F449163

General Info

Members Datasets Scaffolds Average Seq Length
463 276 926 325

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0010958|Ga0495629_0010958_1516_2535
Length 332
Sequence MPEQPPYEEEAHHGPEGPPLQDLAMAPTGMGGPMDLGASEAESLEKTPGGPLGTGPKEKPRSLWSDAWRDLRRNPVFIISGLVIAFLVVISIWPGLITTQSPLQCDLSKAQQGSQPGHPFGYDGQGCDVYTRTVYGTRISISVGVLATLGVALLGSFYGGLSDSILSRTTDIFFAIPVVLGGLVLLSVVTSNTIWPVVGFMVLLGWPQISRIARGSVITTKENDYVQAARALGASDSRLMLRHITPNAVAPVIVVSTIALGTYISLEATLSYLGVGLKPPRVSWGIDISAASAYIRQAPHMLLWPAGALAITVLAFIMLGDAVRDALDPKLR

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
6 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
7 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
8 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
9 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
10 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
13 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
14 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
15 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
16 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
17 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
18 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
21 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
22 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
23 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
24 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
25 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
26 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
27 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
28 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
29 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
30 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
31 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
32 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
33 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
34 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
35 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
36 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
37 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
38 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
39 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
40 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
41 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
42 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
43 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
44 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
45 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
46 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
49 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
50 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
55 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
59 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
63 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
64 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
65 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
66 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
67 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
68 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
69 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
70 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
71 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
74 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
77 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
78 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
82 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
86 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
105 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
124 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
166 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
167 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
168 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
169 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
170 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
171 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
172 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
173 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
176 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
177 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
180 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
181 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
182 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
188 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
189 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
190 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
191 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
192 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
193 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
194 2643221548 Streptomyces sp. Root55 Isolate Unclassified
195 2643221578 Streptomyces sp. Root63 Isolate Unclassified
196 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
197 2643221647 Streptomyces sp. Root369 Isolate Unclassified
198 2643221670 Streptomyces sp. Root431 Isolate Unclassified
199 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
200 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
201 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
202 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
203 2643221714 Streptomyces sp. Root264 Isolate Unclassified
204 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
205 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
206 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
207 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
208 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
209 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
210 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
211 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
212 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
213 2808606448 Streptomyces sp. 193411 Isolate Unclassified
214 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
215 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
216 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
217 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
218 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
219 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
220 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
221 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
222 2862574272 Streptomyces sp. AcE210 Isolate Nodule
223 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
224 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
225 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
226 2867428634 Streptomyces sp. RP5T Isolate Unclassified
227 2867475112 Streptomyces sp. TM32 Isolate Unclassified
228 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
229 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
230 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
231 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
232 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
233 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
234 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
235 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
236 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
237 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
238 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
239 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
240 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
241 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
242 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
243 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
244 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
245 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
246 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
247 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
248 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
249 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
250 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
251 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
252 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
253 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
254 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
255 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
256 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
257 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
258 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
259 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
260 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
261 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
262 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
263 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
264 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
265 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
266 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
267 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
268 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
269 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
270 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
271 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
272 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
273 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
274 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
275 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
276 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.7
Metatranscriptomes 0.65
Isolates 19.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.83
Nodule 0.65
Rhizoplane 0.65
Rhizosphere 77.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0010958 3300046459 Bacteria 6590
2 JGI24738J21930_10014547 3300002075 Bacteria 1686
3 Ga0006562J51391_1034030 3300003578 Bacteria 1080
4 Ga0006562J51391_1044731 3300003578 Bacteria 2000
5 Ga0006562J51391_1044732 3300003578 Bacteria 2020
6 Ga0081455_10135317 3300005937 Bacteria 1921
7 Ga0075367_10013010 3300006178 Bacteria 4459
8 Ga0075370_10115890 3300006353 Bacteria 1557
9 Ga0105251_10012345 3300009011 Bacteria 4836
10 Ga0105247_10106233 3300009101 Bacteria 1801
11 Ga0105243_10044744 3300009148 Bacteria 3475
12 Ga0105249_10531736 3300009553 Bacteria 1224
13 Ga0105246_10001164 3300011119 Bacteria 15280
14 Ga0105246_10124962 3300011119 Bacteria 1912
15 Ga0157372_10041569 3300013307 Bacteria 5084
16 Ga0182008_10017104 3300014497 Bacteria 3763
17 Ga0182007_10005376 3300015262 Bacteria 5631
18 Ga0183367_1002 3300015688 Bacteria 1101531
19 Ga0209758_1004520 3300025297 Bacteria 11527
20 Ga0207426_1005045 3300025302 Bacteria 6189
21 Ga0207426_1030531 3300025302 Bacteria 1766
22 Ga0207713_1019919 3300025735 Bacteria 3267
23 Ga0207647_10018822 3300025904 Bacteria 4657
24 Ga0209813_10005948 3300027866 Bacteria 2994
25 Ga0307517_10022035 3300028786 Bacteria 8008
26 Ga0307515_10001617 3300028794 Bacteria 50228
27 Ga0307515_10032640 3300028794 Bacteria 8613
28 Ga0307511_10001450 3300030521 Bacteria 25061
29 Ga0307511_10180002 3300030521 Bacteria 1141
30 Ga0307512_10000716 3300030522 Bacteria 49274
31 Ga0307512_10062848 3300030522 Bacteria 2844
32 Ga0307512_10077989 3300030522 Bacteria 2403
33 Ga0307513_10012157 3300031456 Bacteria 10642
34 Ga0307513_10297154 3300031456 Bacteria 1383
35 Ga0307509_10020147 3300031507 Bacteria 7578
36 Ga0307509_10033943 3300031507 Bacteria 5610
37 Ga0307509_10071599 3300031507 Bacteria 3615
38 Ga0307508_10024881 3300031616 Bacteria 5431
39 Ga0307508_10026438 3300031616 Bacteria 5259
40 Ga0307508_10062593 3300031616 Bacteria 3284
41 Ga0307508_10146680 3300031616 Bacteria 1964
42 Ga0307508_10306882 3300031616 Bacteria 1179
43 Ga0307514_10006104 3300031649 Bacteria 10577
44 Ga0307514_10198175 3300031649 Bacteria 1266
45 Ga0307516_10007876 3300031730 Bacteria 12136
46 Ga0307516_10081542 3300031730 Bacteria 3078
47 Ga0307516_10125266 3300031730 Bacteria 2355
48 Ga0307518_10071709 3300031838 Bacteria 2508
49 Ga0307416_100233616 3300032002 Bacteria 1775
50 Ga0307507_10010033 3300033179 Bacteria 12390
51 Ga0307507_10011635 3300033179 Bacteria 11051
52 Ga0307510_10065482 3300033180 Bacteria 3680
53 Ga0307510_10067986 3300033180 Bacteria 3580
54 Ga0307510_10084275 3300033180 Bacteria 3062
55 Ga0307510_10093186 3300033180 Bacteria 2845
56 Ga0307510_10266079 3300033180 Bacteria 1193
57 Ga0395900_0034206 3300037418 Bacteria 5233
58 Ga0395898_0001773 3300037466 Bacteria 28149
59 Ga0439439_0016197 3300041406 Bacteria 1824
60 Ga0451853_0725015 3300041512 Bacteria 2903
61 Ga0439448_0000121 3300042005 Bacteria 14639
62 Ga0439449_0001073 3300042007 Bacteria 10750
63 Ga0439455_0002937 3300042012 Bacteria 3190
64 Ga0450898_001139 3300042134 Bacteria 3412
65 Ga0450900_002903 3300042136 Bacteria 1860
66 Ga0450903_000089 3300042138 Bacteria 18878
67 Ga0450903_015752 3300042138 Bacteria 1189
68 Ga0466969_0009128 3300044656 Bacteria 5258
69 Ga0466969_0029001 3300044656 Bacteria 2828
70 Ga0466972_0003454 3300044658 Bacteria 7840
71 Ga0466972_0005814 3300044658 Bacteria 6183
72 Ga0466972_0011891 3300044658 Bacteria 4372
73 Ga0466965_0000481 3300044683 Bacteria 14141
74 Ga0466966_0011106 3300044684 Bacteria 5977
75 Ga0466966_0014010 3300044684 Bacteria 5308
76 Ga0466966_0026063 3300044684 Bacteria 3817
77 Ga0466961_0002614 3300044693 Bacteria 11188
78 Ga0466961_0007234 3300044693 Bacteria 7063
79 Ga0466961_0029778 3300044693 Bacteria 3507
80 Ga0466961_0031100 3300044693 Bacteria 3431
81 Ga0466961_0074281 3300044693 Bacteria 2156
82 Ga0466963_0006886 3300044694 Bacteria 6761
83 Ga0466963_0176597 3300044694 Bacteria 1490
84 Ga0466964_0002222 3300044706 Bacteria 6871
85 Ga0466971_0002635 3300044719 Bacteria 7590
86 Ga0466971_0014711 3300044719 Bacteria 3444
87 Ga0466971_0027853 3300044719 Bacteria 2530
88 Ga0466968_0017833 3300044735 Bacteria 2842
89 Ga0466970_0000801 3300044765 Bacteria 15148
90 Ga0466970_0001941 3300044765 Bacteria 10005
91 Ga0466957_0000371 3300044842 Bacteria 22070
92 Ga0466960_0002874 3300044901 Bacteria 6535
93 Ga0466959_0007206 3300045049 Bacteria 7789
94 Ga0466967_0001405 3300045976 Bacteria 13922
95 Ga0466967_0004490 3300045976 Bacteria 9420
96 Ga0466967_0058695 3300045976 Bacteria 3402
97 Ga0466967_0414428 3300045976 Bacteria 1312
98 Ga0495617_068450 3300046452 Bacteria 1168
99 Ga0495627_019746 3300046453 Bacteria 2255
100 Ga0495627_030764 3300046453 Bacteria 1700
101 Ga0495592_0051562 3300046454 Bacteria 3056
102 Ga0495603_0001922 3300046455 Bacteria 12249
103 Ga0495603_0006790 3300046455 Bacteria 6864
104 Ga0495603_0007709 3300046455 Bacteria 6485
105 Ga0495603_0015168 3300046455 Bacteria 4661
106 Ga0495603_0035941 3300046455 Bacteria 2974
107 Ga0495590_0015427 3300046457 Bacteria 2773
108 Ga0495629_0006450 3300046459 Bacteria 8694
109 Ga0495629_0018848 3300046459 Bacteria 4933
110 Ga0495629_0021328 3300046459 Bacteria 4622
111 Ga0495629_0021675 3300046459 Bacteria 4584
112 Ga0495629_0056377 3300046459 Bacteria 2748
113 Ga0495629_0061892 3300046459 Bacteria 2615
114 Ga0495629_0065765 3300046459 Bacteria 2530
115 Ga0495629_0147745 3300046459 Bacteria 1634
116 Ga0495651_0004182 3300046462 Bacteria 11055
117 Ga0495651_0008058 3300046462 Bacteria 8078
118 Ga0495651_0008674 3300046462 Bacteria 7801
119 Ga0495580_0029815 3300046472 Bacteria 3957
120 Ga0495580_0030333 3300046472 Bacteria 3916
121 Ga0495582_0022146 3300046473 Bacteria 3477
122 Ga0495582_0045544 3300046473 Bacteria 2416
123 Ga0495605_0051890 3300046474 Bacteria 1995
124 Ga0495639_0004184 3300046475 Bacteria 6188
125 Ga0495662_0009217 3300046476 Bacteria 4841
126 Ga0495662_0047338 3300046476 Bacteria 2075
127 Ga0495662_0048485 3300046476 Bacteria 2051
128 Ga0495662_0135486 3300046476 Bacteria 1211
129 Ga0495664_0002010 3300046477 Bacteria 10860
130 Ga0495664_0002808 3300046477 Bacteria 9363
131 Ga0495584_0088622 3300046491 Bacteria 1560
132 Ga0495585_0021579 3300046492 Bacteria 3697
133 Ga0495585_0032623 3300046492 Bacteria 2950
134 Ga0495585_0052546 3300046492 Bacteria 2256
135 Ga0495594_0003107 3300046499 Bacteria 8596
136 Ga0495594_0017450 3300046499 Bacteria 3793
137 Ga0495594_0017733 3300046499 Bacteria 3764
138 Ga0495594_0051359 3300046499 Bacteria 2268
139 Ga0495607_0165058 3300046501 Bacteria 1122
140 Ga0495606_0105920 3300046507 Bacteria 1703
141 Ga0495608_0006414 3300046511 Bacteria 8355
142 Ga0495610_0048018 3300046512 Bacteria 2097
143 Ga0495616_0015682 3300046513 Bacteria 4209
144 Ga0495618_0192580 3300046514 Bacteria 1292
145 Ga0495628_0044506 3300046516 Bacteria 3530
146 Ga0495628_0056393 3300046516 Bacteria 3092
147 Ga0495628_0056400 3300046516 Bacteria 3092
148 Ga0495630_0060555 3300046517 Bacteria 2841
149 Ga0495630_0365733 3300046517 Bacteria 1104
150 Ga0495631_0016092 3300046518 Bacteria 3573
151 Ga0495637_0040233 3300046520 Bacteria 2013
152 Ga0495643_0000832 3300046522 Bacteria 33597
153 Ga0495643_0012607 3300046522 Bacteria 5092
154 Ga0495652_0014313 3300046529 Bacteria 7124
155 Ga0495652_0072658 3300046529 Bacteria 2866
156 Ga0495654_0046429 3300046530 Bacteria 2139
157 Ga0495665_0004385 3300046531 Bacteria 7620
158 Ga0495640_0005080 3300046533 Bacteria 10451
159 Ga0495640_0046078 3300046533 Bacteria 3023
160 Ga0495640_0057213 3300046533 Bacteria 2662
161 Ga0495586_0019172 3300046535 Bacteria 3639
162 Ga0495586_0021913 3300046535 Bacteria 3410
163 Ga0495587_0007893 3300046536 Bacteria 6876
164 Ga0495609_0019976 3300046538 Bacteria 3097
165 Ga0495645_0066275 3300046543 Bacteria 2610
166 Ga0495622_0034231 3300046557 Bacteria 2370
167 Ga0495633_0029176 3300046558 Bacteria 2684
168 Ga0495667_0040675 3300046559 Bacteria 3085
169 Ga0495668_0027533 3300046616 Bacteria 3220
170 Ga0495634_0017609 3300046642 Bacteria 5095
171 Ga0495634_0035021 3300046642 Bacteria 3441
172 Ga0495611_0012640 3300046648 Bacteria 3589
173 Ga0495625_0024799 3300046660 Bacteria 4556
174 Ga0495625_0155911 3300046660 Bacteria 1532
175 Ga0495635_0007026 3300046663 Bacteria 7865
176 Ga0495635_0041201 3300046663 Bacteria 3190
177 Ga0495635_0091265 3300046663 Bacteria 2083
178 Ga0495661_0037644 3300046665 Bacteria 3018
179 Ga0495661_0044324 3300046665 Bacteria 2728
180 Ga0495588_0023597 3300046674 Bacteria 3047
181 Ga0495588_0039153 3300046674 Bacteria 2414
182 Ga0495657_0000556 3300046675 Bacteria 34468
183 Ga0495657_0004947 3300046675 Bacteria 10593
184 Ga0495657_0010090 3300046675 Bacteria 7119
185 Ga0495657_0034651 3300046675 Bacteria 3504
186 Ga0495657_0061899 3300046675 Bacteria 2475
187 Ga0495599_0098092 3300046678 Bacteria 1827
188 Ga0495623_0003508 3300046679 Bacteria 10379
189 Ga0495646_0000353 3300046680 Bacteria 23686
190 Ga0495646_0085847 3300046680 Bacteria 1826
191 Ga0495658_0011511 3300046683 Bacteria 4452
192 Ga0495613_0002443 3300046689 Bacteria 14026
193 Ga0495613_0009543 3300046689 Bacteria 7205
194 Ga0495613_0025172 3300046689 Bacteria 4435
195 Ga0495613_0026011 3300046689 Bacteria 4360
196 Ga0495613_0030558 3300046689 Bacteria 4001
197 Ga0495613_0032637 3300046689 Bacteria 3868
198 Ga0495613_0034968 3300046689 Bacteria 3730
199 Ga0495624_0053169 3300046690 Bacteria 2557
200 Ga0495624_0062476 3300046690 Bacteria 2330
201 Ga0495624_0078476 3300046690 Bacteria 2047
202 Ga0495670_0005106 3300046691 Bacteria 6455
203 Ga0495649_0015818 3300046694 Bacteria 4288
204 Ga0495649_0032897 3300046694 Bacteria 2855
205 Ga0495649_0175433 3300046694 Bacteria 1120
206 Ga0495589_0002815 3300046794 Bacteria 9621
207 Ga0495589_0009779 3300046794 Bacteria 4980
208 Ga0495600_0003216 3300046809 Bacteria 9555
209 Ga0495600_0036056 3300046809 Bacteria 3213
210 Ga0495600_0069327 3300046809 Bacteria 2304
211 Ga0495660_0015554 3300046810 Bacteria 4394
212 Ga0495581_0000544 3300047315 Bacteria 19425
213 Ga0495581_0040628 3300047315 Bacteria 2691
214 Ga0495581_0084433 3300047315 Bacteria 1840
215 Ga0495581_0084958 3300047315 Bacteria 1834
216 Ga0495581_0118668 3300047315 Bacteria 1539
217 Ga0495604_0002969 3300047317 Bacteria 13582
218 Ga0495604_0005382 3300047317 Bacteria 10154
219 Ga0495604_0030501 3300047317 Bacteria 4282
220 Ga0495604_0053940 3300047317 Bacteria 3104
221 Ga0495636_0004237 3300047318 Bacteria 5629
222 Ga0495636_0010422 3300047318 Bacteria 3670
223 Ga0495636_0059407 3300047318 Bacteria 1613
224 Ga0495636_0079501 3300047318 Bacteria 1410
225 Ga0495674_0076249 3300047319 Bacteria 2884
226 Ga0495674_0332377 3300047319 Bacteria 1236
227 Ga0495676_0015461 3300047321 Bacteria 6793
228 Ga0495676_0015599 3300047321 Bacteria 6757
229 Ga0495676_0016311 3300047321 Bacteria 6597
230 Ga0495676_0043604 3300047321 Bacteria 3667
231 Ga0495676_0106813 3300047321 Bacteria 2062
232 Ga0495676_0112435 3300047321 Bacteria 1995
233 Ga0495680_0019583 3300047322 Bacteria 5709
234 Ga0495680_0176956 3300047322 Bacteria 1542
235 Ga0495683_0091885 3300047323 Bacteria 1469
236 Ga0495687_002615 3300047443 Bacteria 14142
237 Ga0495687_003973 3300047443 Bacteria 10320
238 Ga0495687_018453 3300047443 Bacteria 3448
239 Ga0495687_045786 3300047443 Bacteria 1892
240 Ga0495675_0033763 3300047444 Bacteria 3265
241 Ga0495675_0045625 3300047444 Bacteria 2791
242 Ga0495675_0074036 3300047444 Bacteria 2147
243 Ga0495675_0102643 3300047444 Bacteria 1789
244 Ga0495675_0134051 3300047444 Bacteria 1538
245 Ga0495685_001273 3300047447 Bacteria 7705
246 Ga0495685_002859 3300047447 Bacteria 5451
247 Ga0495685_036653 3300047447 Bacteria 1683
248 Ga0495681_0003178 3300047470 Bacteria 11476
249 Ga0495681_0019863 3300047470 Bacteria 3656
250 Ga0495684_0137794 3300047471 Bacteria 1831
251 Ga0495686_0035630 3300047472 Bacteria 3197
252 Ga0495686_0069346 3300047472 Bacteria 2173
253 Ga0495686_0091531 3300047472 Bacteria 1846
254 Ga0495593_0000649 3300047673 Bacteria 20018
255 Ga0495593_0017629 3300047673 Bacteria 4019
256 Ga0495593_0033100 3300047673 Bacteria 2816
257 Ga0495602_0110744 3300048088 Bacteria 2231
258 Ga0495602_0230822 3300048088 Bacteria 1390
259 Ga0495614_0024093 3300048089 Bacteria 2627
260 Ga0496106_0100205 3300048909 Bacteria 2246
261 Ga0496108_0133985 3300048911 Bacteria 2130
262 Ga0495682_0031590 3300049460 Bacteria 1957
263 Ga0501031_0000516 3300049568 Bacteria 22645
264 Ga0501031_0012477 3300049568 Bacteria 5544
265 Ga0501031_0025673 3300049568 Bacteria 3843
266 Ga0501031_0128941 3300049568 Bacteria 1652
267 Ga0501031_0150547 3300049568 Bacteria 1520
268 Ga0501032_0000846 3300049569 Bacteria 24834
269 Ga0501032_0004845 3300049569 Bacteria 10085
270 Ga0501032_0038509 3300049569 Bacteria 3256
271 Ga0501032_0067406 3300049569 Bacteria 2390
272 Ga0501032_0153681 3300049569 Bacteria 1512
273 Ga0501033_0001224 3300049570 Bacteria 23048
274 Ga0501033_0002951 3300049570 Bacteria 14217
275 Ga0501033_0029691 3300049570 Bacteria 4108
276 Ga0501033_0150330 3300049570 Bacteria 1680
277 Ga0501033_0218811 3300049570 Bacteria 1356
278 Ga0501034_0009955 3300049571 Bacteria 9935
279 Ga0501034_0020424 3300049571 Bacteria 6762
280 Ga0501034_0032860 3300049571 Bacteria 5268
281 Ga0501034_0053171 3300049571 Bacteria 4079
282 Ga0501034_0180741 3300049571 Bacteria 2074
283 Ga0501036_0008233 3300049572 Bacteria 8548
284 Ga0501036_0018009 3300049572 Bacteria 5913
285 Ga0501036_0052973 3300049572 Bacteria 3436
286 Ga0501036_0087431 3300049572 Bacteria 2634
287 Ga0501036_0214461 3300049572 Bacteria 1617
288 Ga0501037_0000573 3300049573 Bacteria 29070
289 Ga0501037_0007230 3300049573 Bacteria 8114
290 Ga0501037_0123649 3300049573 Bacteria 1859
291 Ga0501037_0159345 3300049573 Bacteria 1609
292 Ga0501038_0002237 3300049574 Bacteria 17987
293 Ga0501038_0002719 3300049574 Bacteria 16494
294 Ga0501038_0058720 3300049574 Bacteria 3297
295 Ga0501038_0136682 3300049574 Bacteria 2007
296 Ga0501039_0022668 3300049575 Bacteria 4818
297 Ga0501041_0005817 3300049577 Bacteria 7211
298 Ga0501042_0002021 3300049578 Bacteria 12277
299 Ga0501043_0000883 3300049579 Bacteria 26596
300 Ga0501043_0001874 3300049579 Bacteria 18024
301 Ga0501043_0003311 3300049579 Bacteria 13275
302 Ga0501043_0048978 3300049579 Bacteria 3321
303 Ga0501043_0188739 3300049579 Bacteria 1603
304 Ga0501043_0210887 3300049579 Bacteria 1505
305 Ga0501046_0001264 3300049580 Bacteria 24502
306 Ga0501046_0016329 3300049580 Bacteria 6220
307 Ga0501047_0000336 3300049581 Bacteria 53637
308 Ga0501047_0040420 3300049581 Bacteria 4510
309 Ga0501047_0050103 3300049581 Bacteria 4032
310 Ga0501047_0180471 3300049581 Bacteria 1977
311 Ga0501047_0276899 3300049581 Bacteria 1523
312 Ga0501048_0025001 3300049582 Bacteria 4356
313 Ga0501048_0057784 3300049582 Bacteria 2750
314 Ga0501048_0168883 3300049582 Bacteria 1549
315 Ga0501067_0002265 3300049583 Bacteria 10616
316 Ga0501068_0000440 3300049584 Bacteria 21126
317 Ga0501070_0005217 3300049586 Bacteria 11075
318 Ga0501071_0000907 3300049587 Bacteria 16016
319 Ga0501072_0001019 3300049588 Bacteria 20746
320 Ga0501073_0003084 3300049589 Bacteria 12486
321 Ga0501074_0005497 3300049590 Bacteria 9115
322 Ga0501074_0008138 3300049590 Bacteria 7598
323 Ga0501074_0194507 3300049590 Bacteria 1446
324 Ga0501076_0130095 3300049592 Bacteria 2041
325 Ga0501077_0054020 3300049593 Bacteria 2551
326 Ga0501079_0003741 3300049741 Bacteria 11224
327 Ga0501080_0027879 3300049742 Bacteria 5251
328 Ga0501080_0237548 3300049742 Bacteria 1664
329 Ga0501083_0018767 3300049744 Bacteria 4816
330 Ga0501035_0000762 3300049822 Bacteria 34623
331 Ga0501035_0012578 3300049822 Bacteria 7820
332 Ga0501035_0073920 3300049822 Bacteria 3016
333 Ga0501035_0079481 3300049822 Bacteria 2897
334 Ga0501035_0102571 3300049822 Bacteria 2509
335 Ga0501035_0283566 3300049822 Bacteria 1399
336 Ga0501044_0001145 3300049823 Bacteria 31413
337 Ga0501044_0002102 3300049823 Bacteria 22924
338 Ga0501044_0007358 3300049823 Bacteria 12106
339 Ga0501044_0010567 3300049823 Bacteria 10013
340 Ga0501044_0040829 3300049823 Bacteria 4833
341 Ga0501044_0056680 3300049823 Bacteria 4023
342 Ga0501044_0210923 3300049823 Bacteria 1896
343 Ga0501044_0259179 3300049823 Bacteria 1677
344 Ga0501045_0011969 3300049824 Bacteria 6099
345 Ga0501045_0054447 3300049824 Bacteria 2925
346 nmdc:mga0yw44_64457_c1 3300050492 Bacteria 2255
347 nmdc:mga06z11_7341_c1 3300050494 Bacteria 4529
348 nmdc:mga07m45_133977_c1 3300050496 Bacteria 1434
349 Ga0500610_0126601 3300053079 Bacteria 1303
350 Ga0495655_0029239 3300053083 Bacteria 1323
351 Ga0500578_0098779 3300053086 Bacteria 1848
352 Ga0500566_0111298 3300053094 Bacteria 1488
353 Ga0500640_014823 3300053095 Bacteria 3250
354 Ga0500569_006995 3300053109 Bacteria 2508
355 Ga0500614_027056 3300053123 Bacteria 1375
356 Ga0500628_001254 3300053129 Bacteria 4385
357 Ga0500652_004188 3300053131 Bacteria 4442
358 Ga0500658_0002904 3300053134 Bacteria 6576
359 Ga0500573_0053770 3300053140 Bacteria 2313
360 Ga0500573_0059485 3300053140 Bacteria 2190
361 Ga0500579_043661 3300053143 Bacteria 2797
362 Ga0500606_092659 3300053152 Bacteria 1021
363 Ga0500616_0008568 3300053153 Bacteria 6334
364 Ga0500633_0001041 3300053160 Bacteria 4941
365 Ga0500634_0004539 3300053161 Bacteria 6441
366 Ga0500656_000998 3300053732 Bacteria 2307
367 Ga0500587_002108 3300053739 Bacteria 2841
368 Ga0501084_0000962 3300054114 Bacteria 22310
369 Ga0501082_0002675 3300060353 Bacteria 15568
370 Ga0466962_0003578 3300061719 Bacteria 7404
371 Ga0466962_0038958 3300061719 Bacteria 2276
372 Ga0530510_0072538 3300061734 Bacteria 2499
373 2547408633 2547132111 Bacteria 8013147
374 2554256457 2554235005 Bacteria 6457341
375 2585296336 2582581312 Bacteria 7308206
376 2585307062 2582581313 Bacteria 10042643
377 2585320506 2582581314 Bacteria 11452267
378 2616697033 2616644814 Bacteria 11555299
379 2616900174 2616644941 Bacteria 8510691
380 2643763763 2643221548 Bacteria 8053412
381 2643903387 2643221578 Bacteria 9213798
382 2643941583 2643221587 Bacteria 7586415
383 2644263653 2643221647 Bacteria 10741251
384 2644386647 2643221670 Bacteria 6497041
385 2644404103 2643221673 Bacteria 9196637
386 2644428667 2643221677 Bacteria 7584031
387 2644439773 2643221678 Bacteria 9540101
388 2644461802 2643221682 Bacteria 6743283
389 2644632905 2643221714 Bacteria 9015452
390 2768646594 2767802112 Bacteria 6465194
391 2784590167 2784132148 Bacteria 8627943
392 2785341455 2784746763 Bacteria 9783172
393 2785371215 2784746768 Bacteria 10036182
394 2786672401 2786546132 Bacteria 10419719
395 2793976264 2791355406 Bacteria 11364898
396 2804847647 2802429296 Bacteria 7227771
397 2808843780 2808606359 Bacteria 9866990
398 2808913324 2808606375 Bacteria 9466072
399 2809233836 2808606448 Bacteria 8656184
400 2811844700 2808606982 Bacteria 7791042
401 2812479009 2811994917 Bacteria 7761064
402 2819694866 2818991463 Bacteria 7948711
403 2862179239 2862178590 Bacteria 8583590
404 2862285080 2862281513 Bacteria 9621493
405 2862287461 2862281513 Bacteria 9621493
406 2862293089 2862290372 Bacteria 7471434
407 2862389623 2862382967 Bacteria 10317375
408 2862513217 2862507626 Bacteria 9425308
409 2862577783 2862574272 Bacteria 10567477
410 2862710903 2862705112 Bacteria 6563286
411 2863408356 2863404153 Bacteria 9672205
412 2867349408 2867346516 Bacteria 7608576
413 2867436608 2867428634 Bacteria 9590268
414 2867475563 2867475112 Bacteria 6909112
415 2873154305 2873151551 Bacteria 8625867
416 2875396418 2875391855 Bacteria 7600475
417 2912717978 2912715099 Bacteria 9460473
418 2912730404 2912723979 Bacteria 8557534
419 2912762505 2912757875 Bacteria 7940295
420 2918506228 2918501144 Bacteria 8668083
421 2919474287 2919468124 Bacteria 9133025
422 2946048133 2946045630 Bacteria 8527308
423 2946077485 2946072368 Bacteria 8999607
424 2954384273 2954380949 Bacteria 10050426
425 2954678674 2954673503 Bacteria 9685905
426 2954685482 2954682443 Bacteria 9862841
427 2954695094 2954691527 Bacteria 10720516
428 2954710269 2954701450 Bacteria 10834262
429 2954714586 2954711539 Bacteria 10867210
430 2954724531 2954721474 Bacteria 10456478
431 2954737288 2954731030 Bacteria 10243860
432 2954743452 2954740390 Bacteria 10229294
433 2954756138 2954749733 Bacteria 10366972
434 2954762409 2954759201 Bacteria 9358192
435 2966601103 2966598605 Bacteria 7676064
436 2990048456 2990044586 Bacteria 6603797
437 2990065329 2990059506 Bacteria 9321252
438 2995467344 2995463766 Bacteria 8577691
439 2997453324 2997451912 Bacteria 8492419
440 2997603139 2997600082 Bacteria 9896405
441 3006323915 3006321560 Bacteria 8247479
442 3006397686 3006393351 Bacteria 6615579
443 3006430126 3006425503 Bacteria 6491253
444 3006493221 3006486233 Bacteria 8157040
445 3006494846 3006493962 Bacteria 8825450
446 8008491237 8008485437 Bacteria 7198341
447 8008562524 8008558824 Bacteria 10610750
448 8008577419 8008574985 Bacteria 7815457
449 8023628935 8023623736 Bacteria 8593882
450 8025419791 8025413630 Bacteria 7014048
451 8025481571 8025478263 Bacteria 8209203
452 8025530566 8025524527 Bacteria 7197316
453 8025537524 8025530807 Bacteria 8495698
454 8033686135 8033684223 Bacteria 6906479
455 8047896405 8047893842 Bacteria 11723082
456 8048135715 8048127548 Bacteria 11053136
457 8048362531 8048356638 Bacteria 11044339
458 8048373414 8048369669 Bacteria 11666822
459 8048384828 8048379754 Bacteria 11877923
460 8048406710 8048406513 Bacteria 8936924
461 8054166089 8054160619 Bacteria 7783213
462 8056672101 8056667051 Bacteria 6953971
463 8056831883 8056829672 Bacteria 9045328
464 Ga0495629_0010958
465 JGI24738J21930_10014547
466 Ga0006562J51391_1034030
467 Ga0006562J51391_1044731
468 Ga0006562J51391_1044732
469 Ga0081455_10135317
470 Ga0075367_10013010
471 Ga0075370_10115890
472 Ga0105251_10012345
473 Ga0105247_10106233
474 Ga0105243_10044744
475 Ga0105249_10531736
476 Ga0105246_10001164
477 Ga0105246_10124962
478 Ga0157372_10041569
479 Ga0182008_10017104
480 Ga0182007_10005376
481 Ga0183367_1002
482 Ga0209758_1004520
483 Ga0207426_1005045
484 Ga0207426_1030531
485 Ga0207713_1019919
486 Ga0207647_10018822
487 Ga0209813_10005948
488 Ga0307517_10022035
489 Ga0307515_10001617
490 Ga0307515_10032640
491 Ga0307511_10001450
492 Ga0307511_10180002
493 Ga0307512_10000716
494 Ga0307512_10062848
495 Ga0307512_10077989
496 Ga0307513_10012157
497 Ga0307513_10297154
498 Ga0307509_10020147
499 Ga0307509_10033943
500 Ga0307509_10071599
501 Ga0307508_10024881
502 Ga0307508_10026438
503 Ga0307508_10062593
504 Ga0307508_10146680
505 Ga0307508_10306882
506 Ga0307514_10006104
507 Ga0307514_10198175
508 Ga0307516_10007876
509 Ga0307516_10081542
510 Ga0307516_10125266
511 Ga0307518_10071709
512 Ga0307416_100233616
513 Ga0307507_10010033
514 Ga0307507_10011635
515 Ga0307510_10065482
516 Ga0307510_10067986
517 Ga0307510_10084275
518 Ga0307510_10093186
519 Ga0307510_10266079
520 Ga0395900_0034206
521 Ga0395898_0001773
522 Ga0439439_0016197
523 Ga0451853_0725015
524 Ga0439448_0000121
525 Ga0439449_0001073
526 Ga0439455_0002937
527 Ga0450898_001139
528 Ga0450900_002903
529 Ga0450903_000089
530 Ga0450903_015752
531 Ga0466969_0009128
532 Ga0466969_0029001
533 Ga0466972_0003454
534 Ga0466972_0005814
535 Ga0466972_0011891
536 Ga0466965_0000481
537 Ga0466966_0011106
538 Ga0466966_0014010
539 Ga0466966_0026063
540 Ga0466961_0002614
541 Ga0466961_0007234
542 Ga0466961_0029778
543 Ga0466961_0031100
544 Ga0466961_0074281
545 Ga0466963_0006886
546 Ga0466963_0176597
547 Ga0466964_0002222
548 Ga0466971_0002635
549 Ga0466971_0014711
550 Ga0466971_0027853
551 Ga0466968_0017833
552 Ga0466970_0000801
553 Ga0466970_0001941
554 Ga0466957_0000371
555 Ga0466960_0002874
556 Ga0466959_0007206
557 Ga0466967_0001405
558 Ga0466967_0004490
559 Ga0466967_0058695
560 Ga0466967_0414428
561 Ga0495617_068450
562 Ga0495627_019746
563 Ga0495627_030764
564 Ga0495592_0051562
565 Ga0495603_0001922
566 Ga0495603_0006790
567 Ga0495603_0007709
568 Ga0495603_0015168
569 Ga0495603_0035941
570 Ga0495590_0015427
571 Ga0495629_0006450
572 Ga0495629_0018848
573 Ga0495629_0021328
574 Ga0495629_0021675
575 Ga0495629_0056377
576 Ga0495629_0061892
577 Ga0495629_0065765
578 Ga0495629_0147745
579 Ga0495651_0004182
580 Ga0495651_0008058
581 Ga0495651_0008674
582 Ga0495580_0029815
583 Ga0495580_0030333
584 Ga0495582_0022146
585 Ga0495582_0045544
586 Ga0495605_0051890
587 Ga0495639_0004184
588 Ga0495662_0009217
589 Ga0495662_0047338
590 Ga0495662_0048485
591 Ga0495662_0135486
592 Ga0495664_0002010
593 Ga0495664_0002808
594 Ga0495584_0088622
595 Ga0495585_0021579
596 Ga0495585_0032623
597 Ga0495585_0052546
598 Ga0495594_0003107
599 Ga0495594_0017450
600 Ga0495594_0017733
601 Ga0495594_0051359
602 Ga0495607_0165058
603 Ga0495606_0105920
604 Ga0495608_0006414
605 Ga0495610_0048018
606 Ga0495616_0015682
607 Ga0495618_0192580
608 Ga0495628_0044506
609 Ga0495628_0056393
610 Ga0495628_0056400
611 Ga0495630_0060555
612 Ga0495630_0365733
613 Ga0495631_0016092
614 Ga0495637_0040233
615 Ga0495643_0000832
616 Ga0495643_0012607
617 Ga0495652_0014313
618 Ga0495652_0072658
619 Ga0495654_0046429
620 Ga0495665_0004385
621 Ga0495640_0005080
622 Ga0495640_0046078
623 Ga0495640_0057213
624 Ga0495586_0019172
625 Ga0495586_0021913
626 Ga0495587_0007893
627 Ga0495609_0019976
628 Ga0495645_0066275
629 Ga0495622_0034231
630 Ga0495633_0029176
631 Ga0495667_0040675
632 Ga0495668_0027533
633 Ga0495634_0017609
634 Ga0495634_0035021
635 Ga0495611_0012640
636 Ga0495625_0024799
637 Ga0495625_0155911
638 Ga0495635_0007026
639 Ga0495635_0041201
640 Ga0495635_0091265
641 Ga0495661_0037644
642 Ga0495661_0044324
643 Ga0495588_0023597
644 Ga0495588_0039153
645 Ga0495657_0000556
646 Ga0495657_0004947
647 Ga0495657_0010090
648 Ga0495657_0034651
649 Ga0495657_0061899
650 Ga0495599_0098092
651 Ga0495623_0003508
652 Ga0495646_0000353
653 Ga0495646_0085847
654 Ga0495658_0011511
655 Ga0495613_0002443
656 Ga0495613_0009543
657 Ga0495613_0025172
658 Ga0495613_0026011
659 Ga0495613_0030558
660 Ga0495613_0032637
661 Ga0495613_0034968
662 Ga0495624_0053169
663 Ga0495624_0062476
664 Ga0495624_0078476
665 Ga0495670_0005106
666 Ga0495649_0015818
667 Ga0495649_0032897
668 Ga0495649_0175433
669 Ga0495589_0002815
670 Ga0495589_0009779
671 Ga0495600_0003216
672 Ga0495600_0036056
673 Ga0495600_0069327
674 Ga0495660_0015554
675 Ga0495581_0000544
676 Ga0495581_0040628
677 Ga0495581_0084433
678 Ga0495581_0084958
679 Ga0495581_0118668
680 Ga0495604_0002969
681 Ga0495604_0005382
682 Ga0495604_0030501
683 Ga0495604_0053940
684 Ga0495636_0004237
685 Ga0495636_0010422
686 Ga0495636_0059407
687 Ga0495636_0079501
688 Ga0495674_0076249
689 Ga0495674_0332377
690 Ga0495676_0015461
691 Ga0495676_0015599
692 Ga0495676_0016311
693 Ga0495676_0043604
694 Ga0495676_0106813
695 Ga0495676_0112435
696 Ga0495680_0019583
697 Ga0495680_0176956
698 Ga0495683_0091885
699 Ga0495687_002615
700 Ga0495687_003973
701 Ga0495687_018453
702 Ga0495687_045786
703 Ga0495675_0033763
704 Ga0495675_0045625
705 Ga0495675_0074036
706 Ga0495675_0102643
707 Ga0495675_0134051
708 Ga0495685_001273
709 Ga0495685_002859
710 Ga0495685_036653
711 Ga0495681_0003178
712 Ga0495681_0019863
713 Ga0495684_0137794
714 Ga0495686_0035630
715 Ga0495686_0069346
716 Ga0495686_0091531
717 Ga0495593_0000649
718 Ga0495593_0017629
719 Ga0495593_0033100
720 Ga0495602_0110744
721 Ga0495602_0230822
722 Ga0495614_0024093
723 Ga0496106_0100205
724 Ga0496108_0133985
725 Ga0495682_0031590
726 Ga0501031_0000516
727 Ga0501031_0012477
728 Ga0501031_0025673
729 Ga0501031_0128941
730 Ga0501031_0150547
731 Ga0501032_0000846
732 Ga0501032_0004845
733 Ga0501032_0038509
734 Ga0501032_0067406
735 Ga0501032_0153681
736 Ga0501033_0001224
737 Ga0501033_0002951
738 Ga0501033_0029691
739 Ga0501033_0150330
740 Ga0501033_0218811
741 Ga0501034_0009955
742 Ga0501034_0020424
743 Ga0501034_0032860
744 Ga0501034_0053171
745 Ga0501034_0180741
746 Ga0501036_0008233
747 Ga0501036_0018009
748 Ga0501036_0052973
749 Ga0501036_0087431
750 Ga0501036_0214461
751 Ga0501037_0000573
752 Ga0501037_0007230
753 Ga0501037_0123649
754 Ga0501037_0159345
755 Ga0501038_0002237
756 Ga0501038_0002719
757 Ga0501038_0058720
758 Ga0501038_0136682
759 Ga0501039_0022668
760 Ga0501041_0005817
761 Ga0501042_0002021
762 Ga0501043_0000883
763 Ga0501043_0001874
764 Ga0501043_0003311
765 Ga0501043_0048978
766 Ga0501043_0188739
767 Ga0501043_0210887
768 Ga0501046_0001264
769 Ga0501046_0016329
770 Ga0501047_0000336
771 Ga0501047_0040420
772 Ga0501047_0050103
773 Ga0501047_0180471
774 Ga0501047_0276899
775 Ga0501048_0025001
776 Ga0501048_0057784
777 Ga0501048_0168883
778 Ga0501067_0002265
779 Ga0501068_0000440
780 Ga0501070_0005217
781 Ga0501071_0000907
782 Ga0501072_0001019
783 Ga0501073_0003084
784 Ga0501074_0005497
785 Ga0501074_0008138
786 Ga0501074_0194507
787 Ga0501076_0130095
788 Ga0501077_0054020
789 Ga0501079_0003741
790 Ga0501080_0027879
791 Ga0501080_0237548
792 Ga0501083_0018767
793 Ga0501035_0000762
794 Ga0501035_0012578
795 Ga0501035_0073920
796 Ga0501035_0079481
797 Ga0501035_0102571
798 Ga0501035_0283566
799 Ga0501044_0001145
800 Ga0501044_0002102
801 Ga0501044_0007358
802 Ga0501044_0010567
803 Ga0501044_0040829
804 Ga0501044_0056680
805 Ga0501044_0210923
806 Ga0501044_0259179
807 Ga0501045_0011969
808 Ga0501045_0054447
809 nmdc:mga0yw44_64457_c1
810 nmdc:mga06z11_7341_c1
811 nmdc:mga07m45_133977_c1
812 Ga0500610_0126601
813 Ga0495655_0029239
814 Ga0500578_0098779
815 Ga0500566_0111298
816 Ga0500640_014823
817 Ga0500569_006995
818 Ga0500614_027056
819 Ga0500628_001254
820 Ga0500652_004188
821 Ga0500658_0002904
822 Ga0500573_0053770
823 Ga0500573_0059485
824 Ga0500579_043661
825 Ga0500606_092659
826 Ga0500616_0008568
827 Ga0500633_0001041
828 Ga0500634_0004539
829 Ga0500656_000998
830 Ga0500587_002108
831 Ga0501084_0000962
832 Ga0501082_0002675
833 Ga0466962_0003578
834 Ga0466962_0038958
835 Ga0530510_0072538
836 2547408633
837 2554256457
838 2585296336
839 2585307062
840 2585320506
841 2616697033
842 2616900174
843 2643763763
844 2643903387
845 2643941583
846 2644263653
847 2644386647
848 2644404103
849 2644428667
850 2644439773
851 2644461802
852 2644632905
853 2768646594
854 2784590167
855 2785341455
856 2785371215
857 2786672401
858 2793976264
859 2804847647
860 2808843780
861 2808913324
862 2809233836
863 2811844700
864 2812479009
865 2819694866
866 2862179239
867 2862285080
868 2862287461
869 2862293089
870 2862389623
871 2862513217
872 2862577783
873 2862710903
874 2863408356
875 2867349408
876 2867436608
877 2867475563
878 2873154305
879 2875396418
880 2912717978
881 2912730404
882 2912762505
883 2918506228
884 2919474287
885 2946048133
886 2946077485
887 2954384273
888 2954678674
889 2954685482
890 2954695094
891 2954710269
892 2954714586
893 2954724531
894 2954737288
895 2954743452
896 2954756138
897 2954762409
898 2966601103
899 2990048456
900 2990065329
901 2995467344
902 2997453324
903 2997603139
904 3006323915
905 3006397686
906 3006430126
907 3006493221
908 3006494846
909 8008491237
910 8008562524
911 8008577419
912 8023628935
913 8025419791
914 8025481571
915 8025530566
916 8025537524
917 8033686135
918 8047896405
919 8048135715
920 8048362531
921 8048373414
922 8048384828
923 8048406710
924 8054166089
925 8056672101
926 8056831883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

140

332

0.94

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

62

116

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7052 115 321
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.6811 118 321
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.6772 115 321
3pv0-assembly1.cif.gz_F crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide 0.6594 107 265
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.6458 105 269
ID Description Score Start End Superfamily
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.78 114 321 1.10.3720.10
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7734 114 321 1.10.3720.10
af_L0TEV4_50_262_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7694 114 325 1.10.3720.10
af_Q2FVH1_15_213_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.769 116 322 1.10.3720.10
af_Q2FVE9_63_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.767 114 317 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2V6SJT1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8675 54 272 GO:0005886
GO:0055085
AF-A0A2V6SJT1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8602 54 272 GO:0005886
GO:0055085
AF-A0A4Q3ZGJ1-F1-model_v4 ABC transporter permease 0.8566 54 272 GO:0005886
GO:0071916
AF-A0A2J4YX31-F1-model_v4 Nickel ABC transporter permease 0.8558 59 226 GO:0005886
GO:0055085
AF-A0A418GHU2-F1-model_v4 ABC transporter permease 0.8534 54 212 GO:0005886
GO:0071916

Map