F449319

General Info

Members Datasets Scaffolds Average Seq Length
464 244 928 427

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100001667|Ga0307408_1000016679
Length 449
Sequence MTLAPSLLPLLQAVGGTVAERQAPLTFWPFVIFTILKMLVVFTVYMVGVALLTLAERKVSAWIQDRHGPNRVGPGGLLQPAADGLKNLMKEETLPATANKPLFVMAPMLAFLPALLTWAVIPFGASWASPWGRVDMVLADLPVGFLFTLAIGSLGVYGIVLAGWASNNKYALLGGLRSSAQMVSYEIAMGLSTIPVLLLAGNVSLTAIVREQAAMGWYVFALTIAFFIFLVAAFAETNRLPFDLPEAESELVAGYHSEYSGMKFSLFFIAEYANMVTASSLMVTLFFGGWNLPFYRADDLAAVSGWIVLASVGWYLLKVLFFLXXXMWIRXTLPRFRYDQLMSLGWKFMLPLALAYIVIIAGAILALDAAGVSRHGGGFFNRYGLVLFALNVMLAVALFFFLDRGRIISPASSRLASDAVARLRAESARAAAGRHRGAVAHAPAPEAGD

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
228 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
229 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
230 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
231 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.08
Rhizosphere 98.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100001667 3300031548 Bacteria 16363
2 JGI25406J46586_10017790 3300003203 Bacteria 2932
3 Ga0065712_10019376 3300005290 Bacteria 2062
4 Ga0065715_10004932 3300005293 Bacteria 3348
5 Ga0065715_10106907 3300005293 Bacteria 2801
6 Ga0070658_10002750 3300005327 Bacteria 14643
7 Ga0070658_10003448 3300005327 Bacteria 12998
8 Ga0070658_10011571 3300005327 Bacteria 7077
9 Ga0070676_10012722 3300005328 Bacteria 4602
10 Ga0070683_100001540 3300005329 Bacteria 17845
11 Ga0070683_100004838 3300005329 Bacteria 11149
12 Ga0070683_100014508 3300005329 Bacteria 6894
13 Ga0070683_100026589 3300005329 Bacteria 5213
14 Ga0070683_100099316 3300005329 Bacteria 2740
15 Ga0070670_100021036 3300005331 Bacteria 5610
16 Ga0070670_100021256 3300005331 Bacteria 5584
17 Ga0070677_10028049 3300005333 Bacteria 2124
18 Ga0068869_100009677 3300005334 Bacteria 6258
19 Ga0070680_100006272 3300005336 Bacteria 9023
20 Ga0070680_100014365 3300005336 Bacteria 6186
21 Ga0070680_100019712 3300005336 Bacteria 5350
22 Ga0070680_100048545 3300005336 Bacteria 3460
23 Ga0070682_100002061 3300005337 Bacteria 11212
24 Ga0070682_100017273 3300005337 Bacteria 4205
25 Ga0070660_100004019 3300005339 Bacteria 10153
26 Ga0070689_100017388 3300005340 Bacteria 5280
27 Ga0070691_10002352 3300005341 Bacteria 8382
28 Ga0070687_100076449 3300005343 Bacteria 1813
29 Ga0070661_100019397 3300005344 Bacteria 4846
30 Ga0070661_100021254 3300005344 Bacteria 4632
31 Ga0070661_100023179 3300005344 Bacteria 4448
32 Ga0070668_100027586 3300005347 Bacteria 4311
33 Ga0070668_100046286 3300005347 Bacteria 3340
34 Ga0070668_100104159 3300005347 Bacteria 2251
35 Ga0070669_100027620 3300005353 Bacteria 4085
36 Ga0070669_100039551 3300005353 Bacteria 3427
37 Ga0070669_100065402 3300005353 Bacteria 2679
38 Ga0070675_100004759 3300005354 Bacteria 10361
39 Ga0070675_100006655 3300005354 Bacteria 8887
40 Ga0070675_100010750 3300005354 Bacteria 7159
41 Ga0070671_100046213 3300005355 Bacteria 3620
42 Ga0070674_100127965 3300005356 Bacteria 1889
43 Ga0070673_100032974 3300005364 Bacteria 3905
44 Ga0070673_100033256 3300005364 Bacteria 3892
45 Ga0070673_100039260 3300005364 Bacteria 3621
46 Ga0070673_100147183 3300005364 Bacteria 1992
47 Ga0070688_100029615 3300005365 Bacteria 3280
48 Ga0070659_100041621 3300005366 Bacteria 3592
49 Ga0070659_100142638 3300005366 Bacteria 1950
50 Ga0070667_100093946 3300005367 Bacteria 2583
51 Ga0070709_10053676 3300005434 Bacteria 2539
52 Ga0070714_100004697 3300005435 Bacteria 10327
53 Ga0070714_100033471 3300005435 Bacteria 4295
54 Ga0070713_100000168 3300005436 Bacteria 43646
55 Ga0070713_100016645 3300005436 Bacteria 5531
56 Ga0070710_10108489 3300005437 Bacteria 1664
57 Ga0070711_100046692 3300005439 Bacteria 2952
58 Ga0070700_100045983 3300005441 Bacteria 2695
59 Ga0070700_100145510 3300005441 Bacteria 1615
60 Ga0070708_100000086 3300005445 Bacteria 61026
61 Ga0070708_100004632 3300005445 Bacteria 10831
62 Ga0070708_100037594 3300005445 Bacteria 4224
63 Ga0070708_100205716 3300005445 Bacteria 1844
64 Ga0070663_100009306 3300005455 Bacteria 6080
65 Ga0070681_10000222 3300005458 Bacteria 44616
66 Ga0070681_10000726 3300005458 Bacteria 27264
67 Ga0070681_10002138 3300005458 Bacteria 17958
68 Ga0070681_10023103 3300005458 Bacteria 6253
69 Ga0070681_10033288 3300005458 Bacteria 5174
70 Ga0070681_10154893 3300005458 Bacteria 2217
71 Ga0070681_10169245 3300005458 Bacteria 2107
72 Ga0068867_100010986 3300005459 Bacteria 6382
73 Ga0068867_100031924 3300005459 Bacteria 3805
74 Ga0068867_100222429 3300005459 Bacteria 1522
75 Ga0070706_100032388 3300005467 Bacteria 4821
76 Ga0070707_100002230 3300005468 Bacteria 18506
77 Ga0070707_100104988 3300005468 Bacteria 2739
78 Ga0070698_100052933 3300005471 Bacteria 4126
79 Ga0070698_100125003 3300005471 Bacteria 2529
80 Ga0070699_100001800 3300005518 Bacteria 19483
81 Ga0070699_100135647 3300005518 Bacteria 2171
82 Ga0070679_100002800 3300005530 Bacteria 15833
83 Ga0070679_100007628 3300005530 Bacteria 10125
84 Ga0070679_100014942 3300005530 Bacteria 7458
85 Ga0070679_100014991 3300005530 Bacteria 7448
86 Ga0070679_100032089 3300005530 Bacteria 5194
87 Ga0070679_100053007 3300005530 Bacteria 4038
88 Ga0070679_100065160 3300005530 Bacteria 3631
89 Ga0070684_100002576 3300005535 Bacteria 13386
90 Ga0070684_100004308 3300005535 Bacteria 10808
91 Ga0070684_100022298 3300005535 Bacteria 5279
92 Ga0070684_100054200 3300005535 Bacteria 3494
93 Ga0070684_100085145 3300005535 Bacteria 2803
94 Ga0070684_100197796 3300005535 Bacteria 1830
95 Ga0068853_100009430 3300005539 Bacteria 7863
96 Ga0068853_100026661 3300005539 Bacteria 4854
97 Ga0068853_100035404 3300005539 Bacteria 4241
98 Ga0070672_100061886 3300005543 Bacteria 2952
99 Ga0070695_100004158 3300005545 Bacteria 8464
100 Ga0070696_100005005 3300005546 Bacteria 8856
101 Ga0070696_100005983 3300005546 Bacteria 8121
102 Ga0070696_100008872 3300005546 Bacteria 6726
103 Ga0070693_100002175 3300005547 Bacteria 8984
104 Ga0070693_100025733 3300005547 Bacteria 3169
105 Ga0070665_100021114 3300005548 Bacteria 6546
106 Ga0068855_100006161 3300005563 Bacteria 14625
107 Ga0068855_100017575 3300005563 Bacteria 8600
108 Ga0070664_100002111 3300005564 Bacteria 15896
109 Ga0070664_100022195 3300005564 Bacteria 5235
110 Ga0070664_100049450 3300005564 Bacteria 3556
111 Ga0070664_100060885 3300005564 Bacteria 3216
112 Ga0070664_100084749 3300005564 Bacteria 2736
113 Ga0068857_100001747 3300005577 Bacteria 17473
114 Ga0068857_100005311 3300005577 Bacteria 10970
115 Ga0068857_100034225 3300005577 Bacteria 4494
116 Ga0068857_100036956 3300005577 Bacteria 4325
117 Ga0068854_100002751 3300005578 Bacteria 10920
118 Ga0068856_100151430 3300005614 Bacteria 2328
119 Ga0068852_100022866 3300005616 Bacteria 5022
120 Ga0068859_100183883 3300005617 Bacteria 2173
121 Ga0068859_100186182 3300005617 Bacteria 2160
122 Ga0068864_100048790 3300005618 Bacteria 3641
123 Ga0068864_100076120 3300005618 Bacteria 2931
124 Ga0068864_100143367 3300005618 Bacteria 2157
125 Ga0068866_10020599 3300005718 Bacteria 3023
126 Ga0068866_10049564 3300005718 Bacteria 2129
127 Ga0068861_100006059 3300005719 Bacteria 8223
128 Ga0068851_10052979 3300005834 Bacteria 2065
129 Ga0068870_10001350 3300005840 Bacteria 9905
130 Ga0068858_100034837 3300005842 Bacteria 4669
131 Ga0068860_100024836 3300005843 Bacteria 5787
132 Ga0068860_100085278 3300005843 Bacteria 3005
133 Ga0068862_100000475 3300005844 Bacteria 43306
134 Ga0068862_100002474 3300005844 Bacteria 16357
135 Ga0081455_10126632 3300005937 Bacteria 2003
136 Ga0081539_10000103 3300005985 Bacteria 197839
137 Ga0070717_10006985 3300006028 Bacteria 8351
138 Ga0070716_100002489 3300006173 Bacteria 8510
139 Ga0070712_100003656 3300006175 Bacteria 9482
140 Ga0070712_100107123 3300006175 Bacteria 2079
141 Ga0097621_100066837 3300006237 Bacteria 2962
142 Ga0068871_100238237 3300006358 Bacteria 1581
143 Ga0075428_100011523 3300006844 Bacteria 9834
144 Ga0075428_100305913 3300006844 Bacteria 1709
145 Ga0075430_100000459 3300006846 Bacteria 30420
146 Ga0075430_100024844 3300006846 Bacteria 5096
147 Ga0075431_100012956 3300006847 Bacteria 8418
148 Ga0075431_100037702 3300006847 Bacteria 4978
149 Ga0075431_100081962 3300006847 Bacteria 3330
150 Ga0075433_10009195 3300006852 Bacteria 7897
151 Ga0075433_10176607 3300006852 Bacteria 1901
152 Ga0075434_100011092 3300006871 Bacteria 8481
153 Ga0075434_100018541 3300006871 Bacteria 6725
154 Ga0075434_100029168 3300006871 Bacteria 5426
155 Ga0068865_100005331 3300006881 Bacteria 7786
156 Ga0068865_100047045 3300006881 Bacteria 2962
157 Ga0068865_100062382 3300006881 Bacteria 2616
158 Ga0075436_100020391 3300006914 Bacteria 4550
159 Ga0075436_100045607 3300006914 Bacteria 3024
160 Ga0097620_100183889 3300006931 Bacteria 2173
161 Ga0097620_100186167 3300006931 Bacteria 2160
162 Ga0105240_10003063 3300009093 Bacteria 26282
163 Ga0105240_10134627 3300009093 Bacteria 2960
164 Ga0111539_10239593 3300009094 Bacteria 2111
165 Ga0105245_10047748 3300009098 Bacteria 3828
166 Ga0105245_10091954 3300009098 Bacteria 2793
167 Ga0114129_10074612 3300009147 Bacteria 4725
168 Ga0114129_10256211 3300009147 Bacteria 2347
169 Ga0114129_10388887 3300009147 Bacteria 1840
170 Ga0105243_10046635 3300009148 Bacteria 3409
171 Ga0105241_10040319 3300009174 Bacteria 3525
172 Ga0105242_10042819 3300009176 Bacteria 3659
173 Ga0105248_10073091 3300009177 Bacteria 3854
174 Ga0105248_10073319 3300009177 Bacteria 3847
175 Ga0105248_10187937 3300009177 Bacteria 2328
176 Ga0105237_10105564 3300009545 Bacteria 2808
177 Ga0105238_10054219 3300009551 Bacteria 4028
178 Ga0105249_10000078 3300009553 Bacteria 140030
179 Ga0105249_10000083 3300009553 Bacteria 135844
180 Ga0105249_10054085 3300009553 Bacteria 3670
181 Ga0157373_10000736 3300013100 Bacteria 25407
182 Ga0157373_10035459 3300013100 Bacteria 3581
183 Ga0157373_10135810 3300013100 Bacteria 1729
184 Ga0157371_10003723 3300013102 Bacteria 13669
185 Ga0157370_10003876 3300013104 Bacteria 17427
186 Ga0157370_10076254 3300013104 Bacteria 3159
187 Ga0157374_10305402 3300013296 Bacteria 1575
188 Ga0157378_10033186 3300013297 Bacteria 4562
189 Ga0157378_10107820 3300013297 Bacteria 2549
190 Ga0157378_10171721 3300013297 Bacteria 2034
191 Ga0163162_10015222 3300013306 Bacteria 7513
192 Ga0157372_10004945 3300013307 Bacteria 14156
193 Ga0157372_10006998 3300013307 Bacteria 12015
194 Ga0157372_10009717 3300013307 Bacteria 10231
195 Ga0157372_10065132 3300013307 Bacteria 4091
196 Ga0157372_10083786 3300013307 Bacteria 3612
197 Ga0157372_10206871 3300013307 Bacteria 2274
198 Ga0157375_10121031 3300013308 Bacteria 2727
199 Ga0157380_10019850 3300014326 Bacteria 5015
200 Ga0182008_10013835 3300014497 Bacteria 4238
201 Ga0157379_10008398 3300014968 Bacteria 8975
202 Ga0157376_10012749 3300014969 Bacteria 6251
203 Ga0163161_10054355 3300017792 Bacteria 2906
204 Ga0207697_10001571 3300025315 Bacteria 12339
205 Ga0207656_10045195 3300025321 Bacteria 1884
206 Ga0207692_10128114 3300025898 Bacteria 1430
207 Ga0207642_10019277 3300025899 Bacteria 2639
208 Ga0207642_10037189 3300025899 Bacteria 2096
209 Ga0207688_10009735 3300025901 Bacteria 5230
210 Ga0207699_10093634 3300025906 Bacteria 1891
211 Ga0207645_10000052 3300025907 Bacteria 83428
212 Ga0207645_10069444 3300025907 Bacteria 2253
213 Ga0207645_10107928 3300025907 Bacteria 1801
214 Ga0207643_10008540 3300025908 Bacteria 5493
215 Ga0207705_10014323 3300025909 Bacteria 5707
216 Ga0207705_10020296 3300025909 Bacteria 4751
217 Ga0207705_10184612 3300025909 Bacteria 1575
218 Ga0207707_10000322 3300025912 Bacteria 50600
219 Ga0207707_10000368 3300025912 Bacteria 47267
220 Ga0207707_10000450 3300025912 Bacteria 42820
221 Ga0207707_10002900 3300025912 Bacteria 15289
222 Ga0207707_10021229 3300025912 Bacteria 5676
223 Ga0207707_10022748 3300025912 Bacteria 5481
224 Ga0207707_10075351 3300025912 Bacteria 2943
225 Ga0207707_10128664 3300025912 Bacteria 2214
226 Ga0207695_10002777 3300025913 Bacteria 25479
227 Ga0207693_10003536 3300025915 Bacteria 13345
228 Ga0207660_10000275 3300025917 Bacteria 33934
229 Ga0207660_10048063 3300025917 Bacteria 3019
230 Ga0207660_10087322 3300025917 Bacteria 2304
231 Ga0207662_10011631 3300025918 Bacteria 4888
232 Ga0207657_10016878 3300025919 Bacteria 7025
233 Ga0207657_10022887 3300025919 Bacteria 5832
234 Ga0207649_10027114 3300025920 Bacteria 3359
235 Ga0207649_10070077 3300025920 Bacteria 2235
236 Ga0207652_10000841 3300025921 Bacteria 29282
237 Ga0207652_10002393 3300025921 Bacteria 15836
238 Ga0207652_10013794 3300025921 Bacteria 6536
239 Ga0207652_10027492 3300025921 Bacteria 4740
240 Ga0207652_10096139 3300025921 Bacteria 2609
241 Ga0207652_10191184 3300025921 Bacteria 1841
242 Ga0207652_10264300 3300025921 Bacteria 1552
243 Ga0207646_10013124 3300025922 Bacteria 7929
244 Ga0207646_10030913 3300025922 Bacteria 4851
245 Ga0207646_10102052 3300025922 Bacteria 2572
246 Ga0207646_10248759 3300025922 Bacteria 1606
247 Ga0207681_10028927 3300025923 Bacteria 3593
248 Ga0207681_10037004 3300025923 Bacteria 3223
249 Ga0207681_10209697 3300025923 Bacteria 1501
250 Ga0207650_10018742 3300025925 Bacteria 4860
251 Ga0207650_10065094 3300025925 Bacteria 2730
252 Ga0207659_10007773 3300025926 Bacteria 6622
253 Ga0207700_10011617 3300025928 Bacteria 5626
254 Ga0207700_10074445 3300025928 Bacteria 2627
255 Ga0207664_10012405 3300025929 Bacteria 6091
256 Ga0207664_10015543 3300025929 Bacteria 5529
257 Ga0207664_10026276 3300025929 Bacteria 4399
258 Ga0207664_10094038 3300025929 Bacteria 2463
259 Ga0207690_10025567 3300025932 Bacteria 3709
260 Ga0207690_10038392 3300025932 Bacteria 3116
261 Ga0207706_10002460 3300025933 Bacteria 18078
262 Ga0207706_10070254 3300025933 Bacteria 3080
263 Ga0207706_10075611 3300025933 Bacteria 2962
264 Ga0207706_10083958 3300025933 Bacteria 2800
265 Ga0207709_10074494 3300025935 Bacteria 2166
266 Ga0207709_10121281 3300025935 Bacteria 1765
267 Ga0207670_10004394 3300025936 Bacteria 7586
268 Ga0207669_10018560 3300025937 Bacteria 3599
269 Ga0207669_10021715 3300025937 Bacteria 3395
270 Ga0207704_10028041 3300025938 Bacteria 3118
271 Ga0207665_10000198 3300025939 Bacteria 40191
272 Ga0207691_10000223 3300025940 Bacteria 55292
273 Ga0207691_10001361 3300025940 Bacteria 24383
274 Ga0207691_10003241 3300025940 Bacteria 15858
275 Ga0207691_10034050 3300025940 Bacteria 4741
276 Ga0207711_10026644 3300025941 Bacteria 4852
277 Ga0207711_10075167 3300025941 Bacteria 2940
278 Ga0207689_10006033 3300025942 Bacteria 10709
279 Ga0207661_10001347 3300025944 Bacteria 16496
280 Ga0207661_10002693 3300025944 Bacteria 12216
281 Ga0207661_10007949 3300025944 Bacteria 7562
282 Ga0207661_10021530 3300025944 Bacteria 4831
283 Ga0207661_10024086 3300025944 Bacteria 4608
284 Ga0207661_10057488 3300025944 Bacteria 3127
285 Ga0207661_10062993 3300025944 Bacteria 3002
286 Ga0207661_10138436 3300025944 Bacteria 2093
287 Ga0207679_10000491 3300025945 Bacteria 27303
288 Ga0207679_10003936 3300025945 Bacteria 9226
289 Ga0207679_10005198 3300025945 Bacteria 8157
290 Ga0207679_10057499 3300025945 Bacteria 2877
291 Ga0207667_10060633 3300025949 Bacteria 3960
292 Ga0207651_10044954 3300025960 Bacteria 2959
293 Ga0207651_10049833 3300025960 Bacteria 2840
294 Ga0207651_10163160 3300025960 Bacteria 1749
295 Ga0207712_10000079 3300025961 Bacteria 115164
296 Ga0207712_10000116 3300025961 Bacteria 86504
297 Ga0207712_10002159 3300025961 Bacteria 12848
298 Ga0207668_10022657 3300025972 Bacteria 4025
299 Ga0207640_10000433 3300025981 Bacteria 25514
300 Ga0207658_10106953 3300025986 Bacteria 2204
301 Ga0207658_10154615 3300025986 Bacteria 1873
302 Ga0207677_10006668 3300026023 Bacteria 6340
303 Ga0207639_10062129 3300026041 Bacteria 2887
304 Ga0207639_10115254 3300026041 Bacteria 2197
305 Ga0207708_10013786 3300026075 Bacteria 6042
306 Ga0207708_10120575 3300026075 Bacteria 2043
307 Ga0207641_10028325 3300026088 Bacteria 4628
308 Ga0207641_10065266 3300026088 Bacteria 3114
309 Ga0207648_10009384 3300026089 Bacteria 9367
310 Ga0207648_10016216 3300026089 Bacteria 6817
311 Ga0207648_10081959 3300026089 Bacteria 2813
312 Ga0207676_10114999 3300026095 Bacteria 2258
313 Ga0207674_10001353 3300026116 Bacteria 31708
314 Ga0207674_10001558 3300026116 Bacteria 29526
315 Ga0207674_10019328 3300026116 Bacteria 7380
316 Ga0207674_10063622 3300026116 Bacteria 3724
317 Ga0207675_100000096 3300026118 Bacteria 69990
318 Ga0207675_100005343 3300026118 Bacteria 12342
319 Ga0207675_100104659 3300026118 Bacteria 2667
320 Ga0207675_100235285 3300026118 Bacteria 1768
321 Ga0207683_10074361 3300026121 Bacteria 3006
322 Ga0207683_10098711 3300026121 Bacteria 2606
323 Ga0207698_10308080 3300026142 Bacteria 1477
324 Ga0209966_1006239 3300027695 Bacteria 2066
325 Ga0209998_10006067 3300027717 Bacteria 2514
326 Ga0268265_10000624 3300028380 Bacteria 35283
327 Ga0268264_10024396 3300028381 Bacteria 4937
328 Ga0307408_100006194 3300031548 Bacteria 7944
329 Ga0307408_100077904 3300031548 Bacteria 2469
330 Ga0265314_10025993 3300031711 Bacteria 4406
331 Ga0307405_10000086 3300031731 Bacteria 39376
332 Ga0307405_10017092 3300031731 Bacteria 3973
333 Ga0307405_10044236 3300031731 Bacteria 2722
334 Ga0307405_10056529 3300031731 Bacteria 2462
335 Ga0307405_10066945 3300031731 Bacteria 2292
336 Ga0307405_10088936 3300031731 Bacteria 2039
337 Ga0307405_10105283 3300031731 Bacteria 1900
338 Ga0307413_10000077 3300031824 Bacteria 24398
339 Ga0307413_10000315 3300031824 Bacteria 15063
340 Ga0307413_10012747 3300031824 Bacteria 4195
341 Ga0307413_10014820 3300031824 Bacteria 3974
342 Ga0307410_10000579 3300031852 Bacteria 15030
343 Ga0307410_10002114 3300031852 Bacteria 9433
344 Ga0307410_10015189 3300031852 Bacteria 4560
345 Ga0307410_10031076 3300031852 Bacteria 3422
346 Ga0307406_10002171 3300031901 Bacteria 10682
347 Ga0307406_10004315 3300031901 Bacteria 7736
348 Ga0307406_10037605 3300031901 Bacteria 2991
349 Ga0307407_10000255 3300031903 Bacteria 15796
350 Ga0307407_10000709 3300031903 Bacteria 10854
351 Ga0307407_10001289 3300031903 Bacteria 8954
352 Ga0307407_10010918 3300031903 Bacteria 4302
353 Ga0307407_10045612 3300031903 Bacteria 2478
354 Ga0307412_10000440 3300031911 Bacteria 25159
355 Ga0307412_10001958 3300031911 Bacteria 11396
356 Ga0307412_10093115 3300031911 Bacteria 2113
357 Ga0307409_100000093 3300031995 Bacteria 32355
358 Ga0307409_100003123 3300031995 Bacteria 8890
359 Ga0307409_100006408 3300031995 Bacteria 6914
360 Ga0307409_100127141 3300031995 Bacteria 2170
361 Ga0307409_100203757 3300031995 Bacteria 1772
362 Ga0307416_100003664 3300032002 Bacteria 9087
363 Ga0307416_100059390 3300032002 Bacteria 3107
364 Ga0307416_100245497 3300032002 Bacteria 1738
365 Ga0307414_10000763 3300032004 Bacteria 16522
366 Ga0307414_10001312 3300032004 Bacteria 12841
367 Ga0307414_10014903 3300032004 Bacteria 4679
368 Ga0307411_10000272 3300032005 Bacteria 17058
369 Ga0307411_10000312 3300032005 Bacteria 16261
370 Ga0307411_10087724 3300032005 Bacteria 2161
371 Ga0307411_10125557 3300032005 Bacteria 1865
372 Ga0307415_100003634 3300032126 Bacteria 7884
373 Ga0307415_100006392 3300032126 Bacteria 6348
374 Ga0373934_0000613 3300035086 Bacteria 12584
375 Ga0373955_0000555 3300035172 Bacteria 15870
376 Ga0373924_0025517 3300035410 Bacteria 2337
377 Ga0373935_0015507 3300035692 Bacteria 4607
378 Ga0373935_0077998 3300035692 Bacteria 2148
379 Ga0373933_0000055 3300035724 Bacteria 67484
380 Ga0373947_0037687 3300035725 Bacteria 2870
381 Ga0373937_0000450 3300036401 Bacteria 37946
382 Ga0373925_0032034 3300037068 Bacteria 3867
383 Ga0395900_0459811 3300037418 Bacteria 1228
384 Ga0436365_0781396 3300039437 Bacteria 1542
385 Ga0451577_0000016 3300042876 Bacteria 531002
386 Ga0466959_0027268 3300045049 Bacteria 4237
387 Ga0451576_0090668 3300045051 Bacteria 3180
388 Ga0495592_0002705 3300046454 Bacteria 12543
389 Ga0495603_0021580 3300046455 Bacteria 3900
390 Ga0495629_0011314 3300046459 Bacteria 6483
391 Ga0495629_0060097 3300046459 Bacteria 2657
392 Ga0495629_0176604 3300046459 Bacteria 1481
393 Ga0495651_0000996 3300046462 Bacteria 21980
394 Ga0495653_0000195 3300046463 Bacteria 49244
395 Ga0495580_0008769 3300046472 Bacteria 8008
396 Ga0495582_0029998 3300046473 Bacteria 2984
397 Ga0495582_0047459 3300046473 Bacteria 2366
398 Ga0495639_0008494 3300046475 Bacteria 4403
399 Ga0495608_0000085 3300046511 Bacteria 68124
400 Ga0495618_0125155 3300046514 Bacteria 1646
401 Ga0495628_0034222 3300046516 Bacteria 4088
402 Ga0495630_0022736 3300046517 Bacteria 4631
403 Ga0495652_0008685 3300046529 Bacteria 9262
404 Ga0495665_0005306 3300046531 Bacteria 6945
405 Ga0495665_0027424 3300046531 Bacteria 3057
406 Ga0495586_0042067 3300046535 Bacteria 2461
407 Ga0495587_0000114 3300046536 Bacteria 61671
408 Ga0495587_0099730 3300046536 Bacteria 1674
409 Ga0495645_0000144 3300046543 Bacteria 48490
410 Ga0495667_0000241 3300046559 Bacteria 35516
411 Ga0495635_0000253 3300046663 Bacteria 34161
412 Ga0495657_0000210 3300046675 Bacteria 52663
413 Ga0495599_0032551 3300046678 Bacteria 3272
414 Ga0495623_0000305 3300046679 Bacteria 31845
415 Ga0495623_0063515 3300046679 Bacteria 2312
416 Ga0495646_0011487 3300046680 Bacteria 5621
417 Ga0495658_0001556 3300046683 Bacteria 11985
418 Ga0495613_0051085 3300046689 Bacteria 3048
419 Ga0495600_0000023 3300046809 Bacteria 94401
420 Ga0495604_0000251 3300047317 Bacteria 47665
421 Ga0495674_0040004 3300047319 Bacteria 4197
422 Ga0495672_0003697 3300047320 Bacteria 12916
423 Ga0495680_0006224 3300047322 Bacteria 11126
424 Ga0495675_0005468 3300047444 Bacteria 7750
425 Ga0495684_0000037 3300047471 Bacteria 106933
426 Ga0495593_0006004 3300047673 Bacteria 7151
427 Ga0495602_0002980 3300048088 Bacteria 17361
428 Ga0495602_0123206 3300048088 Bacteria 2082
429 Ga0496104_0279671 3300048907 Bacteria 1582
430 Ga0496109_0073272 3300048912 Bacteria 3147
431 Ga0496112_0008419 3300048915 Bacteria 9234
432 Ga0496113_0118078 3300048916 Bacteria 2071
433 Ga0496115_0001287 3300048918 Bacteria 17908
434 Ga0501036_0057097 3300049572 Bacteria 3307
435 Ga0501047_0017515 3300049581 Bacteria 6862
436 Ga0501068_0145802 3300049584 Bacteria 1486
437 Ga0501075_0076498 3300049591 Bacteria 2532
438 Ga0501076_0179323 3300049592 Bacteria 1727
439 Ga0501227_010498 3300049665 Bacteria 2009
440 Ga0501235_001197 3300049669 Bacteria 5451
441 Ga0501242_001897 3300049674 Bacteria 2156
442 Ga0501221_000835 3300049704 Bacteria 5017
443 Ga0501225_0003228 3300049705 Bacteria 4979
444 Ga0501079_0013695 3300049741 Bacteria 6184
445 Ga0501081_0190319 3300049743 Bacteria 1486
446 nmdc:mga05p37_127480_c1 3300050507 Bacteria 3124
447 nmdc:mga05p37_16141_c1 3300050507 Bacteria 8992
448 nmdc:mga05p37_58693_c1 3300050507 Bacteria 4224
449 nmdc:mga09592_94953_c1 3300050508 Bacteria 2550
450 nmdc:mga0qj67_18998_c1 3300050509 Bacteria 5246
451 nmdc:mga06r32_171401_c1 3300050510 Bacteria 2154
452 nmdc:mga06r32_34417_c1 3300050510 Bacteria 4776
453 nmdc:mga06r32_35158_c1 3300050510 Bacteria 4728
454 nmdc:mga08y16_60782_c1 3300050511 Bacteria 3945
455 nmdc:mga08y16_95067_c1 3300050511 Bacteria 3104
456 nmdc:mga0n895_10743_c1 3300050512 Bacteria 8116
457 nmdc:mga0n895_287749_c1 3300050512 Bacteria 1666
458 nmdc:mga0n895_9918_c1 3300050512 Bacteria 8377
459 nmdc:mga08x19_4984_c1 3300050514 Bacteria 7850
460 nmdc:mga0a205_114816_c1 3300050515 Bacteria 2591
461 nmdc:mga0a205_8011_c1 3300050515 Bacteria 9602
462 Ga0495601_0002235 3300053077 Bacteria 10903
463 Ga0495612_0000577 3300053078 Bacteria 14757
464 Ga0495619_0007670 3300053085 Bacteria 6834
465 Ga0307408_100001667
466 JGI25406J46586_10017790
467 Ga0065712_10019376
468 Ga0065715_10004932
469 Ga0065715_10106907
470 Ga0070658_10002750
471 Ga0070658_10003448
472 Ga0070658_10011571
473 Ga0070676_10012722
474 Ga0070683_100001540
475 Ga0070683_100004838
476 Ga0070683_100014508
477 Ga0070683_100026589
478 Ga0070683_100099316
479 Ga0070670_100021036
480 Ga0070670_100021256
481 Ga0070677_10028049
482 Ga0068869_100009677
483 Ga0070680_100006272
484 Ga0070680_100014365
485 Ga0070680_100019712
486 Ga0070680_100048545
487 Ga0070682_100002061
488 Ga0070682_100017273
489 Ga0070660_100004019
490 Ga0070689_100017388
491 Ga0070691_10002352
492 Ga0070687_100076449
493 Ga0070661_100019397
494 Ga0070661_100021254
495 Ga0070661_100023179
496 Ga0070668_100027586
497 Ga0070668_100046286
498 Ga0070668_100104159
499 Ga0070669_100027620
500 Ga0070669_100039551
501 Ga0070669_100065402
502 Ga0070675_100004759
503 Ga0070675_100006655
504 Ga0070675_100010750
505 Ga0070671_100046213
506 Ga0070674_100127965
507 Ga0070673_100032974
508 Ga0070673_100033256
509 Ga0070673_100039260
510 Ga0070673_100147183
511 Ga0070688_100029615
512 Ga0070659_100041621
513 Ga0070659_100142638
514 Ga0070667_100093946
515 Ga0070709_10053676
516 Ga0070714_100004697
517 Ga0070714_100033471
518 Ga0070713_100000168
519 Ga0070713_100016645
520 Ga0070710_10108489
521 Ga0070711_100046692
522 Ga0070700_100045983
523 Ga0070700_100145510
524 Ga0070708_100000086
525 Ga0070708_100004632
526 Ga0070708_100037594
527 Ga0070708_100205716
528 Ga0070663_100009306
529 Ga0070681_10000222
530 Ga0070681_10000726
531 Ga0070681_10002138
532 Ga0070681_10023103
533 Ga0070681_10033288
534 Ga0070681_10154893
535 Ga0070681_10169245
536 Ga0068867_100010986
537 Ga0068867_100031924
538 Ga0068867_100222429
539 Ga0070706_100032388
540 Ga0070707_100002230
541 Ga0070707_100104988
542 Ga0070698_100052933
543 Ga0070698_100125003
544 Ga0070699_100001800
545 Ga0070699_100135647
546 Ga0070679_100002800
547 Ga0070679_100007628
548 Ga0070679_100014942
549 Ga0070679_100014991
550 Ga0070679_100032089
551 Ga0070679_100053007
552 Ga0070679_100065160
553 Ga0070684_100002576
554 Ga0070684_100004308
555 Ga0070684_100022298
556 Ga0070684_100054200
557 Ga0070684_100085145
558 Ga0070684_100197796
559 Ga0068853_100009430
560 Ga0068853_100026661
561 Ga0068853_100035404
562 Ga0070672_100061886
563 Ga0070695_100004158
564 Ga0070696_100005005
565 Ga0070696_100005983
566 Ga0070696_100008872
567 Ga0070693_100002175
568 Ga0070693_100025733
569 Ga0070665_100021114
570 Ga0068855_100006161
571 Ga0068855_100017575
572 Ga0070664_100002111
573 Ga0070664_100022195
574 Ga0070664_100049450
575 Ga0070664_100060885
576 Ga0070664_100084749
577 Ga0068857_100001747
578 Ga0068857_100005311
579 Ga0068857_100034225
580 Ga0068857_100036956
581 Ga0068854_100002751
582 Ga0068856_100151430
583 Ga0068852_100022866
584 Ga0068859_100183883
585 Ga0068859_100186182
586 Ga0068864_100048790
587 Ga0068864_100076120
588 Ga0068864_100143367
589 Ga0068866_10020599
590 Ga0068866_10049564
591 Ga0068861_100006059
592 Ga0068851_10052979
593 Ga0068870_10001350
594 Ga0068858_100034837
595 Ga0068860_100024836
596 Ga0068860_100085278
597 Ga0068862_100000475
598 Ga0068862_100002474
599 Ga0081455_10126632
600 Ga0081539_10000103
601 Ga0070717_10006985
602 Ga0070716_100002489
603 Ga0070712_100003656
604 Ga0070712_100107123
605 Ga0097621_100066837
606 Ga0068871_100238237
607 Ga0075428_100011523
608 Ga0075428_100305913
609 Ga0075430_100000459
610 Ga0075430_100024844
611 Ga0075431_100012956
612 Ga0075431_100037702
613 Ga0075431_100081962
614 Ga0075433_10009195
615 Ga0075433_10176607
616 Ga0075434_100011092
617 Ga0075434_100018541
618 Ga0075434_100029168
619 Ga0068865_100005331
620 Ga0068865_100047045
621 Ga0068865_100062382
622 Ga0075436_100020391
623 Ga0075436_100045607
624 Ga0097620_100183889
625 Ga0097620_100186167
626 Ga0105240_10003063
627 Ga0105240_10134627
628 Ga0111539_10239593
629 Ga0105245_10047748
630 Ga0105245_10091954
631 Ga0114129_10074612
632 Ga0114129_10256211
633 Ga0114129_10388887
634 Ga0105243_10046635
635 Ga0105241_10040319
636 Ga0105242_10042819
637 Ga0105248_10073091
638 Ga0105248_10073319
639 Ga0105248_10187937
640 Ga0105237_10105564
641 Ga0105238_10054219
642 Ga0105249_10000078
643 Ga0105249_10000083
644 Ga0105249_10054085
645 Ga0157373_10000736
646 Ga0157373_10035459
647 Ga0157373_10135810
648 Ga0157371_10003723
649 Ga0157370_10003876
650 Ga0157370_10076254
651 Ga0157374_10305402
652 Ga0157378_10033186
653 Ga0157378_10107820
654 Ga0157378_10171721
655 Ga0163162_10015222
656 Ga0157372_10004945
657 Ga0157372_10006998
658 Ga0157372_10009717
659 Ga0157372_10065132
660 Ga0157372_10083786
661 Ga0157372_10206871
662 Ga0157375_10121031
663 Ga0157380_10019850
664 Ga0182008_10013835
665 Ga0157379_10008398
666 Ga0157376_10012749
667 Ga0163161_10054355
668 Ga0207697_10001571
669 Ga0207656_10045195
670 Ga0207692_10128114
671 Ga0207642_10019277
672 Ga0207642_10037189
673 Ga0207688_10009735
674 Ga0207699_10093634
675 Ga0207645_10000052
676 Ga0207645_10069444
677 Ga0207645_10107928
678 Ga0207643_10008540
679 Ga0207705_10014323
680 Ga0207705_10020296
681 Ga0207705_10184612
682 Ga0207707_10000322
683 Ga0207707_10000368
684 Ga0207707_10000450
685 Ga0207707_10002900
686 Ga0207707_10021229
687 Ga0207707_10022748
688 Ga0207707_10075351
689 Ga0207707_10128664
690 Ga0207695_10002777
691 Ga0207693_10003536
692 Ga0207660_10000275
693 Ga0207660_10048063
694 Ga0207660_10087322
695 Ga0207662_10011631
696 Ga0207657_10016878
697 Ga0207657_10022887
698 Ga0207649_10027114
699 Ga0207649_10070077
700 Ga0207652_10000841
701 Ga0207652_10002393
702 Ga0207652_10013794
703 Ga0207652_10027492
704 Ga0207652_10096139
705 Ga0207652_10191184
706 Ga0207652_10264300
707 Ga0207646_10013124
708 Ga0207646_10030913
709 Ga0207646_10102052
710 Ga0207646_10248759
711 Ga0207681_10028927
712 Ga0207681_10037004
713 Ga0207681_10209697
714 Ga0207650_10018742
715 Ga0207650_10065094
716 Ga0207659_10007773
717 Ga0207700_10011617
718 Ga0207700_10074445
719 Ga0207664_10012405
720 Ga0207664_10015543
721 Ga0207664_10026276
722 Ga0207664_10094038
723 Ga0207690_10025567
724 Ga0207690_10038392
725 Ga0207706_10002460
726 Ga0207706_10070254
727 Ga0207706_10075611
728 Ga0207706_10083958
729 Ga0207709_10074494
730 Ga0207709_10121281
731 Ga0207670_10004394
732 Ga0207669_10018560
733 Ga0207669_10021715
734 Ga0207704_10028041
735 Ga0207665_10000198
736 Ga0207691_10000223
737 Ga0207691_10001361
738 Ga0207691_10003241
739 Ga0207691_10034050
740 Ga0207711_10026644
741 Ga0207711_10075167
742 Ga0207689_10006033
743 Ga0207661_10001347
744 Ga0207661_10002693
745 Ga0207661_10007949
746 Ga0207661_10021530
747 Ga0207661_10024086
748 Ga0207661_10057488
749 Ga0207661_10062993
750 Ga0207661_10138436
751 Ga0207679_10000491
752 Ga0207679_10003936
753 Ga0207679_10005198
754 Ga0207679_10057499
755 Ga0207667_10060633
756 Ga0207651_10044954
757 Ga0207651_10049833
758 Ga0207651_10163160
759 Ga0207712_10000079
760 Ga0207712_10000116
761 Ga0207712_10002159
762 Ga0207668_10022657
763 Ga0207640_10000433
764 Ga0207658_10106953
765 Ga0207658_10154615
766 Ga0207677_10006668
767 Ga0207639_10062129
768 Ga0207639_10115254
769 Ga0207708_10013786
770 Ga0207708_10120575
771 Ga0207641_10028325
772 Ga0207641_10065266
773 Ga0207648_10009384
774 Ga0207648_10016216
775 Ga0207648_10081959
776 Ga0207676_10114999
777 Ga0207674_10001353
778 Ga0207674_10001558
779 Ga0207674_10019328
780 Ga0207674_10063622
781 Ga0207675_100000096
782 Ga0207675_100005343
783 Ga0207675_100104659
784 Ga0207675_100235285
785 Ga0207683_10074361
786 Ga0207683_10098711
787 Ga0207698_10308080
788 Ga0209966_1006239
789 Ga0209998_10006067
790 Ga0268265_10000624
791 Ga0268264_10024396
792 Ga0307408_100006194
793 Ga0307408_100077904
794 Ga0265314_10025993
795 Ga0307405_10000086
796 Ga0307405_10017092
797 Ga0307405_10044236
798 Ga0307405_10056529
799 Ga0307405_10066945
800 Ga0307405_10088936
801 Ga0307405_10105283
802 Ga0307413_10000077
803 Ga0307413_10000315
804 Ga0307413_10012747
805 Ga0307413_10014820
806 Ga0307410_10000579
807 Ga0307410_10002114
808 Ga0307410_10015189
809 Ga0307410_10031076
810 Ga0307406_10002171
811 Ga0307406_10004315
812 Ga0307406_10037605
813 Ga0307407_10000255
814 Ga0307407_10000709
815 Ga0307407_10001289
816 Ga0307407_10010918
817 Ga0307407_10045612
818 Ga0307412_10000440
819 Ga0307412_10001958
820 Ga0307412_10093115
821 Ga0307409_100000093
822 Ga0307409_100003123
823 Ga0307409_100006408
824 Ga0307409_100127141
825 Ga0307409_100203757
826 Ga0307416_100003664
827 Ga0307416_100059390
828 Ga0307416_100245497
829 Ga0307414_10000763
830 Ga0307414_10001312
831 Ga0307414_10014903
832 Ga0307411_10000272
833 Ga0307411_10000312
834 Ga0307411_10087724
835 Ga0307411_10125557
836 Ga0307415_100003634
837 Ga0307415_100006392
838 Ga0373934_0000613
839 Ga0373955_0000555
840 Ga0373924_0025517
841 Ga0373935_0015507
842 Ga0373935_0077998
843 Ga0373933_0000055
844 Ga0373947_0037687
845 Ga0373937_0000450
846 Ga0373925_0032034
847 Ga0395900_0459811
848 Ga0436365_0781396
849 Ga0451577_0000016
850 Ga0466959_0027268
851 Ga0451576_0090668
852 Ga0495592_0002705
853 Ga0495603_0021580
854 Ga0495629_0011314
855 Ga0495629_0060097
856 Ga0495629_0176604
857 Ga0495651_0000996
858 Ga0495653_0000195
859 Ga0495580_0008769
860 Ga0495582_0029998
861 Ga0495582_0047459
862 Ga0495639_0008494
863 Ga0495608_0000085
864 Ga0495618_0125155
865 Ga0495628_0034222
866 Ga0495630_0022736
867 Ga0495652_0008685
868 Ga0495665_0005306
869 Ga0495665_0027424
870 Ga0495586_0042067
871 Ga0495587_0000114
872 Ga0495587_0099730
873 Ga0495645_0000144
874 Ga0495667_0000241
875 Ga0495635_0000253
876 Ga0495657_0000210
877 Ga0495599_0032551
878 Ga0495623_0000305
879 Ga0495623_0063515
880 Ga0495646_0011487
881 Ga0495658_0001556
882 Ga0495613_0051085
883 Ga0495600_0000023
884 Ga0495604_0000251
885 Ga0495674_0040004
886 Ga0495672_0003697
887 Ga0495680_0006224
888 Ga0495675_0005468
889 Ga0495684_0000037
890 Ga0495593_0006004
891 Ga0495602_0002980
892 Ga0495602_0123206
893 Ga0496104_0279671
894 Ga0496109_0073272
895 Ga0496112_0008419
896 Ga0496113_0118078
897 Ga0496115_0001287
898 Ga0501036_0057097
899 Ga0501047_0017515
900 Ga0501068_0145802
901 Ga0501075_0076498
902 Ga0501076_0179323
903 Ga0501227_010498
904 Ga0501235_001197
905 Ga0501242_001897
906 Ga0501221_000835
907 Ga0501225_0003228
908 Ga0501079_0013695
909 Ga0501081_0190319
910 nmdc:mga05p37_127480_c1
911 nmdc:mga05p37_16141_c1
912 nmdc:mga05p37_58693_c1
913 nmdc:mga09592_94953_c1
914 nmdc:mga0qj67_18998_c1
915 nmdc:mga06r32_171401_c1
916 nmdc:mga06r32_34417_c1
917 nmdc:mga06r32_35158_c1
918 nmdc:mga08y16_60782_c1
919 nmdc:mga08y16_95067_c1
920 nmdc:mga0n895_10743_c1
921 nmdc:mga0n895_287749_c1
922 nmdc:mga0n895_9918_c1
923 nmdc:mga08x19_4984_c1
924 nmdc:mga0a205_114816_c1
925 nmdc:mga0a205_8011_c1
926 Ga0495601_0002235
927 Ga0495612_0000577
928 Ga0495619_0007670

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

36

361

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7k-assembly1.cif.gz_H complex i from e. coli, ddm/lmng-purified, with dq, resting state 0.8179 19 351
7p7e-assembly1.cif.gz_H complex i from e. coli, ddm/lmng-purified, apo, resting state 0.8151 21 348
4he8-assembly2.cif.gz_C crystal structure of the membrane domain of respiratory complex i from thermus thermophilus 0.8118 12 381
7wg5-assembly1.cif.gz_A cyclic electron transport supercomplex ndh-psi from arabidopsis 0.8089 24 345
7zci-assembly1.cif.gz_H complex i from e. coli, lmng-purified, under turnover at ph 6, resting state 0.8035 19 348
ID Description Score Start End Superfamily
af_Q84UT5_3_141_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.382 70 190 1.20.140.150
af_Q5ACZ4_387_544_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3719 130 277 1.20.1250.20
af_Q9Y7S5_183_457_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3351 89 379 1.20.1070.10
af_Q1LXB7_11_219_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.3345 67 275 1.20.120.1770
af_C6TJE7_52_289_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.3341 138 367 1.20.1420.10
ID Description Score Start End GO Terms
AF-A0A2D7I209-F1-model_v4 ABC transporter permease 0.8635 91 224 GO:0016020
AF-A0A6N9Y501-F1-model_v4 deleted 0.8596 63 231
AF-A0A6N9Y501-F1-model_v4 deleted 0.8549 63 231
AF-A0A1Q6W5Z8-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.8535 17 337 GO:0003954
GO:0005886
GO:0009060
AF-A0A2V7RM58-F1-model_v4 NADH-quinone oxidoreductase subunit H (EC 7.1.1.-) (NADH dehydrogenase I subunit H) (NDH-1 subunit H) 0.8534 16 395 GO:0003954
GO:0005886
GO:0009060
GO:0016655
GO:0048038

Map