F449352

General Info

Members Datasets Scaffolds Average Seq Length
464 260 349 268

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0047587|Ga0495607_0047587_1466_2332
Length 288
Sequence MQSGTVDGLYYEVHGGPAADRATVILSAGLGGSGAFWAPQMDALLSRFRVVLYDHRGTGRSVRALPAGPYSVTAMGEDIVKVMDAVGLDRAHVVGHAAGGNAGLAMALDHPDRIGRLVVVNGWSRPDPHIKRCFDTRLALLNNTGIAAYVHAQPLFLYPADWLSANHARLEAEEVHHIHGFPDPEVMRARIQALLAFDIDADLERIACPVLVSASADDMLVPLACSRRLAERLPNAVLDIAPWGGHGFTVTAAEAFNSSLLSFLGGDLQRGNNPWKSASSFRSATTAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
6 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
7 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
8 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
9 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
10 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
11 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
12 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
13 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
14 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
15 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
16 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
17 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
18 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
19 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
20 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
21 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
22 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
23 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
24 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
25 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
26 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
27 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
28 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
29 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
30 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
31 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
32 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
33 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
34 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
35 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
36 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
37 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
38 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
39 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
40 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
41 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
42 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
43 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
44 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
45 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
46 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
47 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
48 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
49 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
50 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
51 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
52 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
53 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
54 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
55 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
56 2636415599 Klebsiella variicola DX120E Isolate Unclassified
57 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
58 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
59 2643221583 Caulobacter sp. Root655 Isolate Unclassified
60 2643221584 Caulobacter sp. Root656 Isolate Unclassified
61 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
62 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
63 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
64 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
65 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
66 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
67 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
68 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
69 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
70 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
71 2751185917 Enterobacter sp. HK169 Isolate Unclassified
72 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
73 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
74 2775507074 Klebsiella sp. D5A Isolate Unclassified
75 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
76 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
77 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
78 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
79 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
80 2818991435 Caulobacter henricii 536 Isolate Unclassified
81 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
82 2821118458 Enterobacter asburiae 609 Isolate Unclassified
83 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
84 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
85 2847085930 Erwinia persicina B64 Isolate Bulb
86 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
87 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
88 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
89 2904504865 Serratia marcescens 1822 Isolate Unclassified
90 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
91 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
92 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
93 2919150387 Rahnella aceris 1817 Isolate Unclassified
94 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
95 2927143783 Rahnella sp. 2050 Isolate Unclassified
96 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
97 2937539931 Pantoea sp. LS15 Isolate Unclassified
98 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
99 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
100 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
101 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
102 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
103 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
104 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
105 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
106 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
107 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
108 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
109 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
110 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
111 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
112 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
113 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
114 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
115 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
116 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
117 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
118 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
119 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
120 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
121 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
122 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
123 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
124 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
125 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
126 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
127 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
128 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
131 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
132 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
145 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
146 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
147 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
157 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
174 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
180 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
183 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
184 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
187 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
188 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
189 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
211 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
215 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
216 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
241 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
242 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
243 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
244 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
245 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
246 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
249 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
250 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
251 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
252 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
253 640753048 Serratia proteamaculans 568 Isolate Endosphere
254 8018221730 Enterobacter sp. CM29 Isolate Unclassified
255 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
256 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
257 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
258 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
259 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
260 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.22
Metatranscriptomes 0
Isolates 24.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.86
Bulb 0.22
Endosphere 12.5
Nodule 2.37
Rhizoplane 13.15
Rhizosphere 45.04
Stem 0
Stem Tuber 0
Unclassified 25.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2705273 2162886007 Bacteria 4371
2 JGI24739J22299_10000821 3300001989 Bacteria 11396
3 JGI25162J39368_1000084 3300002737 Bacteria 108880
4 JGI25163J39215_1000095 3300002771 Bacteria 37243
5 JGI25163J39215_1000124 3300002771 Bacteria 31687
6 JGI25164J39214_1000062 3300002772 Bacteria 108882
7 rootH2_10059718 3300003320 Bacteria 15347
8 Ga0055538_1000060 3300003751 Bacteria 108880
9 Ga0055539_1000092 3300003752 Bacteria 108880
10 Ga0055533_1000101 3300003756 Bacteria 108880
11 Ga0055525_1000134 3300003759 Bacteria 108880
12 Ga0055537_1001438 3300003773 Bacteria 9292
13 Ga0055524_1015544 3300003775 Bacteria 2768
14 Ga0055524_1026756 3300003775 Bacteria 1772
15 Ga0055528_1008952 3300003790 Bacteria 4230
16 Ga0055531_10018802 3300003794 Bacteria 2832
17 Ga0055541_1000062 3300003841 Bacteria 108880
18 Ga0058692_1002831 3300003856 Bacteria 5682
19 Ga0058692_1003237 3300003856 Bacteria 5109
20 Ga0058692_1003615 3300003856 Bacteria 4742
21 Ga0065165_1000561 3300005262 Bacteria 55325
22 Ga0065704_10000664 3300005289 Bacteria 46630
23 Ga0065704_10000674 3300005289 Bacteria 55017
24 Ga0065704_10000722 3300005289 Bacteria 17520
25 Ga0065704_10004428 3300005289 Bacteria 5573
26 Ga0065704_10087996 3300005289 Bacteria 2976
27 Ga0070659_100101047 3300005366 Bacteria 2321
28 Ga0070665_100000446 3300005548 Bacteria 60094
29 Ga0068857_100001056 3300005577 Bacteria 21349
30 Ga0075364_10011159 3300006051 Bacteria 5453
31 Ga0075364_10013894 3300006051 Bacteria 4962
32 Ga0075366_10051047 3300006195 Bacteria 2457
33 Ga0075366_10135582 3300006195 Bacteria 1486
34 Ga0079104_1006009 3300006946 Bacteria 4700
35 Ga0079104_1011871 3300006946 Bacteria 2772
36 Ga0079104_1011876 3300006946 Bacteria 2771
37 Ga0079104_1012532 3300006946 Bacteria 2658
38 Ga0079104_1012627 3300006946 Bacteria 2642
39 Ga0105251_10000053 3300009011 Bacteria 106190
40 Ga0105251_10000465 3300009011 Bacteria 38667
41 Ga0105251_10000606 3300009011 Bacteria 32839
42 Ga0105251_10001506 3300009011 Bacteria 20010
43 Ga0105251_10001643 3300009011 Bacteria 18941
44 Ga0105251_10004673 3300009011 Bacteria 9209
45 Ga0105251_10010121 3300009011 Bacteria 5500
46 Ga0105251_10136348 3300009011 Bacteria 1111
47 Ga0105251_10144129 3300009011 Bacteria 1077
48 Ga0105244_10000569 3300009036 Bacteria 33031
49 Ga0105244_10000942 3300009036 Bacteria 24430
50 Ga0105244_10001226 3300009036 Bacteria 21039
51 Ga0105244_10001863 3300009036 Bacteria 16393
52 Ga0105244_10002704 3300009036 Bacteria 13254
53 Ga0105244_10009582 3300009036 Bacteria 5938
54 Ga0105244_10183973 3300009036 Bacteria 990
55 Ga0105250_10000003 3300009092 Bacteria 547770
56 Ga0105250_10000040 3300009092 Bacteria 133899
57 Ga0105250_10001600 3300009092 Bacteria 12132
58 Ga0105250_10005696 3300009092 Bacteria 5561
59 Ga0105250_10030172 3300009092 Bacteria 2180
60 Ga0105250_10032752 3300009092 Bacteria 2087
61 Ga0105250_10035634 3300009092 Bacteria 1997
62 Ga0105247_10000599 3300009101 Bacteria 29233
63 Ga0105243_10057395 3300009148 Bacteria 3099
64 Ga0105241_10000005 3300009174 Bacteria 384203
65 Ga0157373_10002016 3300013100 Bacteria 15393
66 Ga0157373_10036192 3300013100 Bacteria 3544
67 Ga0157373_10152814 3300013100 Bacteria 1624
68 Ga0157371_10000101 3300013102 Bacteria 129981
69 Ga0157371_10001776 3300013102 Bacteria 21809
70 Ga0157371_10116122 3300013102 Bacteria 1901
71 Ga0157371_10200358 3300013102 Bacteria 1431
72 Ga0157370_10000796 3300013104 Bacteria 39701
73 Ga0157370_10002997 3300013104 Bacteria 20058
74 Ga0157370_10033336 3300013104 Bacteria 5022
75 Ga0163162_10021821 3300013306 Bacteria 6308
76 Ga0157372_10023649 3300013307 Bacteria 6665
77 Ga0157372_10154077 3300013307 Bacteria 2654
78 Ga0182008_10004217 3300014497 Bacteria 8441
79 Ga0183366_1001 3300015679 Bacteria 2743932
80 Ga0183370_1001 3300015680 Bacteria 2743932
81 Ga0183369_1001 3300015685 Bacteria 2743932
82 Ga0183368_1001 3300015687 Bacteria 2743932
83 Ga0163161_10000001 3300017792 Bacteria 2041488
84 Ga0213876_10000016 3300021384 Bacteria 300175
85 Ga0209760_100001 3300025207 Bacteria 348781
86 Ga0209784_100001 3300025224 Bacteria 3600592
87 Ga0209566_100001 3300025225 Bacteria 3600765
88 Ga0209674_100002 3300025226 Bacteria 3600592
89 Ga0209563_100008 3300025230 Bacteria 1554545
90 Ga0207427_100002 3300025231 Bacteria 1355321
91 Ga0209437_100007 3300025233 Bacteria 938377
92 Ga0209677_100004 3300025253 Bacteria 1554545
93 Ga0209565_1000140 3300025263 Bacteria 101561
94 Ga0209565_1027198 3300025263 Bacteria 1140
95 Ga0209673_1000630 3300025273 Bacteria 53635
96 Ga0209675_1006367 3300025291 Bacteria 4747
97 Ga0209564_1007509 3300025295 Bacteria 5617
98 Ga0209564_1035222 3300025295 Bacteria 1453
99 Ga0209564_1039265 3300025295 Bacteria 1303
100 Ga0209758_1024518 3300025297 Bacteria 2685
101 Ga0209758_1056441 3300025297 Bacteria 1326
102 Ga0209050_1017250 3300025298 Bacteria 2893
103 Ga0209256_1001549 3300025299 Bacteria 22921
104 Ga0209256_1003734 3300025299 Bacteria 10305
105 Ga0209257_1000200 3300025304 Bacteria 147538
106 Ga0207696_1000001 3300025711 Bacteria 2579611
107 Ga0207696_1000004 3300025711 Bacteria 671626
108 Ga0207696_1000077 3300025711 Bacteria 209611
109 Ga0207696_1001271 3300025711 Bacteria 14110
110 Ga0207696_1007868 3300025711 Bacteria 4133
111 Ga0207696_1020677 3300025711 Bacteria 2118
112 Ga0207655_1000001 3300025728 Bacteria 1866413
113 Ga0207655_1000009 3300025728 Bacteria 664676
114 Ga0207655_1000060 3300025728 Bacteria 260572
115 Ga0207655_1000888 3300025728 Bacteria 31658
116 Ga0207655_1002461 3300025728 Bacteria 14998
117 Ga0207655_1003361 3300025728 Bacteria 11973
118 Ga0207655_1010499 3300025728 Bacteria 5606
119 Ga0207713_1000040 3300025735 Bacteria 245322
120 Ga0207713_1000119 3300025735 Bacteria 123810
121 Ga0207713_1000147 3300025735 Bacteria 106198
122 Ga0207713_1000153 3300025735 Bacteria 103510
123 Ga0207713_1000993 3300025735 Bacteria 24885
124 Ga0207713_1004074 3300025735 Bacteria 9634
125 Ga0207713_1009123 3300025735 Bacteria 5627
126 Ga0207713_1021167 3300025735 Bacteria 3125
127 Ga0207713_1051234 3300025735 Bacteria 1642
128 Ga0207713_1054877 3300025735 Bacteria 1559
129 Ga0207713_1094916 3300025735 Bacteria 1040
130 Ga0207710_10000236 3300025900 Bacteria 47574
131 Ga0207654_10000007 3300025911 Bacteria 384211
132 Ga0207709_10183174 3300025935 Bacteria 1481
133 Ga0207674_10000970 3300026116 Bacteria 37542
134 Ga0209281_1000027 3300027111 Bacteria 463409
135 Ga0209281_1000267 3300027111 Bacteria 100564
136 Ga0209281_1000288 3300027111 Bacteria 93347
137 Ga0209281_1000759 3300027111 Bacteria 31002
138 Ga0209281_1001716 3300027111 Bacteria 11311
139 Ga0209281_1002279 3300027111 Bacteria 8087
140 Ga0209371_1000001 3300027312 Bacteria 2771503
141 Ga0209371_1000081 3300027312 Bacteria 185440
142 Ga0209371_1000772 3300027312 Bacteria 26570
143 Ga0209371_1002497 3300027312 Bacteria 10207
144 Ga0209371_1002941 3300027312 Bacteria 8883
145 Ga0209371_1011106 3300027312 Bacteria 2701
146 Ga0268266_10001611 3300028379 Bacteria 26347
147 Ga0307515_10181835 3300028794 Bacteria 2049
148 Ga0268256_1000001 3300030500 Bacteria 2771065
149 Ga0268256_1000136 3300030500 Bacteria 101369
150 Ga0268256_1000180 3300030500 Bacteria 74594
151 Ga0268256_1002218 3300030500 Bacteria 10219
152 Ga0268256_1012017 3300030500 Bacteria 2701
153 Ga0268256_1019075 3300030500 Bacteria 1886
154 Ga0436365_1910565 3300039437 Bacteria 475219
155 Ga0439438_002824 3300041405 Bacteria 7248
156 Ga0439438_004107 3300041405 Bacteria 5685
157 Ga0439447_006056 3300041407 Bacteria 3966
158 Ga0451853_0501298 3300041512 Bacteria 1378
159 Ga0439432_018800 3300042006 Bacteria 2305
160 Ga0439452_000021 3300042010 Bacteria 274062
161 Ga0439452_000286 3300042010 Bacteria 32655
162 Ga0439452_000396 3300042010 Bacteria 25865
163 Ga0450900_002265 3300042136 Bacteria 2018
164 Ga0439446_0008014 3300042156 Bacteria 2792
165 Ga0439464_0002813 3300042439 Bacteria 4323
166 Ga0466981_0000039 3300044669 Bacteria 47011
167 Ga0495627_000126 3300046453 Bacteria 93150
168 Ga0495627_003139 3300046453 Bacteria 7471
169 Ga0495591_000513 3300046458 Bacteria 30422
170 Ga0495591_001159 3300046458 Bacteria 17260
171 Ga0495638_0001144 3300046460 Bacteria 25617
172 Ga0495638_0001341 3300046460 Bacteria 22588
173 Ga0495638_0016193 3300046460 Bacteria 4997
174 Ga0495638_0030323 3300046460 Bacteria 3482
175 Ga0495650_0000016 3300046471 Bacteria 554693
176 Ga0495650_0000021 3300046471 Bacteria 531242
177 Ga0495650_0000032 3300046471 Bacteria 425389
178 Ga0495650_0000217 3300046471 Bacteria 120688
179 Ga0495650_0013229 3300046471 Bacteria 4379
180 Ga0495650_0089898 3300046471 Bacteria 1170
181 Ga0495605_0062590 3300046474 Bacteria 1777
182 Ga0495584_0006356 3300046491 Bacteria 6189
183 Ga0495607_0047587 3300046501 Bacteria 2512
184 Ga0495583_0000002 3300046506 Bacteria 782521
185 Ga0495606_0000483 3300046507 Bacteria 65224
186 Ga0495606_0005689 3300046507 Bacteria 11799
187 Ga0495610_0000157 3300046512 Bacteria 75701
188 Ga0495610_0021139 3300046512 Bacteria 3585
189 Ga0495616_0000286 3300046513 Bacteria 40792
190 Ga0495616_0021460 3300046513 Bacteria 3498
191 Ga0495620_0112578 3300046515 Bacteria 1077
192 Ga0495632_0002577 3300046519 Bacteria 13693
193 Ga0495632_0175359 3300046519 Bacteria 983
194 Ga0495643_0217073 3300046522 Bacteria 909
195 Ga0495648_0032483 3300046524 Bacteria 3423
196 Ga0495648_0136667 3300046524 Bacteria 1295
197 Ga0495663_0024138 3300046525 Bacteria 1766
198 Ga0495654_0000042 3300046530 Bacteria 164346
199 Ga0495654_0000052 3300046530 Bacteria 145382
200 Ga0495654_0000543 3300046530 Bacteria 30408
201 Ga0495654_0011634 3300046530 Bacteria 4754
202 Ga0495654_0015302 3300046530 Bacteria 4075
203 Ga0495597_0000352 3300046542 Bacteria 41199
204 Ga0495668_0005552 3300046616 Bacteria 8491
205 Ga0495668_0021368 3300046616 Bacteria 3712
206 Ga0495625_0000170 3300046660 Bacteria 102224
207 Ga0495625_0001751 3300046660 Bacteria 25108
208 Ga0495625_0004619 3300046660 Bacteria 12943
209 Ga0495625_0040066 3300046660 Bacteria 3419
210 Ga0495625_0044377 3300046660 Bacteria 3218
211 Ga0495625_0127721 3300046660 Bacteria 1725
212 Ga0495625_0149393 3300046660 Bacteria 1571
213 Ga0495671_0008541 3300046692 Bacteria 5755
214 Ga0495649_0012666 3300046694 Bacteria 4894
215 Ga0495589_0000004 3300046794 Bacteria 439891
216 Ga0495589_0065031 3300046794 Bacteria 1788
217 Ga0495660_0000007 3300046810 Bacteria 485295
218 Ga0495660_0000021 3300046810 Bacteria 293250
219 Ga0495660_0010784 3300046810 Bacteria 5307
220 Ga0495672_0000002 3300047320 Bacteria 740116
221 Ga0495672_0000199 3300047320 Bacteria 85658
222 Ga0495672_0001289 3300047320 Bacteria 24996
223 Ga0495683_0068165 3300047323 Bacteria 1750
224 Ga0495679_000020 3300047446 Bacteria 228413
225 Ga0495679_008134 3300047446 Bacteria 4293
226 Ga0495679_036007 3300047446 Bacteria 1565
227 Ga0495673_0000095 3300047469 Bacteria 183429
228 Ga0495673_0000147 3300047469 Bacteria 125742
229 Ga0495673_0000542 3300047469 Bacteria 38769
230 Ga0495673_0002053 3300047469 Bacteria 14740
231 Ga0495681_0015367 3300047470 Bacteria 4334
232 Ga0495681_0025691 3300047470 Bacteria 3077
233 Ga0495686_0121980 3300047472 Bacteria 1552
234 Ga0496100_0070052 3300048903 Bacteria 2337
235 Ga0496101_0066600 3300048904 Bacteria 2628
236 Ga0496103_0081389 3300048906 Bacteria 2037
237 Ga0496104_0000585 3300048907 Bacteria 31096
238 Ga0496104_0002514 3300048907 Bacteria 15791
239 Ga0496104_0089486 3300048907 Bacteria 2941
240 Ga0496104_0298427 3300048907 Bacteria 1523
241 Ga0496106_0051231 3300048909 Bacteria 3113
242 Ga0496107_0000042 3300048910 Bacteria 75015
243 Ga0496115_0096769 3300048918 Bacteria 2417
244 Ga0496116_0000001 3300048919 Bacteria 1501681
245 Ga0496116_0000127 3300048919 Bacteria 158773
246 Ga0496116_0000145 3300048919 Bacteria 145993
247 Ga0496116_0000392 3300048919 Bacteria 64036
248 Ga0496116_0001074 3300048919 Bacteria 32910
249 Ga0496116_0003411 3300048919 Bacteria 15717
250 Ga0496116_0009633 3300048919 Bacteria 8217
251 Ga0496116_0010592 3300048919 Bacteria 7711
252 Ga0496116_0011095 3300048919 Bacteria 7493
253 Ga0496116_0024207 3300048919 Bacteria 4496
254 Ga0496117_0000436 3300048920 Bacteria 69452
255 Ga0496117_0000608 3300048920 Bacteria 58353
256 Ga0496117_0001974 3300048920 Bacteria 27271
257 Ga0496117_0005286 3300048920 Bacteria 13679
258 Ga0496117_0009686 3300048920 Bacteria 8908
259 Ga0496117_0137123 3300048920 Bacteria 1472
260 Ga0496118_0000464 3300048921 Bacteria 67368
261 Ga0496118_0000650 3300048921 Bacteria 56685
262 Ga0496118_0006588 3300048921 Bacteria 12684
263 Ga0496118_0006856 3300048921 Bacteria 12349
264 Ga0496118_0007432 3300048921 Bacteria 11614
265 Ga0496118_0025762 3300048921 Bacteria 5031
266 Ga0496118_0029505 3300048921 Bacteria 4597
267 Ga0496118_0056962 3300048921 Bacteria 2933
268 Ga0496118_0263025 3300048921 Bacteria 972
269 Ga0496119_0000080 3300048922 Bacteria 139962
270 Ga0496119_0001227 3300048922 Bacteria 31931
271 Ga0496119_0002777 3300048922 Bacteria 18799
272 Ga0496119_0006765 3300048922 Bacteria 10514
273 Ga0496119_0020686 3300048922 Bacteria 4786
274 Ga0496119_0038452 3300048922 Bacteria 3091
275 Ga0496119_0065507 3300048922 Bacteria 2151
276 Ga0496119_0101107 3300048922 Bacteria 1618
277 Ga0496120_0000075 3300048923 Bacteria 163540
278 Ga0496120_0000128 3300048923 Bacteria 127855
279 Ga0496120_0002252 3300048923 Bacteria 20156
280 Ga0496120_0005088 3300048923 Bacteria 10642
281 Ga0496120_0021517 3300048923 Bacteria 4075
282 Ga0496120_0051487 3300048923 Bacteria 2351
283 Ga0496120_0101362 3300048923 Bacteria 1520
284 Ga0496120_0117802 3300048923 Bacteria 1377
285 Ga0496121_0000794 3300048924 Bacteria 57780
286 Ga0496121_0004945 3300048924 Bacteria 17485
287 Ga0496121_0005999 3300048924 Bacteria 15334
288 Ga0496121_0023459 3300048924 Bacteria 5940
289 Ga0496121_0026477 3300048924 Bacteria 5462
290 Ga0496121_0031468 3300048924 Bacteria 4846
291 Ga0496121_0046941 3300048924 Bacteria 3690
292 Ga0496121_0058378 3300048924 Bacteria 3190
293 Ga0496121_0089815 3300048924 Bacteria 2403
294 Ga0496121_0246489 3300048924 Bacteria 1241
295 Ga0496122_0000013 3300048925 Bacteria 501039
296 Ga0496122_0000211 3300048925 Bacteria 130145
297 Ga0496122_0000356 3300048925 Bacteria 98548
298 Ga0496122_0002599 3300048925 Bacteria 25300
299 Ga0496122_0004795 3300048925 Bacteria 16537
300 Ga0496122_0007725 3300048925 Bacteria 11838
301 Ga0496122_0088576 3300048925 Bacteria 2120
302 Ga0496122_0090127 3300048925 Bacteria 2094
303 Ga0496123_0000010 3300048926 Bacteria 501039
304 Ga0496123_0000134 3300048926 Bacteria 153219
305 Ga0496123_0000309 3300048926 Bacteria 94366
306 Ga0496123_0000700 3300048926 Bacteria 54995
307 Ga0496123_0001890 3300048926 Bacteria 27331
308 Ga0496123_0007397 3300048926 Bacteria 10365
309 Ga0496123_0018854 3300048926 Bacteria 5464
310 Ga0496123_0035162 3300048926 Bacteria 3575
311 Ga0496123_0153004 3300048926 Bacteria 1241
312 Ga0496124_0000152 3300048927 Bacteria 140118
313 Ga0496124_0009609 3300048927 Bacteria 9911
314 Ga0496124_0093103 3300048927 Bacteria 2453
315 Ga0496124_0096042 3300048927 Bacteria 2408
316 Ga0496124_0146489 3300048927 Bacteria 1857
317 Ga0496124_0274489 3300048927 Bacteria 1232
318 Ga0496125_0000019 3300048928 Bacteria 474989
319 Ga0496125_0002790 3300048928 Bacteria 22082
320 Ga0496125_0006354 3300048928 Bacteria 12817
321 Ga0496125_0008230 3300048928 Bacteria 10962
322 Ga0496125_0088974 3300048928 Bacteria 2324
323 Ga0496126_0002540 3300048929 Bacteria 24417
324 Ga0496126_0003071 3300048929 Bacteria 21610
325 Ga0496126_0004794 3300048929 Bacteria 15896
326 Ga0496126_0016875 3300048929 Bacteria 7288
327 Ga0496126_0099053 3300048929 Bacteria 2553
328 Ga0496126_0124582 3300048929 Bacteria 2231
329 Ga0496126_0275972 3300048929 Bacteria 1394
330 Ga0496126_0307664 3300048929 Bacteria 1305
331 Ga0495678_000326 3300049459 Bacteria 50497
332 Ga0495682_0000015 3300049460 Bacteria 235048
333 nmdc:mga00v17_3690_c1 3300050491 Bacteria 7909
334 nmdc:mga00v17_6380_c1 3300050491 Bacteria 6257
335 nmdc:mga0k408_38189_c1 3300050493 Bacteria 2756
336 Ga0500554_004652 3300053102 Bacteria 2926
337 Ga0500555_026318 3300053103 Bacteria 1663
338 Ga0500556_0000568 3300053104 Bacteria 24516
339 Ga0500614_010536 3300053123 Bacteria 1987
340 Ga0500618_006218 3300053125 Bacteria 3526
341 Ga0500621_000001 3300053126 Bacteria 1049698
342 Ga0500658_0000384 3300053134 Bacteria 19452
343 Ga0500559_0000720 3300053136 Bacteria 21746
344 Ga0500559_0055393 3300053136 Bacteria 1758
345 Ga0500577_0005208 3300053142 Bacteria 3488
346 Ga0500627_0075858 3300053158 Bacteria 1494
347 Ga0500611_013272 3300053727 Bacteria 1410
348 Ga0500645_044513 3300053730 Bacteria 1305
349 Ga0500609_001502 3300053731 Bacteria 3409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0112578 Ga0495620_0112578_345_1040 231
2 3300047470 Ga0495681_0015367 Ga0495681_0015367_2149_2961 242
3 3300046471 Ga0495650_0089898 Ga0495650_0089898_36_770 244
4 iso_pu_bacteria 2923634449 2923638905 248
5 3300046522 Ga0495643_0217073 Ga0495643_0217073_14_772 252
6 3300003794 Ga0055531_10018802 Ga0055531_100188022 257
7 3300003775 Ga0055524_1015544 Ga0055524_10155443 258
8 3300005262 Ga0065165_1000561 Ga0065165_100056143 258
9 3300006195 Ga0075366_10051047 Ga0075366_100510472 258
10 3300006195 Ga0075366_10135582 Ga0075366_101355821 258
11 3300025295 Ga0209564_1007509 Ga0209564_10075096 258
12 3300025299 Ga0209256_1001549 Ga0209256_10015498 258
13 3300028794 Ga0307515_10181835 Ga0307515_101818352 258
14 3300046453 Ga0495627_003139 Ga0495627_003139_5400_6200 258
15 3300046460 Ga0495638_0016193 Ga0495638_0016193_79_882 258
16 3300046507 Ga0495606_0005689 Ga0495606_0005689_5823_6623 258
17 3300046512 Ga0495610_0021139 Ga0495610_0021139_1510_2328 258
18 3300046513 Ga0495616_0000286 Ga0495616_0000286_20927_21730 258
19 3300046519 Ga0495632_0175359 Ga0495632_0175359_89_892 258
20 3300046616 Ga0495668_0005552 Ga0495668_0005552_3473_4276 258
21 3300050493 nmdc:mga0k408_38189_c1 nmdc:mga0k408_38189_c1_1061_1864 258
22 3300053136 Ga0500559_0000720 Ga0500559_0000720_124_927 258
23 3300053730 Ga0500645_044513 Ga0500645_044513_49_849 258
24 iso_pu_bacteria 2510917020 2511123785 258
25 iso_pu_bacteria 2643221583 2643924037 258
26 iso_pu_bacteria 2643221584 2643928234 258
27 3300025735 Ga0207713_1051234 Ga0207713_10512342 259
28 3300009011 Ga0105251_10000053 Ga0105251_1000005318 260
29 3300009011 Ga0105251_10144129 Ga0105251_101441291 260
30 3300009036 Ga0105244_10002704 Ga0105244_1000270412 260
31 3300009092 Ga0105250_10000040 Ga0105250_1000004046 260
32 3300025297 Ga0209758_1024518 Ga0209758_10245184 260
33 3300025298 Ga0209050_1017250 Ga0209050_10172504 260
34 3300025304 Ga0209257_1000200 Ga0209257_100020091 260
35 3300025711 Ga0207696_1000077 Ga0207696_100007772 260
36 3300025728 Ga0207655_1010499 Ga0207655_10104991 260
37 3300025735 Ga0207713_1000147 Ga0207713_100014789 260
38 3300027312 Ga0209371_1011106 Ga0209371_10111063 260
39 3300030500 Ga0268256_1012017 Ga0268256_10120173 260
40 3300042156 Ga0439446_0008014 Ga0439446_0008014_865_1671 260
41 3300046460 Ga0495638_0001144 Ga0495638_0001144_21689_22513 260
42 3300046460 Ga0495638_0001341 Ga0495638_0001341_5670_6476 260
43 3300046506 Ga0495583_0000002 Ga0495583_0000002_511624_512433 260
44 3300046512 Ga0495610_0000157 Ga0495610_0000157_17288_18094 260
45 3300046525 Ga0495663_0024138 Ga0495663_0024138_71_880 260
46 3300046660 Ga0495625_0000170 Ga0495625_0000170_67296_68105 260
47 3300046660 Ga0495625_0001751 Ga0495625_0001751_23982_24788 260
48 3300046660 Ga0495625_0044377 Ga0495625_0044377_2122_2928 260
49 3300046660 Ga0495625_0149393 Ga0495625_0149393_253_1059 260
50 3300046810 Ga0495660_0010784 Ga0495660_0010784_433_1239 260
51 3300047320 Ga0495672_0001289 Ga0495672_0001289_7008_7814 260
52 3300047446 Ga0495679_008134 Ga0495679_008134_2123_2935 260
53 3300047469 Ga0495673_0000147 Ga0495673_0000147_88738_89544 260
54 3300047469 Ga0495673_0002053 Ga0495673_0002053_7077_7886 260
55 3300047472 Ga0495686_0121980 Ga0495686_0121980_353_1177 260
56 3300048929 Ga0496126_0016875 Ga0496126_0016875_83_865 260
57 3300048929 Ga0496126_0275972 Ga0496126_0275972_418_1230 260
58 3300053102 Ga0500554_004652 Ga0500554_004652_1820_2626 260
59 3300053104 Ga0500556_0000568 Ga0500556_0000568_17359_18165 260
60 3300053123 Ga0500614_010536 Ga0500614_010536_685_1491 260
61 3300053125 Ga0500618_006218 Ga0500618_006218_1437_2249 260
62 3300053134 Ga0500658_0000384 Ga0500658_0000384_2078_2884 260
63 3300053136 Ga0500559_0055393 Ga0500559_0055393_439_1248 260
64 3300053142 Ga0500577_0005208 Ga0500577_0005208_473_1279 260
65 iso_pu_bacteria 2582581280 2585152054 260
66 iso_pu_bacteria 2582581293 2585194459 260
67 iso_pu_bacteria 2609459761 2609910694 260
68 iso_pu_bacteria 2818991435 2819539436 260
69 iso_pu_bacteria 2818991454 2819647690 260
70 iso_pu_bacteria 2945874760 2945878624 260
71 3300009011 Ga0105251_10001643 Ga0105251_100016433 261
72 3300009036 Ga0105244_10000942 Ga0105244_100009426 261
73 3300025728 Ga0207655_1000060 Ga0207655_100006098 261
74 3300048920 Ga0496117_0137123 Ga0496117_0137123_429_1214 261
75 iso_pu_bacteria 2585427591 2585830018 261
76 iso_pu_bacteria 2585427592 2585832291 261
77 iso_pu_bacteria 2600255256 2601536475 261
78 iso_pu_bacteria 2600255257 2601541896 261
79 iso_pu_bacteria 2600255310 2601760255 261
80 iso_pu_bacteria 2600255311 2601765658 261
81 3300046530 Ga0495654_0011634 Ga0495654_0011634_286_1086 262
82 3300046660 Ga0495625_0004619 Ga0495625_0004619_8999_9799 262
83 3300047446 Ga0495679_000020 Ga0495679_000020_97645_98445 262
84 iso_pu_bacteria 2506520007 2506577824 262
85 iso_pu_bacteria 2506520008 2506582962 262
86 iso_pu_bacteria 2508501071 2508851784 262
87 iso_pu_bacteria 2599185299 2599929165 262
88 iso_pu_bacteria 2602042046 2603638437 262
89 iso_pu_bacteria 2602042047 2603642943 262
90 iso_pu_bacteria 2602042066 2603699587 262
91 iso_pu_bacteria 2602042067 2603703551 262
92 iso_pu_bacteria 2636415599 2637226057 262
93 iso_pu_bacteria 2648501693 2650899622 262
94 iso_pu_bacteria 2654587920 2656278504 262
95 iso_pu_bacteria 2667528172 2671103480 262
96 iso_pu_bacteria 2667528173 2671108091 262
97 iso_pu_bacteria 2681812866 2681995345 262
98 iso_pu_bacteria 2681812869 2682007105 262
99 iso_pu_bacteria 2684622997 2686355650 262
100 iso_pu_bacteria 2687453601 2689444349 262
101 iso_pu_bacteria 2751185917 2753855469 262
102 iso_pu_bacteria 2765235842 2765588446 262
103 iso_pu_bacteria 2775506706 2775542262 262
104 iso_pu_bacteria 2791354903 2791925040 262
105 iso_pu_bacteria 2806310673 2807177152 262
106 iso_pu_bacteria 2808606414 2809126009 262
107 iso_pu_bacteria 2811995292 2813729495 262
108 iso_pu_bacteria 2814123068 2814696984 262
109 iso_pu_bacteria 2821118458 2821119280 262
110 iso_pu_bacteria 2823373977 2823374235 262
111 iso_pu_bacteria 2844425489 2844427015 262
112 iso_pu_bacteria 2847085930 2847088175 262
113 iso_pu_bacteria 2847797336 2847802262 262
114 iso_pu_bacteria 2869551831 2869553701 262
115 iso_pu_bacteria 2904474040 2904475238 262
116 iso_pu_bacteria 2904513164 2904517540 262
117 iso_pu_bacteria 2908669403 2908670724 262
118 iso_pu_bacteria 2919150387 2919151584 262
119 iso_pu_bacteria 2927143783 2927146458 262
120 iso_pu_bacteria 2927833300 2927834603 262
121 iso_pu_bacteria 2937539931 2937543305 262
122 iso_pu_bacteria 2939568625 2939568670 262
123 iso_pu_bacteria 2939607340 2939607982 262
124 iso_pu_bacteria 2939642701 2939644285 262
125 iso_pu_bacteria 2974310843 2974312630 262
126 iso_pu_bacteria 2984494565 2984494690 262
127 iso_pu_bacteria 2984559226 2984560087 262
128 iso_pu_bacteria 2984595703 2984598169 262
129 iso_pu_bacteria 2990261002 2990265308 262
130 iso_pu_bacteria 640753048 640937352 262
131 iso_pu_bacteria 8018221730 8018225427 262
132 iso_pu_bacteria 8018405270 8018407195 262
133 iso_pu_bacteria 8054844752 8054844770 262
134 iso_pu_bacteria 8055087960 8055088595 262
135 iso_pu_bacteria 8055092621 8055094171 262
136 iso_pu_bacteria 8055097453 8055099587 262
137 iso_pu_bacteria 8057160832 8057162384 262
138 3300003773 Ga0055537_1001438 Ga0055537_10014386 263
139 3300003775 Ga0055524_1026756 Ga0055524_10267562 263
140 3300003790 Ga0055528_1008952 Ga0055528_10089524 263
141 3300025263 Ga0209565_1000140 Ga0209565_100014060 263
142 3300025263 Ga0209565_1027198 Ga0209565_10271982 263
143 3300025273 Ga0209673_1000630 Ga0209673_100063024 263
144 3300025291 Ga0209675_1006367 Ga0209675_10063676 263
145 3300025295 Ga0209564_1035222 Ga0209564_10352223 263
146 3300025295 Ga0209564_1039265 Ga0209564_10392652 263
147 3300025297 Ga0209758_1056441 Ga0209758_10564412 263
148 3300025299 Ga0209256_1003734 Ga0209256_100373410 263
149 3300041512 Ga0451853_0501298 Ga0451853_0501298_412_1227 263
150 3300046460 Ga0495638_0030323 Ga0495638_0030323_1505_2335 263
151 3300046471 Ga0495650_0000217 Ga0495650_0000217_31473_32288 263
152 3300046519 Ga0495632_0002577 Ga0495632_0002577_1312_2130 263
153 3300046524 Ga0495648_0136667 Ga0495648_0136667_309_1124 263
154 3300046530 Ga0495654_0000042 Ga0495654_0000042_7104_7919 263
155 3300046616 Ga0495668_0021368 Ga0495668_0021368_126_944 263
156 3300046660 Ga0495625_0040066 Ga0495625_0040066_2476_3291 263
157 3300046660 Ga0495625_0127721 Ga0495625_0127721_109_939 263
158 3300048909 Ga0496106_0051231 Ga0496106_0051231_2163_2978 263
159 3300048910 Ga0496107_0000042 Ga0496107_0000042_35151_35966 263
160 3300048918 Ga0496115_0096769 Ga0496115_0096769_1109_1924 263
161 3300048924 Ga0496121_0000794 Ga0496121_0000794_39623_40438 263
162 3300053103 Ga0500555_026318 Ga0500555_026318_78_893 263
163 3300053158 Ga0500627_0075858 Ga0500627_0075858_418_1233 263
164 3300053727 Ga0500611_013272 Ga0500611_013272_372_1202 263
165 3300053731 Ga0500609_001502 Ga0500609_001502_1454_2272 263
166 iso_pu_bacteria 2554235234 2555260455 263
167 iso_pu_bacteria 2599185169 2599411130 263
168 iso_pu_bacteria 2600255254 2601523561 263
169 iso_pu_bacteria 2600255255 2601528720 263
170 iso_pu_bacteria 2600255280 2601615553 263
171 iso_pu_bacteria 2600255281 2601620727 263
172 iso_pu_bacteria 2600255287 2601643380 263
173 iso_pu_bacteria 2600255288 2601649124 263
174 iso_pu_bacteria 2600255289 2601653604 263
175 iso_pu_bacteria 2600255290 2601659024 263
176 iso_pu_bacteria 2600255291 2601663203 263
177 iso_pu_bacteria 2600255298 2601696162 263
178 iso_pu_bacteria 2600255299 2601700836 263
179 iso_pu_bacteria 2600255300 2601707819 263
180 iso_pu_bacteria 2600255301 2601712878 263
181 iso_pu_bacteria 2600255302 2601716863 263
182 iso_pu_bacteria 2600255303 2601721186 263
183 iso_pu_bacteria 2600255304 2601724974 263
184 iso_pu_bacteria 2600255305 2601732257 263
185 iso_pu_bacteria 2600255306 2601737865 263
186 iso_pu_bacteria 2600255307 2601744008 263
187 iso_pu_bacteria 2600255309 2601753394 263
188 iso_pu_bacteria 2600255392 2602022021 263
189 iso_pu_bacteria 2602042052 2603660586 263
190 iso_pu_bacteria 2602042053 2603665858 263
191 iso_pu_bacteria 2602042103 2603839206 263
192 iso_pu_bacteria 2602042104 2603844738 263
193 iso_pu_bacteria 2602042105 2603849363 263
194 iso_pu_bacteria 2602042106 2603854432 263
195 iso_pu_bacteria 2602042109 2603867470 263
196 iso_pu_bacteria 2602042110 2603870155 263
197 iso_pu_bacteria 2602042111 2603875110 263
198 iso_pu_bacteria 2603880178 2606047346 263
199 iso_pu_bacteria 2603880184 2606070292 263
200 iso_pu_bacteria 2603880202 2606146151 263
201 iso_pu_bacteria 2603880211 2606177078 263
202 iso_pu_bacteria 2643221545 2643748670 263
203 iso_pu_bacteria 2643221552 2643782928 263
204 iso_pu_bacteria 2643221691 2644510345 263
205 iso_pu_bacteria 2675903046 2676407755 263
206 iso_pu_bacteria 2775507074 2777020581 263
207 iso_pu_bacteria 2919108558 2919112886 263
208 iso_pu_bacteria 2969079654 2969083069 263
209 iso_pu_bacteria 2971820967 2971824347 263
210 3300021384 Ga0213876_10000016 Ga0213876_10000016193 264
211 3300039437 Ga0436365_1910565 Ga0436365_1910565_275717_276520 264
212 3300048925 Ga0496122_0000211 Ga0496122_0000211_53736_54539 264
213 3300048926 Ga0496123_0000134 Ga0496123_0000134_91988_92791 264
214 3300013307 Ga0157372_10023649 Ga0157372_100236495 265
215 3300027312 Ga0209371_1002941 Ga0209371_10029416 265
216 3300041405 Ga0439438_004107 Ga0439438_004107_741_1559 265
217 3300041407 Ga0439447_006056 Ga0439447_006056_1538_2356 265
218 3300046458 Ga0495591_001159 Ga0495591_001159_7950_8771 265
219 3300046471 Ga0495650_0000032 Ga0495650_0000032_192673_193494 265
220 3300046474 Ga0495605_0062590 Ga0495605_0062590_133_954 265
221 3300046491 Ga0495584_0006356 Ga0495584_0006356_2240_3061 265
222 3300046507 Ga0495606_0000483 Ga0495606_0000483_366_1187 265
223 3300046513 Ga0495616_0021460 Ga0495616_0021460_1171_1992 265
224 3300046524 Ga0495648_0032483 Ga0495648_0032483_194_1015 265
225 3300046530 Ga0495654_0000052 Ga0495654_0000052_14740_15561 265
226 3300046692 Ga0495671_0008541 Ga0495671_0008541_4026_4847 265
227 3300046694 Ga0495649_0012666 Ga0495649_0012666_694_1515 265
228 3300046794 Ga0495589_0065031 Ga0495589_0065031_518_1339 265
229 3300046810 Ga0495660_0000021 Ga0495660_0000021_43392_44213 265
230 3300047320 Ga0495672_0000002 Ga0495672_0000002_156330_157151 265
231 3300047323 Ga0495683_0068165 Ga0495683_0068165_201_1022 265
232 3300047469 Ga0495673_0000095 Ga0495673_0000095_169429_170250 265
233 3300049459 Ga0495678_000326 Ga0495678_000326_11035_11856 265
234 3300049460 Ga0495682_0000015 Ga0495682_0000015_81270_82091 265
235 3300053126 Ga0500621_000001 Ga0500621_000001_791946_792767 265
236 2162886007 SwRhRL2b_contig_2705273 SwRhRL2b_0785.00003760 266
237 3300001989 JGI24739J22299_10000821 JGI24739J22299_1000082111 266
238 3300002737 JGI25162J39368_1000084 JGI25162J39368_100008497 266
239 3300002771 JGI25163J39215_1000095 JGI25163J39215_100009541 266
240 3300002771 JGI25163J39215_1000124 JGI25163J39215_100012420 266
241 3300002772 JGI25164J39214_1000062 JGI25164J39214_100006214 266
242 3300003320 rootH2_10059718 rootH2_100597183 266
243 3300003751 Ga0055538_1000060 Ga0055538_100006097 266
244 3300003752 Ga0055539_1000092 Ga0055539_100009297 266
245 3300003756 Ga0055533_1000101 Ga0055533_100010197 266
246 3300003759 Ga0055525_1000134 Ga0055525_100013497 266
247 3300003841 Ga0055541_1000062 Ga0055541_100006297 266
248 3300003856 Ga0058692_1002831 Ga0058692_10028318 266
249 3300003856 Ga0058692_1003237 Ga0058692_10032378 266
250 3300003856 Ga0058692_1003615 Ga0058692_10036152 266
251 3300005289 Ga0065704_10000664 Ga0065704_100006642 266
252 3300005289 Ga0065704_10000674 Ga0065704_1000067441 266
253 3300005289 Ga0065704_10000722 Ga0065704_100007227 266
254 3300005289 Ga0065704_10004428 Ga0065704_100044284 266
255 3300005289 Ga0065704_10087996 Ga0065704_100879963 266
256 3300005366 Ga0070659_100101047 Ga0070659_1001010471 266
257 3300005548 Ga0070665_100000446 Ga0070665_10000044645 266
258 3300005577 Ga0068857_100001056 Ga0068857_1000010562 266
259 3300006051 Ga0075364_10011159 Ga0075364_100111594 266
260 3300006051 Ga0075364_10013894 Ga0075364_100138947 266
261 3300006946 Ga0079104_1006009 Ga0079104_10060097 266
262 3300006946 Ga0079104_1011871 Ga0079104_10118713 266
263 3300006946 Ga0079104_1011876 Ga0079104_10118763 266
264 3300006946 Ga0079104_1012532 Ga0079104_10125323 266
265 3300006946 Ga0079104_1012627 Ga0079104_10126273 266
266 3300009011 Ga0105251_10000465 Ga0105251_1000046538 266
267 3300009011 Ga0105251_10000606 Ga0105251_1000060621 266
268 3300009011 Ga0105251_10001506 Ga0105251_100015069 266
269 3300009011 Ga0105251_10004673 Ga0105251_100046735 266
270 3300009011 Ga0105251_10010121 Ga0105251_100101215 266
271 3300009011 Ga0105251_10136348 Ga0105251_101363482 266
272 3300009036 Ga0105244_10000569 Ga0105244_1000056925 266
273 3300009036 Ga0105244_10001226 Ga0105244_100012267 266
274 3300009036 Ga0105244_10001863 Ga0105244_100018635 266
275 3300009036 Ga0105244_10009582 Ga0105244_100095825 266
276 3300009036 Ga0105244_10183973 Ga0105244_101839731 266
277 3300009092 Ga0105250_10000003 Ga0105250_1000000317 266
278 3300009092 Ga0105250_10001600 Ga0105250_1000160012 266
279 3300009092 Ga0105250_10005696 Ga0105250_100056963 266
280 3300009092 Ga0105250_10030172 Ga0105250_100301723 266
281 3300009092 Ga0105250_10032752 Ga0105250_100327522 266
282 3300009092 Ga0105250_10035634 Ga0105250_100356342 266
283 3300009101 Ga0105247_10000599 Ga0105247_100005994 266
284 3300009148 Ga0105243_10057395 Ga0105243_100573952 266
285 3300009174 Ga0105241_10000005 Ga0105241_10000005241 266
286 3300013100 Ga0157373_10002016 Ga0157373_1000201618 266
287 3300013100 Ga0157373_10036192 Ga0157373_100361924 266
288 3300013100 Ga0157373_10152814 Ga0157373_101528142 266
289 3300013102 Ga0157371_10000101 Ga0157371_1000010189 266
290 3300013102 Ga0157371_10001776 Ga0157371_1000177617 266
291 3300013102 Ga0157371_10116122 Ga0157371_101161223 266
292 3300013102 Ga0157371_10200358 Ga0157371_102003582 266
293 3300013104 Ga0157370_10000796 Ga0157370_1000079612 266
294 3300013104 Ga0157370_10002997 Ga0157370_100029978 266
295 3300013104 Ga0157370_10033336 Ga0157370_100333363 266
296 3300013306 Ga0163162_10021821 Ga0163162_100218217 266
297 3300013307 Ga0157372_10154077 Ga0157372_101540774 266
298 3300014497 Ga0182008_10004217 Ga0182008_1000421711 266
299 3300015679 Ga0183366_1001 Ga0183366_1001839 266
300 3300015680 Ga0183370_1001 Ga0183370_1001839 266
301 3300015685 Ga0183369_1001 Ga0183369_1001839 266
302 3300015687 Ga0183368_1001 Ga0183368_1001839 266
303 3300017792 Ga0163161_10000001 Ga0163161_10000001530 266
304 3300025207 Ga0209760_100001 Ga0209760_100001157 266
305 3300025224 Ga0209784_100001 Ga0209784_1000011119 266
306 3300025225 Ga0209566_100001 Ga0209566_1000011119 266
307 3300025226 Ga0209674_100002 Ga0209674_1000021119 266
308 3300025230 Ga0209563_100008 Ga0209563_1000081120 266
309 3300025231 Ga0207427_100002 Ga0207427_100002157 266
310 3300025233 Ga0209437_100007 Ga0209437_100007572 266
311 3300025253 Ga0209677_100004 Ga0209677_1000041120 266
312 3300025711 Ga0207696_1000001 Ga0207696_1000001604 266
313 3300025711 Ga0207696_1000004 Ga0207696_1000004617 266
314 3300025711 Ga0207696_1001271 Ga0207696_100127111 266
315 3300025711 Ga0207696_1007868 Ga0207696_10078684 266
316 3300025711 Ga0207696_1020677 Ga0207696_10206773 266
317 3300025728 Ga0207655_1000001 Ga0207655_1000001841 266
318 3300025728 Ga0207655_1000009 Ga0207655_100000991 266
319 3300025728 Ga0207655_1000888 Ga0207655_100088824 266
320 3300025728 Ga0207655_1002461 Ga0207655_10024617 266
321 3300025728 Ga0207655_1003361 Ga0207655_10033614 266
322 3300025735 Ga0207713_1000040 Ga0207713_100004021 266
323 3300025735 Ga0207713_1000119 Ga0207713_100011932 266
324 3300025735 Ga0207713_1000153 Ga0207713_100015329 266
325 3300025735 Ga0207713_1000993 Ga0207713_100099322 266
326 3300025735 Ga0207713_1004074 Ga0207713_10040745 266
327 3300025735 Ga0207713_1009123 Ga0207713_10091235 266
328 3300025735 Ga0207713_1021167 Ga0207713_10211674 266
329 3300025735 Ga0207713_1054877 Ga0207713_10548773 266
330 3300025735 Ga0207713_1094916 Ga0207713_10949162 266
331 3300025900 Ga0207710_10000236 Ga0207710_1000023622 266
332 3300025911 Ga0207654_10000007 Ga0207654_10000007149 266
333 3300025935 Ga0207709_10183174 Ga0207709_101831742 266
334 3300026116 Ga0207674_10000970 Ga0207674_1000097022 266
335 3300027111 Ga0209281_1000027 Ga0209281_1000027289 266
336 3300027111 Ga0209281_1000267 Ga0209281_100026778 266
337 3300027111 Ga0209281_1000288 Ga0209281_100028819 266
338 3300027111 Ga0209281_1000759 Ga0209281_10007594 266
339 3300027111 Ga0209281_1001716 Ga0209281_10017163 266
340 3300027111 Ga0209281_1002279 Ga0209281_10022793 266
341 3300027312 Ga0209371_1000001 Ga0209371_1000001766 266
342 3300027312 Ga0209371_1000081 Ga0209371_1000081102 266
343 3300027312 Ga0209371_1000772 Ga0209371_100077213 266
344 3300027312 Ga0209371_1002497 Ga0209371_100249710 266
345 3300028379 Ga0268266_10001611 Ga0268266_1000161112 266
346 3300030500 Ga0268256_1000001 Ga0268256_10000011875 266
347 3300030500 Ga0268256_1000136 Ga0268256_10001362 266
348 3300030500 Ga0268256_1000180 Ga0268256_100018013 266
349 3300030500 Ga0268256_1002218 Ga0268256_10022185 266
350 3300030500 Ga0268256_1019075 Ga0268256_10190753 266
351 3300041405 Ga0439438_002824 Ga0439438_002824_1973_2785 266
352 3300042006 Ga0439432_018800 Ga0439432_018800_1430_2233 266
353 3300042010 Ga0439452_000021 Ga0439452_000021_216032_216859 266
354 3300042010 Ga0439452_000286 Ga0439452_000286_22487_23287 266
355 3300042010 Ga0439452_000396 Ga0439452_000396_8377_9177 266
356 3300042136 Ga0450900_002265 Ga0450900_002265_820_1632 266
357 3300042439 Ga0439464_0002813 Ga0439464_0002813_3093_3893 266
358 3300044669 Ga0466981_0000039 Ga0466981_0000039_9563_10363 266
359 3300046453 Ga0495627_000126 Ga0495627_000126_76611_77450 266
360 3300046458 Ga0495591_000513 Ga0495591_000513_16232_17032 266
361 3300046471 Ga0495650_0000016 Ga0495650_0000016_74305_75144 266
362 3300046471 Ga0495650_0000021 Ga0495650_0000021_208728_209579 266
363 3300046471 Ga0495650_0013229 Ga0495650_0013229_208_1008 266
364 3300046501 Ga0495607_0047587 Ga0495607_0047587_1466_2332 266
365 3300046530 Ga0495654_0000543 Ga0495654_0000543_2154_2957 266
366 3300046530 Ga0495654_0015302 Ga0495654_0015302_327_1127 266
367 3300046542 Ga0495597_0000352 Ga0495597_0000352_27602_28414 266
368 3300046794 Ga0495589_0000004 Ga0495589_0000004_420303_421106 266
369 3300046810 Ga0495660_0000007 Ga0495660_0000007_30500_31339 266
370 3300047320 Ga0495672_0000199 Ga0495672_0000199_28654_29466 266
371 3300047446 Ga0495679_036007 Ga0495679_036007_519_1319 266
372 3300047469 Ga0495673_0000542 Ga0495673_0000542_16265_17065 266
373 3300047470 Ga0495681_0025691 Ga0495681_0025691_1236_2048 266
374 3300048903 Ga0496100_0070052 Ga0496100_0070052_329_1141 266
375 3300048904 Ga0496101_0066600 Ga0496101_0066600_236_1048 266
376 3300048906 Ga0496103_0081389 Ga0496103_0081389_494_1333 266
377 3300048907 Ga0496104_0000585 Ga0496104_0000585_7091_7891 266
378 3300048907 Ga0496104_0002514 Ga0496104_0002514_10369_11208 266
379 3300048907 Ga0496104_0089486 Ga0496104_0089486_534_1334 266
380 3300048907 Ga0496104_0298427 Ga0496104_0298427_426_1226 266
381 3300048919 Ga0496116_0000001 Ga0496116_0000001_77367_78206 266
382 3300048919 Ga0496116_0000127 Ga0496116_0000127_30486_31325 266
383 3300048919 Ga0496116_0000145 Ga0496116_0000145_41084_41911 266
384 3300048919 Ga0496116_0000392 Ga0496116_0000392_19361_20185 266
385 3300048919 Ga0496116_0001074 Ga0496116_0001074_17114_17914 266
386 3300048919 Ga0496116_0003411 Ga0496116_0003411_2084_2884 266
387 3300048919 Ga0496116_0009633 Ga0496116_0009633_1502_2302 266
388 3300048919 Ga0496116_0010592 Ga0496116_0010592_3059_3859 266
389 3300048919 Ga0496116_0011095 Ga0496116_0011095_4010_4810 266
390 3300048919 Ga0496116_0024207 Ga0496116_0024207_1970_2770 266
391 3300048920 Ga0496117_0000436 Ga0496117_0000436_15086_15898 266
392 3300048920 Ga0496117_0000608 Ga0496117_0000608_16647_17447 266
393 3300048920 Ga0496117_0001974 Ga0496117_0001974_2730_3569 266
394 3300048920 Ga0496117_0005286 Ga0496117_0005286_12008_12808 266
395 3300048920 Ga0496117_0009686 Ga0496117_0009686_4193_5020 266
396 3300048921 Ga0496118_0000464 Ga0496118_0000464_18690_19529 266
397 3300048921 Ga0496118_0000650 Ga0496118_0000650_16647_17447 266
398 3300048921 Ga0496118_0006588 Ga0496118_0006588_6561_7388 266
399 3300048921 Ga0496118_0006856 Ga0496118_0006856_9083_9922 266
400 3300048921 Ga0496118_0007432 Ga0496118_0007432_534_1373 266
401 3300048921 Ga0496118_0025762 Ga0496118_0025762_2082_2882 266
402 3300048921 Ga0496118_0029505 Ga0496118_0029505_2082_2882 266
403 3300048921 Ga0496118_0056962 Ga0496118_0056962_1323_2123 266
404 3300048921 Ga0496118_0263025 Ga0496118_0263025_39_839 266
405 3300048922 Ga0496119_0000080 Ga0496119_0000080_91906_92730 266
406 3300048922 Ga0496119_0001227 Ga0496119_0001227_3106_3930 266
407 3300048922 Ga0496119_0002777 Ga0496119_0002777_7787_8587 266
408 3300048922 Ga0496119_0006765 Ga0496119_0006765_4245_5045 266
409 3300048922 Ga0496119_0020686 Ga0496119_0020686_3735_4535 266
410 3300048922 Ga0496119_0038452 Ga0496119_0038452_970_1809 266
411 3300048922 Ga0496119_0065507 Ga0496119_0065507_516_1316 266
412 3300048922 Ga0496119_0101107 Ga0496119_0101107_76_915 266
413 3300048923 Ga0496120_0000075 Ga0496120_0000075_70786_71610 266
414 3300048923 Ga0496120_0000128 Ga0496120_0000128_67655_68479 266
415 3300048923 Ga0496120_0002252 Ga0496120_0002252_13037_13837 266
416 3300048923 Ga0496120_0005088 Ga0496120_0005088_3665_4465 266
417 3300048923 Ga0496120_0021517 Ga0496120_0021517_59_859 266
418 3300048923 Ga0496120_0051487 Ga0496120_0051487_681_1481 266
419 3300048923 Ga0496120_0101362 Ga0496120_0101362_343_1143 266
420 3300048923 Ga0496120_0117802 Ga0496120_0117802_51_890 266
421 3300048924 Ga0496121_0004945 Ga0496121_0004945_13072_13872 266
422 3300048924 Ga0496121_0005999 Ga0496121_0005999_6115_6966 266
423 3300048924 Ga0496121_0023459 Ga0496121_0023459_1124_1924 266
424 3300048924 Ga0496121_0026477 Ga0496121_0026477_467_1267 266
425 3300048924 Ga0496121_0031468 Ga0496121_0031468_10_810 266
426 3300048924 Ga0496121_0046941 Ga0496121_0046941_963_1775 266
427 3300048924 Ga0496121_0058378 Ga0496121_0058378_1873_2673 266
428 3300048924 Ga0496121_0089815 Ga0496121_0089815_1086_1886 266
429 3300048924 Ga0496121_0246489 Ga0496121_0246489_195_995 266
430 3300048925 Ga0496122_0000013 Ga0496122_0000013_78597_79436 266
431 3300048925 Ga0496122_0000356 Ga0496122_0000356_73290_74090 266
432 3300048925 Ga0496122_0002599 Ga0496122_0002599_16465_17265 266
433 3300048925 Ga0496122_0004795 Ga0496122_0004795_12471_13271 266
434 3300048925 Ga0496122_0007725 Ga0496122_0007725_2448_3281 266
435 3300048925 Ga0496122_0088576 Ga0496122_0088576_529_1329 266
436 3300048925 Ga0496122_0090127 Ga0496122_0090127_246_1046 266
437 3300048926 Ga0496123_0000010 Ga0496123_0000010_421604_422443 266
438 3300048926 Ga0496123_0000309 Ga0496123_0000309_69108_69908 266
439 3300048926 Ga0496123_0000700 Ga0496123_0000700_16465_17265 266
440 3300048926 Ga0496123_0001890 Ga0496123_0001890_17733_18566 266
441 3300048926 Ga0496123_0007397 Ga0496123_0007397_5939_6739 266
442 3300048926 Ga0496123_0018854 Ga0496123_0018854_279_1079 266
443 3300048926 Ga0496123_0035162 Ga0496123_0035162_716_1516 266
444 3300048926 Ga0496123_0153004 Ga0496123_0153004_238_1038 266
445 3300048927 Ga0496124_0000152 Ga0496124_0000152_93560_94399 266
446 3300048927 Ga0496124_0009609 Ga0496124_0009609_4490_5290 266
447 3300048927 Ga0496124_0093103 Ga0496124_0093103_776_1576 266
448 3300048927 Ga0496124_0096042 Ga0496124_0096042_1297_2109 266
449 3300048927 Ga0496124_0146489 Ga0496124_0146489_165_965 266
450 3300048927 Ga0496124_0274489 Ga0496124_0274489_78_878 266
451 3300048928 Ga0496125_0000019 Ga0496125_0000019_20309_21148 266
452 3300048928 Ga0496125_0002790 Ga0496125_0002790_14841_15641 266
453 3300048928 Ga0496125_0006354 Ga0496125_0006354_3787_4587 266
454 3300048928 Ga0496125_0008230 Ga0496125_0008230_9671_10471 266
455 3300048928 Ga0496125_0088974 Ga0496125_0088974_849_1649 266
456 3300048929 Ga0496126_0002540 Ga0496126_0002540_8182_8982 266
457 3300048929 Ga0496126_0003071 Ga0496126_0003071_677_1516 266
458 3300048929 Ga0496126_0004794 Ga0496126_0004794_11933_12733 266
459 3300048929 Ga0496126_0099053 Ga0496126_0099053_1061_1861 266
460 3300048929 Ga0496126_0124582 Ga0496126_0124582_931_1731 266
461 3300048929 Ga0496126_0307664 Ga0496126_0307664_281_1081 266
462 3300050491 nmdc:mga00v17_3690_c1 nmdc:mga00v17_3690_c1_6181_6981 266
463 3300050491 nmdc:mga00v17_6380_c1 nmdc:mga00v17_6380_c1_1319_2119 266
464 iso_pu_bacteria 2904504865 2904505215 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

22

145

0.92

PF03096

Ndr

Ndr family

33

266

0.86

PF12146

Hydrolase_4

Serine aminopeptidase, S33

18

249

0.85

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

23

258

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v48-assembly1.cif.gz_B crystal structure of the putative alpha/beta hydrolase rutd from e.coli 0.9918 1 261
3v48-assembly1.cif.gz_B crystal structure of the putative alpha/beta hydrolase rutd from e.coli 0.9806 1 261
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.9236 2 256
4q3l-assembly1.cif.gz_A crystal structure of mgs-m2, an alpha/beta hydrolase enzyme from a medee basin deep-sea metagenome library 0.9074 2 256
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9066 3 255
ID Description Score Start End Superfamily
3v48A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9796 2 266 3.40.50.1820
3v48A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9685 2 266 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.919 2 256 3.40.50.1820
4q3lC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9057 3 256 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9018 3 255 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A376L6Q4-F1-model_v4 Putative carbamate hydrolase RutD (EC 3.5.1.-) (Aminohydrolase) 0.9937 1 258 GO:0006212
GO:0016020
GO:0016811
GO:0019740
AF-A0A377ATY6-F1-model_v4 Putative carbamate hydrolase RutD (EC 3.5.1.-) (Aminohydrolase) 0.9935 1 255 GO:0006212
GO:0016811
GO:0019740
AF-A0A6S4Y8C2-F1-model_v4 deleted 0.9933 1 259
AF-A0A377NAH8-F1-model_v4 Aminoacrylate hydrolase RutD (EC 3.5.1.-) 0.9932 36 253 GO:0006212
GO:0016811
AF-A0A2X2IES8-F1-model_v4 Putative carbamate hydrolase RutD (EC 3.5.1.-) (Aminohydrolase) 0.9922 1 224 GO:0006212
GO:0016020
GO:0016740
GO:0016811
GO:0019740
GO:0046464
GO:0047372

Feature Viewer

pLDDT pTM Quality
93.41 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map