ga0207708_10007914 3300026075 Bacteria 7879
235 Ga0207708_10100479 3300026075 Bacteria 2238
236 Ga0207702_11867104 3300026078 Bacteria 592
237 Ga0207641_11836574 3300026088 Bacteria 608
238 Ga0207648_10000833 3300026089 Bacteria 34734
239 Ga0207648_10128281 3300026089 Bacteria 2232
240 Ga0207676_11204503 3300026095 Bacteria 751
241 Ga0207674_10934277 3300026116 Bacteria 836
242 Ga0207674_10982273 3300026116 Bacteria 813
243 Ga0207675_100005432 3300026118 Bacteria 12212
244 Ga0207675_100345221 3300026118 Bacteria 1458
245 Ga0207675_100357529 3300026118 Bacteria 1432
246 Ga0207675_100838831 3300026118 Bacteria 934
247 Ga0207675_101722645 3300026118 Bacteria 646
248 Ga0207683_10132031 3300026121 Bacteria 2246
249 Ga0207683_10197860 3300026121 Bacteria 1826
250 Ga0207683_10486347 3300026121 Bacteria 1139
251 Ga0207683_11094421 3300026121 Bacteria 739
252 Ga0207698_10066379 3300026142 Bacteria 2840
253 Ga0209813_10001305 3300027866 Bacteria 5568
254 Ga0209813_10001430 3300027866 Bacteria 5399
255 Ga0209813_10506510 3300027866 Bacteria 502
256 Ga0268266_10012438 3300028379 Bacteria 7357
257 Ga0268266_11486690 3300028379 Bacteria 653
258 Ga0268265_11368653 3300028380 Bacteria 709
259 Ga0307408_101212827 3300031548 Bacteria 704
260 Ga0307405_10187746 3300031731 Bacteria 1490
261 Ga0307410_10533557 3300031852 Bacteria 970
262 Ga0307409_100145119 3300031995 Bacteria 2051
263 Ga0307409_100316271 3300031995 Bacteria 1459
264 Ga0307409_100666838 3300031995 Bacteria 1036
265 Ga0307409_101303476 3300031995 Bacteria 751
266 Ga0307409_101829814 3300031995 Bacteria 636
267 Ga0307416_102443645 3300032002 Bacteria 622
268 Ga0307414_11121726 3300032004 Bacteria 727
269 Ga0307411_11312877 3300032005 Bacteria 659
270 Ga0307415_100484836 3300032126 Bacteria 1077
271 Ga0307415_100747749 3300032126 Bacteria 887
272 Ga0307415_102073223 3300032126 Bacteria 555
273 Ga0436365_0637794 3300039437 Bacteria 2496
274 Ga0439438_102603 3300041405 Bacteria 693
275 Ga0439447_067949 3300041407 Bacteria 831
276 Ga0439461_0134748 3300041410 Bacteria 627
277 Ga0451787_543236 3300041441 Bacteria 835
278 Ga0451789_0021329 3300041443 Bacteria 829
279 Ga0451789_0724329 3300041443 Bacteria 894
280 Ga0451791_0507742 3300041451 Bacteria 696
281 Ga0451793_0228260 3300041452 Bacteria 658
282 Ga0451797_0204946 3300041453 Bacteria 507
283 Ga0451798_0456571 3300041458 Bacteria 536
284 Ga0451804_0937464 3300041463 Bacteria 530
285 Ga0451804_1125701 3300041463 Bacteria 722
286 Ga0451807_1844114 3300041486 Bacteria 776
287 Ga0451807_1971552 3300041486 Bacteria 623
288 Ga0451807_1994375 3300041486 Bacteria 547
289 Ga0451807_2359182 3300041486 Bacteria 536
290 Ga0451833_0657918 3300041491 Bacteria 656
291 Ga0451837_0872629 3300041494 Bacteria 727
292 Ga0451851_0908655 3300041507 Bacteria 1057
293 Ga0451853_1771630 3300041512 Bacteria 575
294 Ga0451853_2361913 3300041512 Bacteria 922
295 Ga0451853_3090196 3300041512 Bacteria 633
296 Ga0439433_0124745 3300041999 Bacteria 651
297 Ga0439442_061066 3300042002 Bacteria 799
298 Ga0439457_137104 3300042014 Bacteria 584
299 Ga0439463_083123 3300042016 Bacteria 824
300 Ga0450907_046436 3300042146 Bacteria 746
301 Ga0439446_0004964 3300042156 Bacteria 3402
302 Ga0439434_0000731 3300042435 Bacteria 9400
303 Ga0439464_0050637 3300042439 Bacteria 1200
304 Ga0466963_0051283 3300044694 Bacteria 2735
305 Ga0466963_0102255 3300044694 Bacteria 1962
306 Ga0466963_0595113 3300044694 Bacteria 781
307 Ga0466964_0186718 3300044706 Bacteria 986
308 Ga0466964_0436635 3300044706 Bacteria 691
309 Ga0466964_0615255 3300044706 Bacteria 597
310 Ga0466960_0264675 3300044901 Bacteria 959
311 Ga0466967_0013579 3300045976 Bacteria 6300
312 Ga0466967_0056427 3300045976 Bacteria 3463
313 Ga0466967_0207378 3300045976 Bacteria 1858
314 Ga0466967_0241982 3300045976 Bacteria 1721
315 Ga0466967_0284026 3300045976 Bacteria 1588
316 Ga0466967_0335682 3300045976 Bacteria 1460
317 Ga0466967_0762203 3300045976 Bacteria 960
318 Ga0466967_1383732 3300045976 Bacteria 701
319 Ga0495603_0058065 3300046455 Bacteria 2289
320 Ga0495641_0424610 3300046461 Bacteria 604
321 Ga0495651_0765616 3300046462 Bacteria 598
322 Ga0495653_0329257 3300046463 Bacteria 988
323 Ga0495639_0133474 3300046475 Bacteria 1190
324 Ga0495645_0751723 3300046543 Bacteria 588
325 Ga0495635_0158163 3300046663 Bacteria 1542
326 Ga0495600_0325172 3300046809 Bacteria 967
327 Ga0495674_0176364 3300047319 Bacteria 1781
328 Ga0495676_0496928 3300047321 Bacteria 801
329 Ga0496100_0494223 3300048903 Bacteria 942
330 Ga0496100_0765961 3300048903 Bacteria 755
331 Ga0496101_0087728 3300048904 Bacteria 2310
332 Ga0496101_0382019 3300048904 Bacteria 1108
333 Ga0496101_0536533 3300048904 Bacteria 925
334 Ga0496102_0183958 3300048905 Bacteria 1969
335 Ga0496102_0845397 3300048905 Bacteria 837
336 Ga0496107_0314793 3300048910 Bacteria 1165
337 Ga0496107_0320328 3300048910 Bacteria 1154
338 Ga0496107_0322124 3300048910 Bacteria 1150
339 Ga0496108_0138373 3300048911 Bacteria 2097
340 Ga0496108_0295218 3300048911 Bacteria 1411
341 Ga0496108_0319372 3300048911 Bacteria 1354
342 Ga0496108_0389624 3300048911 Bacteria 1217
343 Ga0496108_0580528 3300048911 Bacteria 977
344 Ga0496109_0051029 3300048912 Bacteria 3767
345 Ga0496109_0180176 3300048912 Bacteria 1984
346 Ga0496109_0628674 3300048912 Bacteria 1010
347 Ga0496109_0671771 3300048912 Bacteria 973
348 Ga0496109_0982005 3300048912 Bacteria 782
349 Ga0496109_1800838 3300048912 Bacteria 545
350 Ga0496110_0161579 3300048913 Bacteria 2031
351 Ga0496110_0179551 3300048913 Bacteria 1922
352 Ga0496110_0353403 3300048913 Bacteria 1339
353 Ga0496110_0687606 3300048913 Bacteria 924
354 Ga0496110_0722709 3300048913 Bacteria 898
355 Ga0496111_0121978 3300048914 Bacteria 1925
356 Ga0496111_1308144 3300048914 Bacteria 510
357 Ga0496112_0163753 3300048915 Bacteria 2190
358 Ga0496113_0258447 3300048916 Bacteria 1391
359 Ga0496113_0393678 3300048916 Bacteria 1112
360 Ga0496114_0003516 3300048917 Bacteria 12024
361 Ga0496114_0260239 3300048917 Bacteria 1528
362 Ga0496114_0288601 3300048917 Bacteria 1447
363 Ga0496114_0578502 3300048917 Bacteria 991
364 Ga0496114_0884903 3300048917 Bacteria 774
365 Ga0496114_1728110 3300048917 Bacteria 514
366 Ga0501031_0001660 3300049568 Bacteria 13964
367 Ga0501031_0179933 3300049568 Bacteria 1381
368 Ga0501032_0243039 3300049569 Bacteria 1169
369 Ga0501033_0276964 3300049570 Bacteria 1185
370 Ga0501036_0002593 3300049572 Bacteria 14240
371 Ga0501036_0646424 3300049572 Bacteria 876
372 Ga0501037_0181990 3300049573 Bacteria 1491
373 Ga0501038_0133860 3300049574 Bacteria 2032
374 Ga0501039_0006187 3300049575 Bacteria 9086
375 Ga0501039_0549494 3300049575 Bacteria 906
376 Ga0501039_1315046 3300049575 Bacteria 557
377 Ga0501040_0007663 3300049576 Bacteria 6987
378 Ga0501041_0100319 3300049577 Bacteria 1792
379 Ga0501041_0100564 3300049577 Bacteria 1789
380 Ga0501041_0385785 3300049577 Bacteria 887
381 Ga0501042_0038551 3300049578 Bacteria 3393
382 Ga0501042_0510999 3300049578 Bacteria 873
383 Ga0501046_0550154 3300049580 Bacteria 823
384 Ga0501048_0124401 3300049582 Bacteria 1823
385 Ga0501048_0933675 3300049582 Bacteria 624
386 Ga0501067_0531724 3300049583 Bacteria 658
387 Ga0501068_0052760 3300049584 Bacteria 2461
388 Ga0501068_0069662 3300049584 Bacteria 2145
389 Ga0501068_0247880 3300049584 Bacteria 1135
390 Ga0501069_0017566 3300049585 Bacteria 3853
391 Ga0501069_0050464 3300049585 Bacteria 2313
392 Ga0501070_0025451 3300049586 Bacteria 4963
393 Ga0501070_0092882 3300049586 Bacteria 2497
394 Ga0501070_0094935 3300049586 Bacteria 2468
395 Ga0501070_0116329 3300049586 Bacteria 2208
396 Ga0501070_0245671 3300049586 Bacteria 1465
397 Ga0501070_0284142 3300049586 Bacteria 1350
398 Ga0501070_0856016 3300049586 Bacteria 711
399 Ga0501071_0009568 3300049587 Bacteria 6462
400 Ga0501072_0033974 3300049588 Bacteria 3995
401 Ga0501072_0102397 3300049588 Bacteria 2276
402 Ga0501072_0297904 3300049588 Bacteria 1282
403 Ga0501073_0152507 3300049589 Bacteria 1601
404 Ga0501074_0069832 3300049590 Bacteria 2526
405 Ga0501074_0157242 3300049590 Bacteria 1623
406 Ga0501074_0578962 3300049590 Bacteria 794
407 Ga0501075_0034178 3300049591 Bacteria 3784
408 Ga0501076_0002458 3300049592 Bacteria 12728
409 Ga0501077_0094435 3300049593 Bacteria 1896
410 Ga0501079_0110857 3300049741 Bacteria 2132
411 Ga0501079_0160102 3300049741 Bacteria 1755
412 Ga0501079_1213411 3300049741 Bacteria 594
413 Ga0501079_1224961 3300049741 Bacteria 591
414 Ga0501080_0100211 3300049742 Bacteria 2688
415 Ga0501083_0372896 3300049744 Bacteria 928
416 Ga0501035_0083205 3300049822 Bacteria 2824
417 Ga0501044_0891503 3300049823 Bacteria 765
418 Ga0501045_0007775 3300049824 Bacteria 7456
419 Ga0501045_0176076 3300049824 Bacteria 1594
420 Ga0501045_0599265 3300049824 Bacteria 816
421 nmdc:mga03683_5657_c1 3300050489 Bacteria 4233
422 nmdc:mga03n38_131775_c1 3300050490 Bacteria 1240
423 nmdc:mga03n38_203541_c1 3300050490 Bacteria 1026
424 nmdc:mga03n38_258206_c1 3300050490 Bacteria 923
425 nmdc:mga00v17_120273_c1 3300050491 Bacteria 1671
426 nmdc:mga00v17_142544_c1 3300050491 Bacteria 1537
427 nmdc:mga00v17_152005_c1 3300050491 Bacteria 1488
428 nmdc:mga00v17_705833_c1 3300050491 Bacteria 646
429 nmdc:mga0yw44_106020_c1 3300050492 Bacteria 1796
430 nmdc:mga0yw44_123320_c1 3300050492 Bacteria 1671
431 nmdc:mga0yw44_124723_c1 3300050492 Bacteria 1662
432 nmdc:mga0yw44_128701_c1 3300050492 Bacteria 1637
433 nmdc:mga0yw44_13531_c1 3300050492 Bacteria 4301
434 nmdc:mga0yw44_29267_c1 3300050492 Bacteria 3178
435 nmdc:mga0yw44_357339_c1 3300050492 Bacteria 984
436 nmdc:mga0yw44_534535_c1 3300050492 Bacteria 796
437 nmdc:mga0yw44_58790_c1 3300050492 Bacteria 2350
438 nmdc:mga0yw44_601743_c1 3300050492 Bacteria 747
439 nmdc:mga0yw44_704545_c1 3300050492 Bacteria 686
440 nmdc:mga0yw44_721822_c1 3300050492 Bacteria 677
441 nmdc:mga06z11_1033_c1 3300050494 Bacteria 10131
442 nmdc:mga06z11_11644_c1 3300050494 Bacteria 3801
443 nmdc:mga06z11_79522_c2 3300050494 Bacteria 954
444 nmdc:mga04h51_170575_c1 3300050495 Bacteria 842
445 nmdc:mga04h51_19900_c1 3300050495 Bacteria 1997
446 nmdc:mga04h51_20053_c1 3300050495 Bacteria 1991
447 nmdc:mga07m45_287582_c1 3300050496 Bacteria 956
448 nmdc:mga07m45_48678_c1 3300050496 Bacteria 2384
449 nmdc:mga07m45_7893_c1 3300050496 Bacteria 5449
450 Ga0495619_0198637 3300053085 Bacteria 1388
451 Ga0495619_0248245 3300053085 Bacteria 1233
452 Ga0500644_0000113 3300053088 Bacteria 51111
453 Ga0500644_0124553 3300053088 Bacteria 1008
454 Ga0500554_110497 3300053102 Bacteria 924
455 Ga0500556_0001401 3300053104 Bacteria 10497
456 Ga0500573_0003248 3300053140 Bacteria 8373
457 Ga0500573_0080352 3300053140 Bacteria 1853
458 Ga0587088_210376 3300059508 Bacteria 501
459 Ga0587090_075252 3300059510 Bacteria 667
460 Ga0587068_019881 3300059641 Bacteria 1092
461 Ga0587111_0277811 3300060346 Bacteria 505
462 Ga0501082_1706743 3300060353 Bacteria 549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046462 Ga0495651_0765616 Ga0495651_0765616_289_582 88
2 3300006038 Ga0075365_10000217 Ga0075365_1000021711 95
3 3300041463 Ga0451804_1125701 Ga0451804_1125701_259_633 95
4 3300005365 Ga0070688_101338159 Ga0070688_1013381592 96
5 3300026067 Ga0207678_10788096 Ga0207678_107880962 96
6 3300041512 Ga0451853_2361913 Ga0451853_2361913_312_659 96
7 3300005458 Ga0070681_10215408 Ga0070681_102154082 97
8 3300014326 Ga0157380_10000905 Ga0157380_100009052 97
9 3300025912 Ga0207707_10215647 Ga0207707_102156472 97
10 3300026121 Ga0207683_10197860 Ga0207683_101978602 97
11 3300049586 Ga0501070_0284142 Ga0501070_0284142_37_336 97
12 3300002076 JGI24749J21850_1005538 JGI24749J21850_10055382 98
13 3300005328 Ga0070676_10452765 Ga0070676_104527652 98
14 3300005329 Ga0070683_100056520 Ga0070683_1000565201 98
15 3300005329 Ga0070683_100565009 Ga0070683_1005650092 98
16 3300005331 Ga0070670_100428610 Ga0070670_1004286102 98
17 3300005333 Ga0070677_10194311 Ga0070677_101943112 98
18 3300005335 Ga0070666_11317060 Ga0070666_113170602 98
19 3300005337 Ga0070682_100146011 Ga0070682_1001460111 98
20 3300005338 Ga0068868_100271773 Ga0068868_1002717732 98
21 3300005339 Ga0070660_100363680 Ga0070660_1003636802 98
22 3300005343 Ga0070687_100942058 Ga0070687_1009420581 98
23 3300005345 Ga0070692_10354595 Ga0070692_103545952 98
24 3300005347 Ga0070668_100161627 Ga0070668_1001616272 98
25 3300005354 Ga0070675_100011234 Ga0070675_1000112343 98
26 3300005354 Ga0070675_100453861 Ga0070675_1004538612 98
27 3300005355 Ga0070671_100323652 Ga0070671_1003236522 98
28 3300005356 Ga0070674_100016325 Ga0070674_1000163252 98
29 3300005365 Ga0070688_100803482 Ga0070688_1008034821 98
30 3300005367 Ga0070667_100571983 Ga0070667_1005719832 98
31 3300005440 Ga0070705_101261789 Ga0070705_1012617892 98
32 3300005441 Ga0070700_100000740 Ga0070700_1000007402 98
33 3300005455 Ga0070663_100393742 Ga0070663_1003937422 98
34 3300005455 Ga0070663_101030324 Ga0070663_1010303242 98
35 3300005456 Ga0070678_100134050 Ga0070678_1001340502 98
36 3300005457 Ga0070662_100251457 Ga0070662_1002514572 98
37 3300005457 Ga0070662_100469973 Ga0070662_1004699732 98
38 3300005459 Ga0068867_100017913 Ga0068867_1000179132 98
39 3300005459 Ga0068867_100178568 Ga0068867_1001785682 98
40 3300005535 Ga0070684_100394899 Ga0070684_1003948992 98
41 3300005543 Ga0070672_100013287 Ga0070672_1000132874 98
42 3300005543 Ga0070672_100253189 Ga0070672_1002531892 98
43 3300005563 Ga0068855_100838364 Ga0068855_1008383642 98
44 3300005578 Ga0068854_100364287 Ga0068854_1003642872 98
45 3300005615 Ga0070702_100002716 Ga0070702_1000027163 98
46 3300005615 Ga0070702_100204535 Ga0070702_1002045351 98
47 3300005616 Ga0068852_100001760 Ga0068852_1000017609 98
48 3300005617 Ga0068859_101259224 Ga0068859_1012592242 98
49 3300005618 Ga0068864_100226913 Ga0068864_1002269132 98
50 3300005618 Ga0068864_101683329 Ga0068864_1016833292 98
51 3300005718 Ga0068866_10100929 Ga0068866_101009292 98
52 3300005719 Ga0068861_100003636 Ga0068861_1000036366 98
53 3300005719 Ga0068861_100308295 Ga0068861_1003082952 98
54 3300005840 Ga0068870_10689033 Ga0068870_106890332 98
55 3300005841 Ga0068863_101023762 Ga0068863_1010237622 98
56 3300005841 Ga0068863_101916723 Ga0068863_1019167232 98
57 3300005844 Ga0068862_101714242 Ga0068862_1017142421 98
58 3300006358 Ga0068871_101989998 Ga0068871_1019899982 98
59 3300006881 Ga0068865_101043162 Ga0068865_1010431622 98
60 3300006931 Ga0097620_101258777 Ga0097620_1012587772 98
61 3300009098 Ga0105245_10018413 Ga0105245_100184137 98
62 3300009098 Ga0105245_12268464 Ga0105245_122684641 98
63 3300009148 Ga0105243_10001097 Ga0105243_100010973 98
64 3300009148 Ga0105243_10193145 Ga0105243_101931452 98
65 3300009176 Ga0105242_11029252 Ga0105242_110292522 98
66 3300009177 Ga0105248_10038508 Ga0105248_100385082 98
67 3300009551 Ga0105238_10309233 Ga0105238_103092332 98
68 3300009553 Ga0105249_10006479 Ga0105249_100064794 98
69 3300009553 Ga0105249_10344876 Ga0105249_103448762 98
70 3300010375 Ga0105239_12393164 Ga0105239_123931642 98
71 3300011119 Ga0105246_10397723 Ga0105246_103977232 98
72 3300012477 Ga0157336_1035933 Ga0157336_10359332 98
73 3300013104 Ga0157370_10318436 Ga0157370_103184362 98
74 3300013104 Ga0157370_10971053 Ga0157370_109710532 98
75 3300013307 Ga0157372_10087765 Ga0157372_100877653 98
76 3300013308 Ga0157375_10159143 Ga0157375_101591432 98
77 3300013308 Ga0157375_10786790 Ga0157375_107867902 98
78 3300014325 Ga0163163_10356142 Ga0163163_103561422 98
79 3300014325 Ga0163163_10537614 Ga0163163_105376142 98
80 3300014325 Ga0163163_11032717 Ga0163163_110327172 98
81 3300014326 Ga0157380_10856754 Ga0157380_108567542 98
82 3300014745 Ga0157377_10038440 Ga0157377_100384402 98
83 3300014968 Ga0157379_10882591 Ga0157379_108825912 98
84 3300014969 Ga0157376_11023847 Ga0157376_110238472 98
85 3300017792 Ga0163161_10001854 Ga0163161_100018543 98
86 3300025315 Ga0207697_10079581 Ga0207697_100795812 98
87 3300025893 Ga0207682_10064872 Ga0207682_100648722 98
88 3300025899 Ga0207642_10081982 Ga0207642_100819821 98
89 3300025901 Ga0207688_10008122 Ga0207688_100081223 98
90 3300025901 Ga0207688_10423525 Ga0207688_104235252 98
91 3300025907 Ga0207645_10936468 Ga0207645_109364682 98
92 3300025908 Ga0207643_10077268 Ga0207643_100772682 98
93 3300025918 Ga0207662_10028314 Ga0207662_100283144 98
94 3300025918 Ga0207662_10516537 Ga0207662_105165372 98
95 3300025919 Ga0207657_10923580 Ga0207657_109235801 98
96 3300025920 Ga0207649_10473506 Ga0207649_104735062 98
97 3300025923 Ga0207681_10142427 Ga0207681_101424272 98
98 3300025925 Ga0207650_10594133 Ga0207650_105941332 98
99 3300025926 Ga0207659_10243521 Ga0207659_102435212 98
100 3300025927 Ga0207687_10068405 Ga0207687_100684053 98
101 3300025927 Ga0207687_10338100 Ga0207687_103381002 98
102 3300025931 Ga0207644_10244057 Ga0207644_102440572 98
103 3300025933 Ga0207706_10253501 Ga0207706_102535012 98
104 3300025933 Ga0207706_10430605 Ga0207706_104306052 98
105 3300025935 Ga0207709_10031923 Ga0207709_100319233 98
106 3300025935 Ga0207709_10228438 Ga0207709_102284382 98
107 3300025937 Ga0207669_10175765 Ga0207669_101757652 98
108 3300025937 Ga0207669_11402232 Ga0207669_114022321 98
109 3300025938 Ga0207704_10012013 Ga0207704_100120133 98
110 3300025938 Ga0207704_10615948 Ga0207704_106159482 98
111 3300025940 Ga0207691_10250484 Ga0207691_102504842 98
112 3300025941 Ga0207711_10433935 Ga0207711_104339352 98
113 3300025944 Ga0207661_10077198 Ga0207661_100771981 98
114 3300025961 Ga0207712_10011831 Ga0207712_100118313 98
115 3300025972 Ga0207668_10291960 Ga0207668_102919602 98
116 3300025972 Ga0207668_10760917 Ga0207668_107609171 98
117 3300025981 Ga0207640_10978025 Ga0207640_109780252 98
118 3300025986 Ga0207658_11311148 Ga0207658_113111482 98
119 3300025986 Ga0207658_12153825 Ga0207658_121538251 98
120 3300026023 Ga0207677_10857396 Ga0207677_108573962 98
121 3300026067 Ga0207678_10909845 Ga0207678_109098452 98
122 3300026067 Ga0207678_10974133 Ga0207678_109741332 98
123 3300026078 Ga0207702_11867104 Ga0207702_118671041 98
124 3300026088 Ga0207641_11836574 Ga0207641_118365742 98
125 3300026089 Ga0207648_10000833 Ga0207648_1000083316 98
126 3300026089 Ga0207648_10128281 Ga0207648_101282812 98
127 3300026095 Ga0207676_11204503 Ga0207676_112045032 98
128 3300026118 Ga0207675_100005432 Ga0207675_10000543210 98
129 3300026121 Ga0207683_10132031 Ga0207683_101320312 98
130 3300026142 Ga0207698_10066379 Ga0207698_100663792 98
131 3300041443 Ga0451789_0724329 Ga0451789_0724329_416_730 98
132 3300041451 Ga0451791_0507742 Ga0451791_0507742_24_338 98
133 3300041463 Ga0451804_0937464 Ga0451804_0937464_143_460 98
134 3300041491 Ga0451833_0657918 Ga0451833_0657918_71_385 98
135 3300041494 Ga0451837_0872629 Ga0451837_0872629_147_461 98
136 3300041507 Ga0451851_0908655 Ga0451851_0908655_463_777 98
137 3300041512 Ga0451853_1771630 Ga0451853_1771630_69_374 98
138 3300048913 Ga0496110_0161579 Ga0496110_0161579_242_556 98
139 3300048917 Ga0496114_0260239 Ga0496114_0260239_270_575 98
140 3300048917 Ga0496114_0884903 Ga0496114_0884903_437_751 98
141 3300049575 Ga0501039_1315046 Ga0501039_1315046_45_356 98
142 3300049586 Ga0501070_0856016 Ga0501070_0856016_302_619 98
143 3300050491 nmdc:mga00v17_705833_c1 nmdc:mga00v17_705833_c1_175_492 98
144 3300053140 Ga0500573_0003248 Ga0500573_0003248_56_352 98
145 iso_pu_bacteria 2643221615 2644091918 98
146 iso_pu_bacteria 2643221657 2644321721 98
147 3300001979 JGI24740J21852_10057100 JGI24740J21852_100571002 99
148 3300002067 JGI24735J21928_10024731 JGI24735J21928_100247312 99
149 3300005327 Ga0070658_10113522 Ga0070658_101135221 99
150 3300005329 Ga0070683_100122527 Ga0070683_1001225272 99
151 3300005336 Ga0070680_100333363 Ga0070680_1003333632 99
152 3300005338 Ga0068868_101344693 Ga0068868_1013446932 99
153 3300005458 Ga0070681_10096346 Ga0070681_100963462 99
154 3300005535 Ga0070684_101080977 Ga0070684_1010809772 99
155 3300005548 Ga0070665_101669479 Ga0070665_1016694792 99
156 3300005577 Ga0068857_101257593 Ga0068857_1012575932 99
157 3300005718 Ga0068866_10225273 Ga0068866_102252732 99
158 3300005840 Ga0068870_10348264 Ga0068870_103482642 99
159 3300005937 Ga0081455_10768147 Ga0081455_107681471 99
160 3300006358 Ga0068871_101915155 Ga0068871_1019151552 99
161 3300009174 Ga0105241_11173825 Ga0105241_111738252 99
162 3300009177 Ga0105248_12647887 Ga0105248_126478872 99
163 3300009551 Ga0105238_12688005 Ga0105238_126880051 99
164 3300011119 Ga0105246_10766512 Ga0105246_107665122 99
165 3300013307 Ga0157372_11455135 Ga0157372_114551351 99
166 3300013308 Ga0157375_10585135 Ga0157375_105851352 99
167 3300014325 Ga0163163_11435161 Ga0163163_114351612 99
168 3300014968 Ga0157379_10229843 Ga0157379_102298432 99
169 3300017792 Ga0163161_10242720 Ga0163161_102427201 99
170 3300025904 Ga0207647_10024052 Ga0207647_100240523 99
171 3300025908 Ga0207643_10034345 Ga0207643_100343454 99
172 3300025912 Ga0207707_10045696 Ga0207707_100456964 99
173 3300025917 Ga0207660_10313058 Ga0207660_103130582 99
174 3300025927 Ga0207687_10097952 Ga0207687_100979523 99
175 3300025934 Ga0207686_11736481 Ga0207686_117364812 99
176 3300025944 Ga0207661_10065637 Ga0207661_100656374 99
177 3300025949 Ga0207667_10948769 Ga0207667_109487692 99
178 3300025981 Ga0207640_11390397 Ga0207640_113903971 99
179 3300026116 Ga0207674_10934277 Ga0207674_109342771 99
180 3300026116 Ga0207674_10982273 Ga0207674_109822732 99
181 3300026118 Ga0207675_101722645 Ga0207675_1017226452 99
182 3300026121 Ga0207683_11094421 Ga0207683_110944212 99
183 3300028379 Ga0268266_11486690 Ga0268266_114866902 99
184 3300039437 Ga0436365_0637794 Ga0436365_0637794_353_670 99
185 3300041453 Ga0451797_0204946 Ga0451797_0204946_105_422 99
186 3300042016 Ga0439463_083123 Ga0439463_083123_159_464 99
187 3300044694 Ga0466963_0051283 Ga0466963_0051283_620_949 99
188 3300044706 Ga0466964_0186718 Ga0466964_0186718_650_976 99
189 3300044706 Ga0466964_0436635 Ga0466964_0436635_228_617 99
190 3300045976 Ga0466967_0013579 Ga0466967_0013579_4065_4391 99
191 3300045976 Ga0466967_0056427 Ga0466967_0056427_2037_2360 99
192 3300045976 Ga0466967_0284026 Ga0466967_0284026_59_448 99
193 3300045976 Ga0466967_0335682 Ga0466967_0335682_178_501 99
194 3300047321 Ga0495676_0496928 Ga0495676_0496928_80_406 99
195 3300048917 Ga0496114_0578502 Ga0496114_0578502_355_681 99
196 3300048917 Ga0496114_1728110 Ga0496114_1728110_178_504 99
197 3300049585 Ga0501069_0017566 Ga0501069_0017566_1904_2230 99
198 3300049586 Ga0501070_0025451 Ga0501070_0025451_2405_2728 99
199 3300049586 Ga0501070_0092882 Ga0501070_0092882_1032_1358 99
200 3300049590 Ga0501074_0157242 Ga0501074_0157242_952_1275 99
201 3300049741 Ga0501079_1224961 Ga0501079_1224961_23_346 99
202 3300049742 Ga0501080_0100211 Ga0501080_0100211_1076_1399 99
203 3300049744 Ga0501083_0372896 Ga0501083_0372896_554_877 99
204 3300060346 Ga0587111_0277811 Ga0587111_0277811_56_388 99
205 iso_pu_bacteria 2855386786 2855390208 99
206 3300010375 Ga0105239_11101839 Ga0105239_111018393 100
207 3300013102 Ga0157371_11300069 Ga0157371_113000691 100
208 3300013306 Ga0163162_10843257 Ga0163162_108432572 100
209 3300013307 Ga0157372_10947064 Ga0157372_109470642 100
210 3300031731 Ga0307405_10187746 Ga0307405_101877462 100
211 3300031995 Ga0307409_100145119 Ga0307409_1001451191 100
212 3300032004 Ga0307414_11121726 Ga0307414_111217262 100
213 3300041486 Ga0451807_1971552 Ga0451807_1971552_54_380 100
214 3300045976 Ga0466967_0207378 Ga0466967_0207378_1066_1386 100
215 3300048910 Ga0496107_0322124 Ga0496107_0322124_145_456 100
216 3300048911 Ga0496108_0138373 Ga0496108_0138373_1475_1786 100
217 3300048911 Ga0496108_0389624 Ga0496108_0389624_131_442 100
218 3300048912 Ga0496109_0051029 Ga0496109_0051029_507_818 100
219 3300048912 Ga0496109_0671771 Ga0496109_0671771_22_333 100
220 3300048913 Ga0496110_0179551 Ga0496110_0179551_1474_1785 100
221 3300048914 Ga0496111_0121978 Ga0496111_0121978_717_1028 100
222 3300048914 Ga0496111_1308144 Ga0496111_1308144_171_482 100
223 3300048916 Ga0496113_0258447 Ga0496113_0258447_148_459 100
224 3300053102 Ga0500554_110497 Ga0500554_110497_336_653 100
225 3300002067 JGI24735J21928_10094479 JGI24735J21928_100944792 101
226 3300005327 Ga0070658_10064750 Ga0070658_100647503 101
227 3300005339 Ga0070660_100010069 Ga0070660_1000100692 101
228 3300005366 Ga0070659_100006440 Ga0070659_1000064403 101
229 3300005539 Ga0068853_101110487 Ga0068853_1011104872 101
230 3300005563 Ga0068855_100209850 Ga0068855_1002098502 101
231 3300009174 Ga0105241_11953203 Ga0105241_119532031 101
232 3300025904 Ga0207647_10104711 Ga0207647_101047112 101
233 3300025909 Ga0207705_10051474 Ga0207705_100514743 101
234 3300025919 Ga0207657_10032835 Ga0207657_100328352 101
235 3300025932 Ga0207690_10013489 Ga0207690_100134893 101
236 3300026041 Ga0207639_10431147 Ga0207639_104311472 101
237 3300041443 Ga0451789_0021329 Ga0451789_0021329_144_461 101
238 3300041452 Ga0451793_0228260 Ga0451793_0228260_116_427 101
239 3300041999 Ga0439433_0124745 Ga0439433_0124745_183_521 101
240 3300044694 Ga0466963_0595113 Ga0466963_0595113_107_442 101
241 3300045976 Ga0466967_1383732 Ga0466967_1383732_315_650 101
242 3300046543 Ga0495645_0751723 Ga0495645_0751723_34_366 101
243 3300049568 Ga0501031_0001660 Ga0501031_0001660_11967_12287 101
244 3300049569 Ga0501032_0243039 Ga0501032_0243039_325_645 101
245 3300049570 Ga0501033_0276964 Ga0501033_0276964_47_367 101
246 3300049572 Ga0501036_0002593 Ga0501036_0002593_9649_9969 101
247 3300049574 Ga0501038_0133860 Ga0501038_0133860_687_1007 101
248 3300049575 Ga0501039_0006187 Ga0501039_0006187_5889_6209 101
249 3300049576 Ga0501040_0007663 Ga0501040_0007663_5681_6001 101
250 3300049577 Ga0501041_0100564 Ga0501041_0100564_639_959 101
251 3300049578 Ga0501042_0038551 Ga0501042_0038551_2968_3288 101
252 3300049582 Ga0501048_0124401 Ga0501048_0124401_1362_1682 101
253 3300049584 Ga0501068_0052760 Ga0501068_0052760_95_415 101
254 3300049585 Ga0501069_0050464 Ga0501069_0050464_808_1128 101
255 3300049586 Ga0501070_0094935 Ga0501070_0094935_1269_1589 101
256 3300049587 Ga0501071_0009568 Ga0501071_0009568_5411_5731 101
257 3300049588 Ga0501072_0102397 Ga0501072_0102397_912_1232 101
258 3300049591 Ga0501075_0034178 Ga0501075_0034178_1006_1326 101
259 3300049592 Ga0501076_0002458 Ga0501076_0002458_12130_12450 101
260 3300049593 Ga0501077_0094435 Ga0501077_0094435_595_915 101
261 3300049741 Ga0501079_0110857 Ga0501079_0110857_456_776 101
262 3300049822 Ga0501035_0083205 Ga0501035_0083205_1347_1667 101
263 3300049824 Ga0501045_0007775 Ga0501045_0007775_3491_3811 101
264 3300053088 Ga0500644_0000113 Ga0500644_0000113_38298_38627 101
265 3300060353 Ga0501082_1706743 Ga0501082_1706743_29_349 101
266 3300005347 Ga0070668_100614737 Ga0070668_1006147372 102
267 3300005367 Ga0070667_100228839 Ga0070667_1002288392 102
268 3300005441 Ga0070700_100071374 Ga0070700_1000713743 102
269 3300005455 Ga0070663_101884825 Ga0070663_1018848251 102
270 3300005547 Ga0070693_100372591 Ga0070693_1003725911 102
271 3300005615 Ga0070702_101498996 Ga0070702_1014989961 102
272 3300005844 Ga0068862_100309184 Ga0068862_1003091842 102
273 3300006038 Ga0075365_10049880 Ga0075365_100498801 102
274 3300006038 Ga0075365_10057198 Ga0075365_100571982 102
275 3300006038 Ga0075365_10273029 Ga0075365_102730292 102
276 3300006038 Ga0075365_10535114 Ga0075365_105351142 102
277 3300006038 Ga0075365_10831409 Ga0075365_108314092 102
278 3300006038 Ga0075365_10840925 Ga0075365_108409252 102
279 3300006042 Ga0075368_10000549 Ga0075368_100005497 102
280 3300006042 Ga0075368_10040181 Ga0075368_100401812 102
281 3300006048 Ga0075363_100006094 Ga0075363_1000060945 102
282 3300006048 Ga0075363_100013161 Ga0075363_1000131615 102
283 3300006048 Ga0075363_100385112 Ga0075363_1003851122 102
284 3300006051 Ga0075364_10372772 Ga0075364_103727722 102
285 3300006051 Ga0075364_10493173 Ga0075364_104931732 102
286 3300006178 Ga0075367_10008197 Ga0075367_100081975 102
287 3300006178 Ga0075367_10010790 Ga0075367_100107905 102
288 3300006353 Ga0075370_10161155 Ga0075370_101611552 102
289 3300006358 Ga0068871_101936121 Ga0068871_1019361212 102
290 3300009148 Ga0105243_12791803 Ga0105243_127918031 102
291 3300009551 Ga0105238_11885428 Ga0105238_118854282 102
292 3300009553 Ga0105249_10996915 Ga0105249_109969152 102
293 3300010375 Ga0105239_10486906 Ga0105239_104869062 102
294 3300013105 Ga0157369_11132341 Ga0157369_111323412 102
295 3300013308 Ga0157375_11219868 Ga0157375_112198682 102
296 3300013308 Ga0157375_12075170 Ga0157375_120751702 102
297 3300025919 Ga0207657_10676631 Ga0207657_106766312 102
298 3300025921 Ga0207652_10116892 Ga0207652_101168922 102
299 3300025932 Ga0207690_11704611 Ga0207690_117046111 102
300 3300025936 Ga0207670_10370022 Ga0207670_103700222 102
301 3300025937 Ga0207669_10472219 Ga0207669_104722191 102
302 3300025986 Ga0207658_10216510 Ga0207658_102165102 102
303 3300026067 Ga0207678_11041974 Ga0207678_110419741 102
304 3300026075 Ga0207708_10007914 Ga0207708_100079142 102
305 3300026075 Ga0207708_10100479 Ga0207708_101004792 102
306 3300026118 Ga0207675_100345221 Ga0207675_1003452212 102
307 3300026118 Ga0207675_100357529 Ga0207675_1003575292 102
308 3300026121 Ga0207683_10486347 Ga0207683_104863472 102
309 3300027866 Ga0209813_10001305 Ga0209813_100013054 102
310 3300027866 Ga0209813_10506510 Ga0209813_105065102 102
311 3300028380 Ga0268265_11368653 Ga0268265_113686532 102
312 3300031548 Ga0307408_101212827 Ga0307408_1012128272 102
313 3300031852 Ga0307410_10533557 Ga0307410_105335572 102
314 3300031995 Ga0307409_100316271 Ga0307409_1003162712 102
315 3300031995 Ga0307409_101303476 Ga0307409_1013034762 102
316 3300031995 Ga0307409_101829814 Ga0307409_1018298142 102
317 3300032002 Ga0307416_102443645 Ga0307416_1024436451 102
318 3300032005 Ga0307411_11312877 Ga0307411_113128772 102
319 3300032126 Ga0307415_100484836 Ga0307415_1004848362 102
320 3300032126 Ga0307415_100747749 Ga0307415_1007477492 102
321 3300041405 Ga0439438_102603 Ga0439438_102603_56_385 102
322 3300041407 Ga0439447_067949 Ga0439447_067949_166_495 102
323 3300041410 Ga0439461_0134748 Ga0439461_0134748_131_460 102
324 3300041441 Ga0451787_543236 Ga0451787_543236_165_479 102
325 3300041458 Ga0451798_0456571 Ga0451798_0456571_95_409 102
326 3300041486 Ga0451807_1994375 Ga0451807_1994375_81_410 102
327 3300041486 Ga0451807_2359182 Ga0451807_2359182_10_333 102
328 3300041512 Ga0451853_3090196 Ga0451853_3090196_137_445 102
329 3300042002 Ga0439442_061066 Ga0439442_061066_99_428 102
330 3300042014 Ga0439457_137104 Ga0439457_137104_185_514 102
331 3300042146 Ga0450907_046436 Ga0450907_046436_29_358 102
332 3300042156 Ga0439446_0004964 Ga0439446_0004964_1519_1848 102
333 3300042435 Ga0439434_0000731 Ga0439434_0000731_835_1164 102
334 3300044694 Ga0466963_0102255 Ga0466963_0102255_1415_1750 102
335 3300044706 Ga0466964_0615255 Ga0466964_0615255_232_567 102
336 3300045976 Ga0466967_0241982 Ga0466967_0241982_702_1037 102
337 3300045976 Ga0466967_0762203 Ga0466967_0762203_115_447 102
338 3300046455 Ga0495603_0058065 Ga0495603_0058065_1685_2008 102
339 3300046461 Ga0495641_0424610 Ga0495641_0424610_200_541 102
340 3300046475 Ga0495639_0133474 Ga0495639_0133474_414_737 102
341 3300046663 Ga0495635_0158163 Ga0495635_0158163_593_928 102
342 3300047319 Ga0495674_0176364 Ga0495674_0176364_895_1230 102
343 3300048903 Ga0496100_0494223 Ga0496100_0494223_337_675 102
344 3300048903 Ga0496100_0765961 Ga0496100_0765961_102_410 102
345 3300048904 Ga0496101_0087728 Ga0496101_0087728_526_864 102
346 3300048904 Ga0496101_0382019 Ga0496101_0382019_224_532 102
347 3300048904 Ga0496101_0536533 Ga0496101_0536533_281_607 102
348 3300048905 Ga0496102_0183958 Ga0496102_0183958_847_1185 102
349 3300048905 Ga0496102_0845397 Ga0496102_0845397_263_571 102
350 3300048910 Ga0496107_0314793 Ga0496107_0314793_387_695 102
351 3300048910 Ga0496107_0320328 Ga0496107_0320328_687_1025 102
352 3300048911 Ga0496108_0295218 Ga0496108_0295218_440_769 102
353 3300048911 Ga0496108_0580528 Ga0496108_0580528_133_456 102
354 3300048912 Ga0496109_0180176 Ga0496109_0180176_1232_1570 102
355 3300048912 Ga0496109_0982005 Ga0496109_0982005_394_708 102
356 3300048912 Ga0496109_1800838 Ga0496109_1800838_193_516 102
357 3300048913 Ga0496110_0353403 Ga0496110_0353403_269_592 102
358 3300048913 Ga0496110_0687606 Ga0496110_0687606_500_841 102
359 3300048915 Ga0496112_0163753 Ga0496112_0163753_94_423 102
360 3300048916 Ga0496113_0393678 Ga0496113_0393678_275_604 102
361 3300048917 Ga0496114_0003516 Ga0496114_0003516_375_713 102
362 3300049568 Ga0501031_0179933 Ga0501031_0179933_216_533 102
363 3300049572 Ga0501036_0646424 Ga0501036_0646424_96_413 102
364 3300049573 Ga0501037_0181990 Ga0501037_0181990_786_1103 102
365 3300049575 Ga0501039_0549494 Ga0501039_0549494_526_843 102
366 3300049577 Ga0501041_0100319 Ga0501041_0100319_211_528 102
367 3300049577 Ga0501041_0385785 Ga0501041_0385785_385_705 102
368 3300049578 Ga0501042_0510999 Ga0501042_0510999_285_602 102
369 3300049580 Ga0501046_0550154 Ga0501046_0550154_210_527 102
370 3300049582 Ga0501048_0933675 Ga0501048_0933675_193_510 102
371 3300049584 Ga0501068_0247880 Ga0501068_0247880_60_377 102
372 3300049586 Ga0501070_0245671 Ga0501070_0245671_296_622 102
373 3300049588 Ga0501072_0033974 Ga0501072_0033974_276_602 102
374 3300049588 Ga0501072_0297904 Ga0501072_0297904_124_441 102
375 3300049589 Ga0501073_0152507 Ga0501073_0152507_1210_1539 102
376 3300049590 Ga0501074_0069832 Ga0501074_0069832_1883_2212 102
377 3300049741 Ga0501079_0160102 Ga0501079_0160102_910_1239 102
378 3300049741 Ga0501079_1213411 Ga0501079_1213411_28_345 102
379 3300049823 Ga0501044_0891503 Ga0501044_0891503_143_460 102
380 3300049824 Ga0501045_0176076 Ga0501045_0176076_1168_1485 102
381 3300050490 nmdc:mga03n38_203541_c1 nmdc:mga03n38_203541_c1_483_797 102
382 3300050490 nmdc:mga03n38_258206_c1 nmdc:mga03n38_258206_c1_409_723 102
383 3300050491 nmdc:mga00v17_120273_c1 nmdc:mga00v17_120273_c1_487_801 102
384 3300050491 nmdc:mga00v17_142544_c1 nmdc:mga00v17_142544_c1_376_690 102
385 3300050492 nmdc:mga0yw44_106020_c1 nmdc:mga0yw44_106020_c1_1368_1682 102
386 3300050492 nmdc:mga0yw44_123320_c1 nmdc:mga0yw44_123320_c1_788_1102 102
387 3300050492 nmdc:mga0yw44_124723_c1 nmdc:mga0yw44_124723_c1_923_1237 102
388 3300050492 nmdc:mga0yw44_128701_c1 nmdc:mga0yw44_128701_c1_73_399 102
389 3300050492 nmdc:mga0yw44_13531_c1 nmdc:mga0yw44_13531_c1_3232_3546 102
390 3300050492 nmdc:mga0yw44_357339_c1 nmdc:mga0yw44_357339_c1_253_567 102
391 3300050492 nmdc:mga0yw44_534535_c1 nmdc:mga0yw44_534535_c1_259_573 102
392 3300050492 nmdc:mga0yw44_601743_c1 nmdc:mga0yw44_601743_c1_406_735 102
393 3300050492 nmdc:mga0yw44_704545_c1 nmdc:mga0yw44_704545_c1_182_496 102
394 3300050492 nmdc:mga0yw44_721822_c1 nmdc:mga0yw44_721822_c1_333_647 102
395 3300050494 nmdc:mga06z11_11644_c1 nmdc:mga06z11_11644_c1_2293_2607 102
396 3300050494 nmdc:mga06z11_79522_c2 nmdc:mga06z11_79522_c2_183_497 102
397 3300050495 nmdc:mga04h51_170575_c1 nmdc:mga04h51_170575_c1_424_738 102
398 3300050495 nmdc:mga04h51_20053_c1 nmdc:mga04h51_20053_c1_483_797 102
399 3300050496 nmdc:mga07m45_287582_c1 nmdc:mga07m45_287582_c1_340_654 102
400 3300050496 nmdc:mga07m45_48678_c1 nmdc:mga07m45_48678_c1_1907_2221 102
401 3300053085 Ga0495619_0198637 Ga0495619_0198637_710_1045 102
402 3300053088 Ga0500644_0124553 Ga0500644_0124553_324_644 102
403 3300053104 Ga0500556_0001401 Ga0500556_0001401_3789_4106 102
404 3300053140 Ga0500573_0080352 Ga0500573_0080352_108_422 102
405 3300059508 Ga0587088_210376 Ga0587088_210376_41_358 102
406 3300005344 Ga0070661_100271354 Ga0070661_1002713541 103
407 3300005366 Ga0070659_101880072 Ga0070659_1018800721 103
408 3300005455 Ga0070663_101234615 Ga0070663_1012346152 103
409 3300005547 Ga0070693_101068995 Ga0070693_1010689951 103
410 3300005564 Ga0070664_100008827 Ga0070664_1000088279 103
411 3300009176 Ga0105242_11513363 Ga0105242_115133631 103
412 3300013307 Ga0157372_11423932 Ga0157372_114239321 103
413 3300017792 Ga0163161_11156324 Ga0163161_111563241 103
414 3300025909 Ga0207705_10540678 Ga0207705_105406782 103
415 3300025932 Ga0207690_11214736 Ga0207690_112147362 103
416 3300025933 Ga0207706_10289420 Ga0207706_102894201 103
417 3300025945 Ga0207679_10042113 Ga0207679_100421135 103
418 3300025972 Ga0207668_11447591 Ga0207668_114475912 103
419 3300026067 Ga0207678_10023921 Ga0207678_100239214 103
420 3300032126 Ga0307415_102073223 Ga0307415_1020732232 103
421 3300042439 Ga0439464_0050637 Ga0439464_0050637_486_809 103
422 3300044901 Ga0466960_0264675 Ga0466960_0264675_248_571 103
423 3300046463 Ga0495653_0329257 Ga0495653_0329257_150_482 103
424 3300046809 Ga0495600_0325172 Ga0495600_0325172_192_524 103
425 3300048911 Ga0496108_0319372 Ga0496108_0319372_510_842 103
426 3300048912 Ga0496109_0628674 Ga0496109_0628674_431_763 103
427 3300048913 Ga0496110_0722709 Ga0496110_0722709_121_453 103
428 3300049583 Ga0501067_0531724 Ga0501067_0531724_227_568 103
429 3300049584 Ga0501068_0069662 Ga0501068_0069662_587_925 103
430 3300049586 Ga0501070_0116329 Ga0501070_0116329_266_586 103
431 3300053085 Ga0495619_0248245 Ga0495619_0248245_258_590 103
432 3300059510 Ga0587090_075252 Ga0587090_075252_290_634 103
433 3300059641 Ga0587068_019881 Ga0587068_019881_662_1006 103
434 3300005548 Ga0070665_100001227 Ga0070665_10000122713 104
435 3300005616 Ga0068852_102367937 Ga0068852_1023679371 104
436 3300025921 Ga0207652_10503956 Ga0207652_105039562 104
437 3300028379 Ga0268266_10012438 Ga0268266_100124385 104
438 3300041486 Ga0451807_1844114 Ga0451807_1844114_421_735 104
439 3300006038 Ga0075365_10059058 Ga0075365_100590583 105
440 3300006038 Ga0075365_10150713 Ga0075365_101507132 105
441 3300006042 Ga0075368_10000161 Ga0075368_100001617 105
442 3300006048 Ga0075363_100002462 Ga0075363_1000024628 105
443 3300006051 Ga0075364_10683630 Ga0075364_106836302 105
444 3300006177 Ga0075362_10000541 Ga0075362_100005416 105
445 3300006178 Ga0075367_10001033 Ga0075367_100010337 105
446 3300006353 Ga0075370_10000336 Ga0075370_100003369 105
447 3300027866 Ga0209813_10001430 Ga0209813_100014307 105
448 3300050489 nmdc:mga03683_5657_c1 nmdc:mga03683_5657_c1_3130_3447 105
449 3300050490 nmdc:mga03n38_131775_c1 nmdc:mga03n38_131775_c1_192_509 105
450 3300050491 nmdc:mga00v17_152005_c1 nmdc:mga00v17_152005_c1_1154_1471 105
451 3300050492 nmdc:mga0yw44_29267_c1 nmdc:mga0yw44_29267_c1_1721_2041 105
452 3300050492 nmdc:mga0yw44_58790_c1 nmdc:mga0yw44_58790_c1_423_740 105
453 3300050494 nmdc:mga06z11_1033_c1 nmdc:mga06z11_1033_c1_4377_4694 105
454 3300050495 nmdc:mga04h51_19900_c1 nmdc:mga04h51_19900_c1_18_335 105
455 3300050496 nmdc:mga07m45_7893_c1 nmdc:mga07m45_7893_c1_4345_4662 105
456 3300025920 Ga0207649_11007159 Ga0207649_110071591 106
457 3300025925 Ga0207650_10446297 Ga0207650_104462972 106
458 3300025935 Ga0207709_10390602 Ga0207709_103906022 106
459 3300026118 Ga0207675_100838831 Ga0207675_1008388312 106
460 3300031995 Ga0307409_100666838 Ga0307409_1006668382 106
461 3300049590 Ga0501074_0578962 Ga0501074_0578962_252_602 106
462 3300049824 Ga0501045_0599265 Ga0501045_0599265_44_394 106
463 3300048917 Ga0496114_0288601 Ga0496114_0288601_609_932 107
464 3300005578 Ga0068854_100540491 Ga0068854_1005404912 108
465 3300000549 LJQas_1041248 LJQas_10412482 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12769

PNTB_4TM

4TM region of pyridine nucleotide transhydrogenase, mitoch

7

91

0.98

Feature Viewer

pLDDT pTM Quality
67.02 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map