F449008

General Info

Members Datasets Scaffolds Average Seq Length
462 221 393 171

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2599185212|2599616334
Length 200
Sequence LLRLAPAVGLALSLAAAGVAWKVQDWRYGNTLAEQARLQAETLNRLTLATAASQQHEADRRLALERQLSASEQTHYRALSDAQRDQDRLRDRLATADVRLSVLLDANDVAAGCAVPAATGAGGLDHGAPRARLDPAHAQRIIAITDAGDRGLIALQACQAYIRALVGNPASLASVDCSCTVGLNRVESGEHHGRHYRTGR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231007 Pseudomonas sp. GM18 Isolate Nodule
3 2511231011 Pseudomonas sp. GM30 Isolate Nodule
4 2511231023 Pseudomonas sp. GM80 Isolate Nodule
5 2511231031 Pseudomonas sp. GM16 Isolate Nodule
6 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
7 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
8 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
9 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
10 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
11 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
12 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
13 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
14 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
15 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
16 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
17 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
18 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
19 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
20 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
21 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
22 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
23 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
24 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
25 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
26 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
27 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
28 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
29 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
30 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
31 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
32 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
33 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
34 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
35 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
36 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
37 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
38 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
39 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
40 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
41 2773857670 Pseudomonas sp. 478 Isolate Unclassified
42 2773857673 Pseudomonas sp. 443 Isolate Unclassified
43 2784132063 Pseudomonas sp. 424 Isolate Unclassified
44 2784132072 Pseudomonas sp. 460 Isolate Unclassified
45 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
46 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
47 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
48 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
49 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
50 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
51 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
52 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
53 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
54 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
55 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
56 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
57 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
58 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
59 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
60 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
61 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
62 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
80 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
109 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
110 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
111 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
123 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
126 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
127 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
128 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
129 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
130 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
131 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
132 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
133 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
134 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
135 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
136 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
137 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
138 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
139 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
147 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
218 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
219 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
220 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
221 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.28
Metatranscriptomes 0
Isolates 14.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 2.81
Rhizoplane 5.41
Rhizosphere 80.09
Stem 0
Stem Tuber 0
Unclassified 8.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_5 2124908027 Bacteria 78295
2 Ga0055530_10000454 3300003791 Bacteria 36466
3 Ga0055530_10000608 3300003791 Bacteria 31086
4 Ga0055540_1000782 3300003792 Bacteria 21518
5 Ga0055540_1000856 3300003792 Bacteria 20321
6 Ga0065704_10073082 3300005289 Bacteria 7604
7 Ga0065715_10560056 3300005293 Bacteria 711
8 Ga0070661_100000856 3300005344 Bacteria 21855
9 Ga0070663_100698271 3300005455 Bacteria 862
10 Ga0070664_100000039 3300005564 Bacteria 79163
11 Ga0075364_10609875 3300006051 Bacteria 746
12 Ga0075432_10123159 3300006058 Bacteria 976
13 Ga0079104_1007393 3300006946 Bacteria 3993
14 Ga0079104_1017477 3300006946 Bacteria 2060
15 Ga0099826_10006316 3300006948 Bacteria 8619
16 Ga0105250_10000421 3300009092 Bacteria 30901
17 Ga0105250_10001864 3300009092 Bacteria 10972
18 Ga0105240_11805981 3300009093 Bacteria 637
19 Ga0105242_10000126 3300009176 Bacteria 55657
20 Ga0105237_10002063 3300009545 Bacteria 25498
21 Ga0105239_10526802 3300010375 Bacteria 1345
22 Ga0157345_1000162 3300012498 Bacteria 11242
23 Ga0157347_1014080 3300012502 Bacteria 879
24 Ga0157373_10001896 3300013100 Bacteria 15871
25 Ga0157373_10003141 3300013100 Bacteria 12481
26 Ga0157373_10004226 3300013100 Bacteria 10837
27 Ga0157373_10008567 3300013100 Bacteria 7595
28 Ga0157371_10011117 3300013102 Bacteria 6967
29 Ga0157371_10643687 3300013102 Bacteria 791
30 Ga0157370_10060438 3300013104 Bacteria 3598
31 Ga0157370_10136645 3300013104 Bacteria 2284
32 Ga0157370_10799758 3300013104 Bacteria 858
33 Ga0157369_10010374 3300013105 Bacteria 10620
34 Ga0157369_10012030 3300013105 Bacteria 9827
35 Ga0157369_10032237 3300013105 Bacteria 5764
36 Ga0163162_10000115 3300013306 Bacteria 70963
37 Ga0163162_10000215 3300013306 Bacteria 53377
38 Ga0163162_10002837 3300013306 Bacteria 16491
39 Ga0157372_10012399 3300013307 Bacteria 9085
40 Ga0157375_10561811 3300013308 Bacteria 1302
41 Ga0182008_10002764 3300014497 Bacteria 10878
42 Ga0182008_10005761 3300014497 Bacteria 7011
43 Ga0182008_10011005 3300014497 Bacteria 4824
44 Ga0182006_1006259 3300015261 Bacteria 5548
45 Ga0182006_1007184 3300015261 Bacteria 5117
46 Ga0182006_1013403 3300015261 Bacteria 3558
47 Ga0182007_10006372 3300015262 Bacteria 5068
48 Ga0182007_10018675 3300015262 Bacteria 2508
49 Ga0182005_1024207 3300015265 Bacteria 1659
50 Ga0163161_10000054 3300017792 Bacteria 117153
51 Ga0163161_11028322 3300017792 Bacteria 705
52 Ga0163161_11292550 3300017792 Bacteria 634
53 Ga0209130_1055818 3300025284 Bacteria 702
54 Ga0209676_1000080 3300025292 Bacteria 287400
55 Ga0209676_1003328 3300025292 Bacteria 10039
56 Ga0209050_1000588 3300025298 Bacteria 58223
57 Ga0209050_1000978 3300025298 Bacteria 36519
58 Ga0209051_1000422 3300025303 Bacteria 58223
59 Ga0209051_1000498 3300025303 Bacteria 50496
60 Ga0209257_1013664 3300025304 Bacteria 3580
61 Ga0207696_1000032 3300025711 Bacteria 380071
62 Ga0207696_1000416 3300025711 Bacteria 39503
63 Ga0207655_1004942 3300025728 Bacteria 9250
64 Ga0207655_1032985 3300025728 Bacteria 2357
65 Ga0207655_1040365 3300025728 Bacteria 2015
66 Ga0207713_1003301 3300025735 Bacteria 11090
67 Ga0207671_10000015 3300025914 Bacteria 439607
68 Ga0207649_10000001 3300025920 Bacteria 537851
69 Ga0207686_10000134 3300025934 Bacteria 58785
70 Ga0207679_10000009 3300025945 Bacteria 357262
71 Ga0207678_11014524 3300026067 Bacteria 734
72 Ga0209281_1000015 3300027111 Bacteria 590084
73 Ga0209281_1000018 3300027111 Bacteria 579091
74 Ga0209281_1002538 3300027111 Bacteria 7172
75 Ga0209281_1004699 3300027111 Bacteria 4007
76 Ga0307511_10159159 3300030521 Bacteria 1273
77 Ga0316177_1018096 3300030731 Bacteria 3218
78 Ga0314311_1217906 3300030733 Bacteria 3812
79 Ga0316179_1023831 3300030734 Bacteria 3125
80 Ga0316178_1009525 3300030735 Bacteria 55280
81 Ga0307408_100001454 3300031548 Bacteria 17613
82 Ga0307408_100044212 3300031548 Bacteria 3172
83 Ga0307408_100208861 3300031548 Bacteria 1585
84 Ga0307408_100210556 3300031548 Bacteria 1579
85 Ga0307408_100310528 3300031548 Bacteria 1324
86 Ga0307408_100425969 3300031548 Bacteria 1145
87 Ga0307408_101070751 3300031548 Bacteria 746
88 Ga0307405_10000211 3300031731 Bacteria 21038
89 Ga0307405_10197066 3300031731 Bacteria 1459
90 Ga0307405_11235576 3300031731 Bacteria 647
91 Ga0307413_10521042 3300031824 Bacteria 958
92 Ga0307406_10271502 3300031901 Bacteria 1288
93 Ga0307407_10007545 3300031903 Bacteria 4932
94 Ga0307412_10011765 3300031911 Bacteria 5076
95 Ga0307412_10047832 3300031911 Bacteria 2810
96 Ga0307412_10121765 3300031911 Bacteria 1879
97 Ga0307412_10272245 3300031911 Bacteria 1325
98 Ga0307412_10936806 3300031911 Bacteria 761
99 Ga0307412_11318013 3300031911 Bacteria 650
100 Ga0307412_11331400 3300031911 Bacteria 647
101 Ga0307416_101104891 3300032002 Bacteria 897
102 Ga0307414_10003310 3300032004 Bacteria 8591
103 Ga0307414_10141110 3300032004 Bacteria 1886
104 Ga0307414_10376387 3300032004 Bacteria 1226
105 Ga0307414_10377647 3300032004 Bacteria 1224
106 Ga0307411_10006047 3300032005 Bacteria 6017
107 Ga0307411_10007982 3300032005 Bacteria 5446
108 Ga0307411_10039977 3300032005 Bacteria 2971
109 Ga0307510_10010198 3300033180 Bacteria 11169
110 Ga0439438_000891 3300041405 Bacteria 13266
111 Ga0439438_002272 3300041405 Bacteria 8237
112 Ga0439438_002376 3300041405 Bacteria 8030
113 Ga0439438_004960 3300041405 Bacteria 4976
114 Ga0439438_028084 3300041405 Bacteria 1515
115 Ga0439447_005558 3300041407 Bacteria 4173
116 Ga0439466_0012253 3300041411 Bacteria 3163
117 Ga0439466_0015241 3300041411 Bacteria 2793
118 Ga0439466_0076494 3300041411 Bacteria 1059
119 Ga0439431_0000533 3300041997 Bacteria 8065
120 Ga0439445_0009674 3300042004 Bacteria 2273
121 Ga0439445_0017632 3300042004 Bacteria 1766
122 Ga0439432_001344 3300042006 Bacteria 9305
123 Ga0439432_002561 3300042006 Bacteria 6852
124 Ga0439432_002729 3300042006 Bacteria 6600
125 Ga0439432_032717 3300042006 Bacteria 1675
126 Ga0439451_015746 3300042009 Bacteria 1525
127 Ga0439451_035526 3300042009 Bacteria 1002
128 Ga0439452_001916 3300042010 Bacteria 7982
129 Ga0439452_001941 3300042010 Bacteria 7917
130 Ga0439452_005916 3300042010 Bacteria 3883
131 Ga0439452_012867 3300042010 Bacteria 2364
132 Ga0439452_022667 3300042010 Bacteria 1622
133 Ga0439456_000410 3300042013 Bacteria 9588
134 Ga0439456_001887 3300042013 Bacteria 4224
135 Ga0439456_021518 3300042013 Bacteria 1364
136 Ga0439463_019522 3300042016 Bacteria 1688
137 Ga0450911_000610 3300042115 Bacteria 10880
138 Ga0450911_006451 3300042115 Bacteria 1749
139 Ga0450896_000105 3300042133 Bacteria 6123
140 Ga0450898_000033 3300042134 Bacteria 10964
141 Ga0450899_000729 3300042135 Bacteria 3743
142 Ga0450900_004589 3300042136 Bacteria 1593
143 Ga0450902_012887 3300042137 Bacteria 1342
144 Ga0450904_001692 3300042139 Bacteria 2941
145 Ga0450906_000565 3300042145 Bacteria 7830
146 Ga0439446_0001038 3300042156 Bacteria 6102
147 Ga0439440_0008728 3300042993 Bacteria 2086
148 Ga0495617_001308 3300046452 Bacteria 11088
149 Ga0495617_002992 3300046452 Bacteria 6456
150 Ga0495617_010334 3300046452 Bacteria 3197
151 Ga0495617_012502 3300046452 Bacteria 2893
152 Ga0495617_095474 3300046452 Bacteria 968
153 Ga0495617_129400 3300046452 Bacteria 810
154 Ga0495627_001875 3300046453 Bacteria 11090
155 Ga0495627_001884 3300046453 Bacteria 11050
156 Ga0495627_001917 3300046453 Bacteria 10860
157 Ga0495627_014614 3300046453 Bacteria 2734
158 Ga0495592_0000277 3300046454 Bacteria 43977
159 Ga0495603_0006254 3300046455 Bacteria 7117
160 Ga0495603_0047025 3300046455 Bacteria 2570
161 Ga0495590_0000788 3300046457 Bacteria 14404
162 Ga0495591_000177 3300046458 Bacteria 65867
163 Ga0495591_000191 3300046458 Bacteria 62737
164 Ga0495591_001046 3300046458 Bacteria 18616
165 Ga0495591_002281 3300046458 Bacteria 10881
166 Ga0495591_002708 3300046458 Bacteria 9606
167 Ga0495591_007663 3300046458 Bacteria 4550
168 Ga0495591_011623 3300046458 Bacteria 3320
169 Ga0495591_012819 3300046458 Bacteria 3099
170 Ga0495629_0273542 3300046459 Bacteria 1160
171 Ga0495638_0008330 3300046460 Bacteria 7356
172 Ga0495638_0022971 3300046460 Bacteria 4086
173 Ga0495638_0160290 3300046460 Bacteria 1298
174 Ga0495653_0000175 3300046463 Bacteria 52815
175 Ga0495653_0001491 3300046463 Bacteria 18284
176 Ga0495653_0004778 3300046463 Bacteria 10979
177 Ga0495650_0009620 3300046471 Bacteria 5480
178 Ga0495650_0010856 3300046471 Bacteria 5048
179 Ga0495650_0082091 3300046471 Bacteria 1240
180 Ga0495605_0002520 3300046474 Bacteria 11302
181 Ga0495605_0027139 3300046474 Bacteria 2970
182 Ga0495605_0100261 3300046474 Bacteria 1332
183 Ga0495584_0132141 3300046491 Bacteria 1266
184 Ga0495585_0000137 3300046492 Bacteria 79585
185 Ga0495585_0000182 3300046492 Bacteria 66842
186 Ga0495585_0004067 3300046492 Bacteria 9605
187 Ga0495585_0004157 3300046492 Bacteria 9465
188 Ga0495585_0005167 3300046492 Bacteria 8288
189 Ga0495585_0007091 3300046492 Bacteria 6885
190 Ga0495585_0065890 3300046492 Bacteria 1984
191 Ga0495594_0102705 3300046499 Bacteria 1608
192 Ga0495596_0003611 3300046500 Bacteria 7774
193 Ga0495596_0040956 3300046500 Bacteria 1827
194 Ga0495607_0004376 3300046501 Bacteria 10407
195 Ga0495607_0005212 3300046501 Bacteria 9350
196 Ga0495607_0089289 3300046501 Bacteria 1673
197 Ga0495583_0004156 3300046506 Bacteria 10581
198 Ga0495583_0103672 3300046506 Bacteria 1211
199 Ga0495583_0104495 3300046506 Bacteria 1206
200 Ga0495606_0000467 3300046507 Bacteria 66389
201 Ga0495606_0006663 3300046507 Bacteria 10592
202 Ga0495606_0007750 3300046507 Bacteria 9507
203 Ga0495606_0020448 3300046507 Bacteria 4877
204 Ga0495606_0141624 3300046507 Bacteria 1419
205 Ga0495606_0159609 3300046507 Bacteria 1316
206 Ga0495606_0355869 3300046507 Bacteria 775
207 Ga0495610_0004636 3300046512 Bacteria 10056
208 Ga0495610_0073455 3300046512 Bacteria 1589
209 Ga0495616_0003024 3300046513 Bacteria 10911
210 Ga0495616_0008468 3300046513 Bacteria 6091
211 Ga0495616_0010493 3300046513 Bacteria 5359
212 Ga0495616_0033510 3300046513 Bacteria 2675
213 Ga0495616_0049723 3300046513 Bacteria 2100
214 Ga0495620_0002269 3300046515 Bacteria 11126
215 Ga0495620_0002316 3300046515 Bacteria 11031
216 Ga0495620_0133930 3300046515 Bacteria 971
217 Ga0495631_0002884 3300046518 Bacteria 9533
218 Ga0495631_0006856 3300046518 Bacteria 5845
219 Ga0495631_0040309 3300046518 Bacteria 2069
220 Ga0495631_0093558 3300046518 Bacteria 1294
221 Ga0495632_0003588 3300046519 Bacteria 10925
222 Ga0495632_0004367 3300046519 Bacteria 9623
223 Ga0495632_0005979 3300046519 Bacteria 7922
224 Ga0495632_0006792 3300046519 Bacteria 7304
225 Ga0495632_0008133 3300046519 Bacteria 6485
226 Ga0495632_0133845 3300046519 Bacteria 1152
227 Ga0495632_0168133 3300046519 Bacteria 1008
228 Ga0495637_0002122 3300046520 Bacteria 11141
229 Ga0495637_0002977 3300046520 Bacteria 9111
230 Ga0495637_0002993 3300046520 Bacteria 9077
231 Ga0495637_0080486 3300046520 Bacteria 1299
232 Ga0495643_0003670 3300046522 Bacteria 11139
233 Ga0495643_0166421 3300046522 Bacteria 1081
234 Ga0495644_0000279 3300046523 Bacteria 23466
235 Ga0495644_0001501 3300046523 Bacteria 9511
236 Ga0495648_0000284 3300046524 Bacteria 57498
237 Ga0495648_0006426 3300046524 Bacteria 9597
238 Ga0495648_0011860 3300046524 Bacteria 6538
239 Ga0495648_0036496 3300046524 Bacteria 3169
240 Ga0495648_0040965 3300046524 Bacteria 2930
241 Ga0495648_0046070 3300046524 Bacteria 2707
242 Ga0495648_0183317 3300046524 Bacteria 1062
243 Ga0495648_0371397 3300046524 Bacteria 647
244 Ga0495666_0044436 3300046526 Bacteria 2145
245 Ga0495642_0001901 3300046528 Bacteria 8894
246 Ga0495654_0000502 3300046530 Bacteria 32013
247 Ga0495654_0001731 3300046530 Bacteria 14635
248 Ga0495654_0003402 3300046530 Bacteria 9778
249 Ga0495654_0018774 3300046530 Bacteria 3620
250 Ga0495654_0023190 3300046530 Bacteria 3216
251 Ga0495654_0045503 3300046530 Bacteria 2164
252 Ga0495654_0062236 3300046530 Bacteria 1789
253 Ga0495654_0077086 3300046530 Bacteria 1569
254 Ga0495609_0000204 3300046538 Bacteria 58862
255 Ga0495609_0002558 3300046538 Bacteria 11102
256 Ga0495609_0002723 3300046538 Bacteria 10664
257 Ga0495609_0003155 3300046538 Bacteria 9602
258 Ga0495609_0005731 3300046538 Bacteria 6463
259 Ga0495609_0005745 3300046538 Bacteria 6452
260 Ga0495609_0112321 3300046538 Bacteria 1175
261 Ga0495597_0002663 3300046542 Bacteria 11043
262 Ga0495597_0140180 3300046542 Bacteria 997
263 Ga0495622_0002184 3300046557 Bacteria 9544
264 Ga0495622_0003752 3300046557 Bacteria 7108
265 Ga0495633_0003227 3300046558 Bacteria 11005
266 Ga0495656_0340608 3300046615 Bacteria 775
267 Ga0495668_0003778 3300046616 Bacteria 11098
268 Ga0495668_0009858 3300046616 Bacteria 5829
269 Ga0495668_0036026 3300046616 Bacteria 2774
270 Ga0495634_0008004 3300046642 Bacteria 7887
271 Ga0495611_0000893 3300046648 Bacteria 16205
272 Ga0495611_0013830 3300046648 Bacteria 3441
273 Ga0495625_0009226 3300046660 Bacteria 8282
274 Ga0495625_0009491 3300046660 Bacteria 8136
275 Ga0495625_0014312 3300046660 Bacteria 6337
276 Ga0495625_0016586 3300046660 Bacteria 5791
277 Ga0495625_0062428 3300046660 Bacteria 2633
278 Ga0495625_0128826 3300046660 Bacteria 1715
279 Ga0495625_0152476 3300046660 Bacteria 1553
280 Ga0495625_0213910 3300046660 Bacteria 1266
281 Ga0495625_0227801 3300046660 Bacteria 1218
282 Ga0495661_0002199 3300046665 Bacteria 15206
283 Ga0495661_0012555 3300046665 Bacteria 5719
284 Ga0495661_0110252 3300046665 Bacteria 1535
285 Ga0495588_0087197 3300046674 Bacteria 1632
286 Ga0495646_0035987 3300046680 Bacteria 3068
287 Ga0495613_0011559 3300046689 Bacteria 6562
288 Ga0495624_0111750 3300046690 Bacteria 1679
289 Ga0495670_0001676 3300046691 Bacteria 10876
290 Ga0495670_0006925 3300046691 Bacteria 5582
291 Ga0495671_0003429 3300046692 Bacteria 9737
292 Ga0495671_0003592 3300046692 Bacteria 9467
293 Ga0495671_0005058 3300046692 Bacteria 7766
294 Ga0495671_0007062 3300046692 Bacteria 6430
295 Ga0495671_0009041 3300046692 Bacteria 5587
296 Ga0495671_0011346 3300046692 Bacteria 4907
297 Ga0495671_0013003 3300046692 Bacteria 4526
298 Ga0495671_0173599 3300046692 Bacteria 1047
299 Ga0495649_0000083 3300046694 Bacteria 81883
300 Ga0495649_0000310 3300046694 Bacteria 42647
301 Ga0495649_0003343 3300046694 Bacteria 10881
302 Ga0495649_0004042 3300046694 Bacteria 9657
303 Ga0495649_0010582 3300046694 Bacteria 5436
304 Ga0495649_0040406 3300046694 Bacteria 2554
305 Ga0495649_0129025 3300046694 Bacteria 1334
306 Ga0495649_0136657 3300046694 Bacteria 1291
307 Ga0495589_0002132 3300046794 Bacteria 11151
308 Ga0495589_0004409 3300046794 Bacteria 7499
309 Ga0495589_0027368 3300046794 Bacteria 2883
310 Ga0495600_0362407 3300046809 Bacteria 907
311 Ga0495660_0002783 3300046810 Bacteria 11025
312 Ga0495660_0003053 3300046810 Bacteria 10451
313 Ga0495660_0005070 3300046810 Bacteria 7912
314 Ga0495660_0005384 3300046810 Bacteria 7663
315 Ga0495660_0007512 3300046810 Bacteria 6398
316 Ga0495660_0030409 3300046810 Bacteria 3042
317 Ga0495660_0054215 3300046810 Bacteria 2172
318 Ga0495660_0120529 3300046810 Bacteria 1327
319 Ga0495660_0246923 3300046810 Bacteria 829
320 Ga0495604_0003349 3300047317 Bacteria 12772
321 Ga0495604_0188111 3300047317 Bacteria 1440
322 Ga0495636_0088705 3300047318 Bacteria 1340
323 Ga0495672_0006009 3300047320 Bacteria 9503
324 Ga0495672_0006045 3300047320 Bacteria 9457
325 Ga0495672_0015401 3300047320 Bacteria 5193
326 Ga0495672_0031436 3300047320 Bacteria 3313
327 Ga0495676_0007643 3300047321 Bacteria 9914
328 Ga0495680_0032878 3300047322 Bacteria 4205
329 Ga0495680_0176861 3300047322 Bacteria 1542
330 Ga0495683_0000887 3300047323 Bacteria 21089
331 Ga0495683_0001794 3300047323 Bacteria 13538
332 Ga0495683_0004591 3300047323 Bacteria 7799
333 Ga0495679_001941 3300047446 Bacteria 11039
334 Ga0495679_001987 3300047446 Bacteria 10859
335 Ga0495679_003088 3300047446 Bacteria 8166
336 Ga0495673_0003216 3300047469 Bacteria 10901
337 Ga0495673_0008339 3300047469 Bacteria 5840
338 Ga0495673_0008861 3300047469 Bacteria 5611
339 Ga0495673_0032229 3300047469 Bacteria 2445
340 Ga0495673_0050229 3300047469 Bacteria 1831
341 Ga0495673_0094188 3300047469 Bacteria 1219
342 Ga0495673_0098428 3300047469 Bacteria 1186
343 Ga0495681_0003428 3300047470 Bacteria 11029
344 Ga0495681_0025002 3300047470 Bacteria 3131
345 Ga0495681_0086032 3300047470 Bacteria 1395
346 Ga0495681_0115425 3300047470 Bacteria 1158
347 Ga0495686_0004824 3300047472 Bacteria 10888
348 Ga0495593_0005766 3300047673 Bacteria 7304
349 Ga0495593_0086501 3300047673 Bacteria 1616
350 Ga0495602_0002634 3300048088 Bacteria 18336
351 Ga0495602_0008227 3300048088 Bacteria 10892
352 Ga0495626_0000825 3300048091 Bacteria 27823
353 Ga0495626_0003098 3300048091 Bacteria 10900
354 Ga0495626_0004470 3300048091 Bacteria 8575
355 Ga0495626_0008274 3300048091 Bacteria 5721
356 Ga0495626_0012938 3300048091 Bacteria 4354
357 Ga0495626_0017972 3300048091 Bacteria 3563
358 Ga0495626_0092488 3300048091 Bacteria 1328
359 Ga0496110_0199368 3300048913 Bacteria 1818
360 Ga0496116_0000207 3300048919 Bacteria 111531
361 Ga0496116_0005990 3300048919 Bacteria 11147
362 Ga0496116_0008534 3300048919 Bacteria 8876
363 Ga0496117_0002707 3300048920 Bacteria 21868
364 Ga0496117_0136239 3300048920 Bacteria 1478
365 Ga0496118_0002747 3300048921 Bacteria 23129
366 Ga0496118_0028012 3300048921 Bacteria 4755
367 Ga0496118_0030317 3300048921 Bacteria 4516
368 Ga0496119_0010295 3300048922 Bacteria 7882
369 Ga0496120_0006983 3300048923 Bacteria 8502
370 Ga0496120_0127653 3300048923 Bacteria 1306
371 Ga0496121_0013242 3300048924 Bacteria 8883
372 Ga0496124_0000825 3300048927 Bacteria 50490
373 Ga0496124_0015839 3300048927 Bacteria 7202
374 Ga0496124_0045821 3300048927 Bacteria 3748
375 Ga0496124_0069003 3300048927 Bacteria 2936
376 Ga0496125_0018324 3300048928 Bacteria 6652
377 Ga0496125_0021617 3300048928 Bacteria 5996
378 Ga0496126_0000761 3300048929 Bacteria 58358
379 Ga0495678_000752 3300049459 Bacteria 29419
380 Ga0495678_001664 3300049459 Bacteria 16908
381 Ga0495678_003480 3300049459 Bacteria 9719
382 Ga0495678_006294 3300049459 Bacteria 6332
383 Ga0495678_010876 3300049459 Bacteria 4389
384 Ga0495678_031114 3300049459 Bacteria 2228
385 Ga0495678_051470 3300049459 Bacteria 1591
386 Ga0495678_052192 3300049459 Bacteria 1575
387 Ga0495678_074105 3300049459 Bacteria 1239
388 Ga0495682_0000143 3300049460 Bacteria 62210
389 Ga0495682_0001728 3300049460 Bacteria 11081
390 Ga0495682_0004119 3300049460 Bacteria 6311
391 Ga0495682_0009124 3300049460 Bacteria 3885
392 Ga0501222_000335 3300049662 Bacteria 7445
393 Ga0500572_000836 3300053111 Bacteria 9660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046692 Ga0495671_0009041 Ga0495671_0009041_3706_4155 140
2 3300046616 Ga0495668_0036026 Ga0495668_0036026_1735_2259 141
3 3300048091 Ga0495626_0000825 Ga0495626_0000825_3012_3518 146
4 3300046515 Ga0495620_0133930 Ga0495620_0133930_76_606 152
5 3300046518 Ga0495631_0006856 Ga0495631_0006856_4680_5210 152
6 3300046460 Ga0495638_0022971 Ga0495638_0022971_1619_2143 154
7 3300046524 Ga0495648_0000284 Ga0495648_0000284_2033_2557 154
8 3300046524 Ga0495648_0371397 Ga0495648_0371397_72_602 154
9 3300047469 Ga0495673_0008339 Ga0495673_0008339_4676_5206 154
10 3300046507 Ga0495606_0000467 Ga0495606_0000467_3217_3723 155
11 3300046519 Ga0495632_0008133 Ga0495632_0008133_183_689 155
12 3300046474 Ga0495605_0027139 Ga0495605_0027139_1894_2376 156
13 3300046692 Ga0495671_0007062 Ga0495671_0007062_111_593 156
14 3300047469 Ga0495673_0094188 Ga0495673_0094188_151_633 156
15 3300048919 Ga0496116_0000207 Ga0496116_0000207_52618_53142 156
16 3300046519 Ga0495632_0006792 Ga0495632_0006792_906_1430 158
17 3300046530 Ga0495654_0000502 Ga0495654_0000502_30319_30843 158
18 3300047323 Ga0495683_0000887 Ga0495683_0000887_1982_2506 158
19 3300049459 Ga0495678_074105 Ga0495678_074105_75_581 158
20 3300046471 Ga0495650_0010856 Ga0495650_0010856_4534_5034 159
21 3300042010 Ga0439452_001941 Ga0439452_001941_651_1169 161
22 3300042013 Ga0439456_000410 Ga0439456_000410_8482_8979 161
23 3300042145 Ga0450906_000565 Ga0450906_000565_6682_7200 161
24 3300012498 Ga0157345_1000162 Ga0157345_10001622 162
25 3300012502 Ga0157347_1014080 Ga0157347_10140802 162
26 3300013100 Ga0157373_10004226 Ga0157373_100042262 162
27 3300013105 Ga0157369_10012030 Ga0157369_100120302 162
28 3300013306 Ga0163162_10002837 Ga0163162_1000283720 162
29 3300046452 Ga0495617_010334 Ga0495617_010334_513_1013 162
30 3300046452 Ga0495617_012502 Ga0495617_012502_2359_2859 162
31 3300046452 Ga0495617_095474 Ga0495617_095474_350_850 162
32 3300046453 Ga0495627_001884 Ga0495627_001884_9950_10450 162
33 3300046453 Ga0495627_001917 Ga0495627_001917_9795_10295 162
34 3300046457 Ga0495590_0000788 Ga0495590_0000788_9677_10165 162
35 3300046458 Ga0495591_002708 Ga0495591_002708_547_1047 162
36 3300046458 Ga0495591_007663 Ga0495591_007663_601_1101 162
37 3300046458 Ga0495591_011623 Ga0495591_011623_2250_2750 162
38 3300046471 Ga0495650_0009620 Ga0495650_0009620_4602_5102 162
39 3300046471 Ga0495650_0082091 Ga0495650_0082091_600_1100 162
40 3300046474 Ga0495605_0100261 Ga0495605_0100261_582_1082 162
41 3300046492 Ga0495585_0004067 Ga0495585_0004067_591_1091 162
42 3300046500 Ga0495596_0040956 Ga0495596_0040956_717_1217 162
43 3300046501 Ga0495607_0004376 Ga0495607_0004376_9370_9870 162
44 3300046501 Ga0495607_0005212 Ga0495607_0005212_8329_8829 162
45 3300046501 Ga0495607_0089289 Ga0495607_0089289_170_670 162
46 3300046506 Ga0495583_0004156 Ga0495583_0004156_9841_10341 162
47 3300046507 Ga0495606_0007750 Ga0495606_0007750_591_1091 162
48 3300046507 Ga0495606_0020448 Ga0495606_0020448_352_852 162
49 3300046507 Ga0495606_0141624 Ga0495606_0141624_329_829 162
50 3300046512 Ga0495610_0004636 Ga0495610_0004636_8951_9451 162
51 3300046513 Ga0495616_0003024 Ga0495616_0003024_9816_10316 162
52 3300046515 Ga0495620_0002269 Ga0495620_0002269_9996_10496 162
53 3300046515 Ga0495620_0002316 Ga0495620_0002316_590_1090 162
54 3300046518 Ga0495631_0002884 Ga0495631_0002884_8434_8934 162
55 3300046518 Ga0495631_0093558 Ga0495631_0093558_227_727 162
56 3300046519 Ga0495632_0003588 Ga0495632_0003588_9792_10292 162
57 3300046519 Ga0495632_0005979 Ga0495632_0005979_549_1049 162
58 3300046519 Ga0495632_0133845 Ga0495632_0133845_602_1102 162
59 3300046520 Ga0495637_0002977 Ga0495637_0002977_8051_8551 162
60 3300046520 Ga0495637_0002993 Ga0495637_0002993_8179_8679 162
61 3300046524 Ga0495648_0006426 Ga0495648_0006426_8519_9019 162
62 3300046524 Ga0495648_0040965 Ga0495648_0040965_1853_2353 162
63 3300046524 Ga0495648_0046070 Ga0495648_0046070_1655_2155 162
64 3300046524 Ga0495648_0183317 Ga0495648_0183317_17_517 162
65 3300046530 Ga0495654_0077086 Ga0495654_0077086_638_1138 162
66 3300046538 Ga0495609_0002558 Ga0495609_0002558_9985_10485 162
67 3300046538 Ga0495609_0002723 Ga0495609_0002723_595_1095 162
68 3300046538 Ga0495609_0112321 Ga0495609_0112321_422_922 162
69 3300046542 Ga0495597_0002663 Ga0495597_0002663_9944_10444 162
70 3300046557 Ga0495622_0002184 Ga0495622_0002184_8438_8938 162
71 3300046558 Ga0495633_0003227 Ga0495633_0003227_9971_10471 162
72 3300046648 Ga0495611_0000893 Ga0495611_0000893_15080_15580 162
73 3300046660 Ga0495625_0009226 Ga0495625_0009226_611_1111 162
74 3300046660 Ga0495625_0062428 Ga0495625_0062428_586_1086 162
75 3300046665 Ga0495661_0110252 Ga0495661_0110252_439_939 162
76 3300046692 Ga0495671_0003429 Ga0495671_0003429_603_1103 162
77 3300046692 Ga0495671_0003592 Ga0495671_0003592_8641_9141 162
78 3300046692 Ga0495671_0173599 Ga0495671_0173599_161_661 162
79 3300046694 Ga0495649_0004042 Ga0495649_0004042_8544_9044 162
80 3300046694 Ga0495649_0010582 Ga0495649_0010582_4327_4827 162
81 3300046694 Ga0495649_0129025 Ga0495649_0129025_266_766 162
82 3300046694 Ga0495649_0136657 Ga0495649_0136657_591_1091 162
83 3300046794 Ga0495589_0002132 Ga0495589_0002132_612_1112 162
84 3300046794 Ga0495589_0027368 Ga0495589_0027368_2211_2711 162
85 3300046810 Ga0495660_0002783 Ga0495660_0002783_9930_10430 162
86 3300046810 Ga0495660_0003053 Ga0495660_0003053_9317_9817 162
87 3300046810 Ga0495660_0005384 Ga0495660_0005384_74_574 162
88 3300046810 Ga0495660_0007512 Ga0495660_0007512_603_1103 162
89 3300046810 Ga0495660_0120529 Ga0495660_0120529_613_1113 162
90 3300046810 Ga0495660_0246923 Ga0495660_0246923_115_615 162
91 3300047320 Ga0495672_0006045 Ga0495672_0006045_8419_8919 162
92 3300047446 Ga0495679_001941 Ga0495679_001941_9968_10468 162
93 3300047446 Ga0495679_001987 Ga0495679_001987_9808_10308 162
94 3300047469 Ga0495673_0003216 Ga0495673_0003216_9797_10297 162
95 3300047470 Ga0495681_0003428 Ga0495681_0003428_589_1089 162
96 3300047470 Ga0495681_0025002 Ga0495681_0025002_2015_2515 162
97 3300047470 Ga0495681_0086032 Ga0495681_0086032_428_928 162
98 3300047472 Ga0495686_0004824 Ga0495686_0004824_9790_10290 162
99 3300048091 Ga0495626_0003098 Ga0495626_0003098_9795_10295 162
100 3300048091 Ga0495626_0008274 Ga0495626_0008274_4632_5132 162
101 3300048091 Ga0495626_0012938 Ga0495626_0012938_154_654 162
102 3300048091 Ga0495626_0017972 Ga0495626_0017972_2486_2986 162
103 3300048091 Ga0495626_0092488 Ga0495626_0092488_269_769 162
104 3300048919 Ga0496116_0005990 Ga0496116_0005990_10042_10542 162
105 3300049459 Ga0495678_003480 Ga0495678_003480_8636_9136 162
106 3300049459 Ga0495678_006294 Ga0495678_006294_5271_5771 162
107 3300049459 Ga0495678_010876 Ga0495678_010876_3302_3802 162
108 3300049459 Ga0495678_031114 Ga0495678_031114_1412_1912 162
109 3300049459 Ga0495678_051470 Ga0495678_051470_607_1107 162
110 3300049459 Ga0495678_052192 Ga0495678_052192_485_985 162
111 3300049460 Ga0495682_0001728 Ga0495682_0001728_9972_10472 162
112 3300053111 Ga0500572_000836 Ga0500572_000836_537_1037 162
113 3300013104 Ga0157370_10136645 Ga0157370_101366452 163
114 iso_pu_bacteria 2511231011 2511295668 164
115 iso_pu_bacteria 2511231023 2511366446 164
116 iso_pu_bacteria 2511231023 2511366604 164
117 iso_pu_bacteria 2511231031 2511410933 164
118 iso_pu_bacteria 2713897148 2715752907 164
119 iso_pu_bacteria 2718217725 2718632886 164
120 iso_pu_bacteria 2738543025 2739312956 164
121 iso_pu_bacteria 2773857673 2774136205 164
122 iso_pu_bacteria 2784132063 2784264711 164
123 iso_pu_bacteria 2818991456 2819658552 164
124 iso_pu_bacteria 2842832357 2842835541 164
125 iso_pu_bacteria 2852657418 2852658497 164
126 iso_pu_bacteria 2880230671 2880231876 164
127 iso_pu_bacteria 2904518522 2904520913 164
128 iso_pu_bacteria 2904518522 2904522079 164
129 iso_pu_bacteria 2919487758 2919490789 164
130 iso_pu_bacteria 3007614139 3007616050 164
131 iso_pu_bacteria 3007614139 3007618240 164
132 iso_pu_bacteria 8029995093 8029998615 164
133 iso_pu_bacteria 8029995093 8029999541 164
134 iso_pu_bacteria 8056166840 8056169851 164
135 iso_pu_bacteria 2988728565 2988733058 166
136 3300009093 Ga0105240_11805981 Ga0105240_118059811 167
137 3300017792 Ga0163161_10000054 Ga0163161_1000005440 167
138 3300042115 Ga0450911_006451 Ga0450911_006451_711_1220 167
139 3300046452 Ga0495617_129400 Ga0495617_129400_96_599 167
140 iso_pu_bacteria 2511231156 2511823179 167
141 iso_pu_bacteria 2599185212 2599616334 167
142 iso_pu_bacteria 2599185316 2600024808 167
143 iso_pu_bacteria 2599185317 2600032852 167
144 iso_pu_bacteria 2599185318 2600035370 167
145 iso_pu_bacteria 2599185322 2600058322 167
146 iso_pu_bacteria 2599185325 2600079392 167
147 iso_pu_bacteria 2600254930 2600360097 167
148 iso_pu_bacteria 3007866637 3007871402 167
149 3300006051 Ga0075364_10609875 Ga0075364_106098752 168
150 3300006058 Ga0075432_10123159 Ga0075432_101231592 168
151 3300006946 Ga0079104_1007393 Ga0079104_10073935 168
152 3300009092 Ga0105250_10001864 Ga0105250_1000186415 168
153 3300010375 Ga0105239_10526802 Ga0105239_105268023 168
154 3300013100 Ga0157373_10001896 Ga0157373_1000189620 168
155 3300013100 Ga0157373_10003141 Ga0157373_1000314116 168
156 3300013102 Ga0157371_10011117 Ga0157371_100111172 168
157 3300013105 Ga0157369_10010374 Ga0157369_1001037415 168
158 3300013105 Ga0157369_10032237 Ga0157369_100322371 168
159 3300013306 Ga0163162_10000215 Ga0163162_1000021514 168
160 3300013307 Ga0157372_10012399 Ga0157372_1001239912 168
161 3300014497 Ga0182008_10002764 Ga0182008_100027642 168
162 3300015261 Ga0182006_1007184 Ga0182006_10071842 168
163 3300017792 Ga0163161_11028322 Ga0163161_110283222 168
164 3300017792 Ga0163161_11292550 Ga0163161_112925501 168
165 3300025711 Ga0207696_1000032 Ga0207696_1000032340 168
166 3300025728 Ga0207655_1004942 Ga0207655_100494212 168
167 3300025728 Ga0207655_1032985 Ga0207655_10329853 168
168 3300027111 Ga0209281_1002538 Ga0209281_10025381 168
169 3300027111 Ga0209281_1004699 Ga0209281_10046991 168
170 3300030521 Ga0307511_10159159 Ga0307511_101591592 168
171 3300030734 Ga0316179_1023831 Ga0316179_10238312 168
172 3300030735 Ga0316178_1009525 Ga0316178_100952553 168
173 3300031548 Ga0307408_100208861 Ga0307408_1002088612 168
174 3300031548 Ga0307408_100425969 Ga0307408_1004259692 168
175 3300031731 Ga0307405_11235576 Ga0307405_112355762 168
176 3300031911 Ga0307412_10121765 Ga0307412_101217652 168
177 3300031911 Ga0307412_10936806 Ga0307412_109368062 168
178 3300031911 Ga0307412_11318013 Ga0307412_113180132 168
179 3300031911 Ga0307412_11331400 Ga0307412_113314002 168
180 3300032002 Ga0307416_101104891 Ga0307416_1011048912 168
181 3300032004 Ga0307414_10376387 Ga0307414_103763872 168
182 3300032004 Ga0307414_10377647 Ga0307414_103776472 168
183 3300032005 Ga0307411_10006047 Ga0307411_100060479 168
184 3300032005 Ga0307411_10007982 Ga0307411_100079822 168
185 3300033180 Ga0307510_10010198 Ga0307510_1001019815 168
186 3300041405 Ga0439438_002376 Ga0439438_002376_642_1160 168
187 3300041405 Ga0439438_028084 Ga0439438_028084_547_1068 168
188 3300041407 Ga0439447_005558 Ga0439447_005558_261_779 168
189 3300041411 Ga0439466_0012253 Ga0439466_0012253_359_877 168
190 3300042004 Ga0439445_0017632 Ga0439445_0017632_775_1293 168
191 3300042006 Ga0439432_001344 Ga0439432_001344_8287_8805 168
192 3300042006 Ga0439432_002561 Ga0439432_002561_618_1136 168
193 3300042006 Ga0439432_002729 Ga0439432_002729_5465_5983 168
194 3300042009 Ga0439451_015746 Ga0439451_015746_427_945 168
195 3300042010 Ga0439452_022667 Ga0439452_022667_166_684 168
196 3300042013 Ga0439456_021518 Ga0439456_021518_479_997 168
197 3300042115 Ga0450911_000610 Ga0450911_000610_9732_10250 168
198 3300042136 Ga0450900_004589 Ga0450900_004589_425_943 168
199 3300042137 Ga0450902_012887 Ga0450902_012887_386_904 168
200 3300046452 Ga0495617_001308 Ga0495617_001308_608_1126 168
201 3300046453 Ga0495627_001875 Ga0495627_001875_607_1125 168
202 3300046454 Ga0495592_0000277 Ga0495592_0000277_40129_40635 168
203 3300046458 Ga0495591_000177 Ga0495591_000177_23588_24115 168
204 3300046458 Ga0495591_000191 Ga0495591_000191_4769_5275 168
205 3300046458 Ga0495591_001046 Ga0495591_001046_9670_10176 168
206 3300046458 Ga0495591_002281 Ga0495591_002281_563_1081 168
207 3300046458 Ga0495591_012819 Ga0495591_012819_569_1087 168
208 3300046459 Ga0495629_0273542 Ga0495629_0273542_255_761 168
209 3300046460 Ga0495638_0008330 Ga0495638_0008330_3131_3637 168
210 3300046460 Ga0495638_0160290 Ga0495638_0160290_541_1059 168
211 3300046463 Ga0495653_0000175 Ga0495653_0000175_49955_50461 168
212 3300046463 Ga0495653_0001491 Ga0495653_0001491_3398_3904 168
213 3300046463 Ga0495653_0004778 Ga0495653_0004778_575_1093 168
214 3300046474 Ga0495605_0002520 Ga0495605_0002520_560_1078 168
215 3300046491 Ga0495584_0132141 Ga0495584_0132141_308_847 168
216 3300046492 Ga0495585_0000182 Ga0495585_0000182_4022_4558 168
217 3300046492 Ga0495585_0004157 Ga0495585_0004157_585_1103 168
218 3300046492 Ga0495585_0005167 Ga0495585_0005167_620_1138 168
219 3300046500 Ga0495596_0003611 Ga0495596_0003611_6848_7366 168
220 3300046506 Ga0495583_0104495 Ga0495583_0104495_562_1068 168
221 3300046507 Ga0495606_0006663 Ga0495606_0006663_624_1142 168
222 3300046507 Ga0495606_0159609 Ga0495606_0159609_311_829 168
223 3300046507 Ga0495606_0355869 Ga0495606_0355869_148_666 168
224 3300046512 Ga0495610_0073455 Ga0495610_0073455_637_1155 168
225 3300046513 Ga0495616_0010493 Ga0495616_0010493_4331_4849 168
226 3300046513 Ga0495616_0033510 Ga0495616_0033510_590_1108 168
227 3300046513 Ga0495616_0049723 Ga0495616_0049723_1202_1708 168
228 3300046518 Ga0495631_0040309 Ga0495631_0040309_95_613 168
229 3300046519 Ga0495632_0004367 Ga0495632_0004367_589_1107 168
230 3300046519 Ga0495632_0168133 Ga0495632_0168133_448_966 168
231 3300046520 Ga0495637_0002122 Ga0495637_0002122_609_1127 168
232 3300046520 Ga0495637_0080486 Ga0495637_0080486_361_879 168
233 3300046522 Ga0495643_0003670 Ga0495643_0003670_614_1132 168
234 3300046522 Ga0495643_0166421 Ga0495643_0166421_56_574 168
235 3300046523 Ga0495644_0000279 Ga0495644_0000279_14793_15299 168
236 3300046523 Ga0495644_0001501 Ga0495644_0001501_249_767 168
237 3300046524 Ga0495648_0036496 Ga0495648_0036496_621_1139 168
238 3300046530 Ga0495654_0001731 Ga0495654_0001731_614_1132 168
239 3300046530 Ga0495654_0018774 Ga0495654_0018774_278_784 168
240 3300046530 Ga0495654_0023190 Ga0495654_0023190_392_910 168
241 3300046530 Ga0495654_0062236 Ga0495654_0062236_377_895 168
242 3300046538 Ga0495609_0000204 Ga0495609_0000204_3369_3875 168
243 3300046538 Ga0495609_0003155 Ga0495609_0003155_536_1054 168
244 3300046538 Ga0495609_0005731 Ga0495609_0005731_223_741 168
245 3300046616 Ga0495668_0003778 Ga0495668_0003778_9959_10477 168
246 3300046616 Ga0495668_0009858 Ga0495668_0009858_366_884 168
247 3300046642 Ga0495634_0008004 Ga0495634_0008004_5914_6420 168
248 3300046648 Ga0495611_0013830 Ga0495611_0013830_541_1059 168
249 3300046660 Ga0495625_0009491 Ga0495625_0009491_2286_2840 168
250 3300046660 Ga0495625_0014312 Ga0495625_0014312_2250_2756 168
251 3300046660 Ga0495625_0128826 Ga0495625_0128826_612_1130 168
252 3300046660 Ga0495625_0152476 Ga0495625_0152476_764_1285 168
253 3300046660 Ga0495625_0213910 Ga0495625_0213910_158_676 168
254 3300046660 Ga0495625_0227801 Ga0495625_0227801_541_1047 168
255 3300046665 Ga0495661_0012555 Ga0495661_0012555_604_1122 168
256 3300046680 Ga0495646_0035987 Ga0495646_0035987_402_920 168
257 3300046689 Ga0495613_0011559 Ga0495613_0011559_456_962 168
258 3300046690 Ga0495624_0111750 Ga0495624_0111750_572_1090 168
259 3300046691 Ga0495670_0001676 Ga0495670_0001676_592_1110 168
260 3300046692 Ga0495671_0005058 Ga0495671_0005058_602_1120 168
261 3300046694 Ga0495649_0000083 Ga0495649_0000083_26898_27425 168
262 3300046694 Ga0495649_0000310 Ga0495649_0000310_1331_1837 168
263 3300046694 Ga0495649_0003343 Ga0495649_0003343_586_1104 168
264 3300046694 Ga0495649_0040406 Ga0495649_0040406_1439_1957 168
265 3300046794 Ga0495589_0004409 Ga0495589_0004409_369_887 168
266 3300046809 Ga0495600_0362407 Ga0495600_0362407_291_797 168
267 3300046810 Ga0495660_0030409 Ga0495660_0030409_1305_1811 168
268 3300046810 Ga0495660_0054215 Ga0495660_0054215_561_1079 168
269 3300047317 Ga0495604_0003349 Ga0495604_0003349_3500_4006 168
270 3300047317 Ga0495604_0188111 Ga0495604_0188111_698_1216 168
271 3300047320 Ga0495672_0006009 Ga0495672_0006009_8572_9090 168
272 3300047320 Ga0495672_0031436 Ga0495672_0031436_2213_2731 168
273 3300047321 Ga0495676_0007643 Ga0495676_0007643_596_1114 168
274 3300047322 Ga0495680_0032878 Ga0495680_0032878_1879_2385 168
275 3300047322 Ga0495680_0176861 Ga0495680_0176861_512_1030 168
276 3300047323 Ga0495683_0004591 Ga0495683_0004591_383_901 168
277 3300047446 Ga0495679_003088 Ga0495679_003088_595_1113 168
278 3300047469 Ga0495673_0008861 Ga0495673_0008861_153_671 168
279 3300047673 Ga0495593_0005766 Ga0495593_0005766_1355_1861 168
280 3300047673 Ga0495593_0086501 Ga0495593_0086501_529_1047 168
281 3300048088 Ga0495602_0002634 Ga0495602_0002634_1900_2406 168
282 3300048088 Ga0495602_0008227 Ga0495602_0008227_9867_10385 168
283 3300048091 Ga0495626_0004470 Ga0495626_0004470_7788_8306 168
284 3300048919 Ga0496116_0008534 Ga0496116_0008534_7996_8514 168
285 3300048920 Ga0496117_0002707 Ga0496117_0002707_16505_17044 168
286 3300048920 Ga0496117_0136239 Ga0496117_0136239_383_901 168
287 3300048921 Ga0496118_0002747 Ga0496118_0002747_4877_5416 168
288 3300048921 Ga0496118_0028012 Ga0496118_0028012_602_1120 168
289 3300048921 Ga0496118_0030317 Ga0496118_0030317_289_807 168
290 3300048923 Ga0496120_0127653 Ga0496120_0127653_218_736 168
291 3300048924 Ga0496121_0013242 Ga0496121_0013242_478_996 168
292 3300048927 Ga0496124_0000825 Ga0496124_0000825_1546_2064 168
293 3300049459 Ga0495678_000752 Ga0495678_000752_25890_26396 168
294 3300049460 Ga0495682_0000143 Ga0495682_0000143_9165_9671 168
295 iso_pu_bacteria 2582580891 2583792161 168
296 3300005344 Ga0070661_100000856 Ga0070661_1000008569 169
297 3300005455 Ga0070663_100698271 Ga0070663_1006982712 169
298 3300005564 Ga0070664_100000039 Ga0070664_10000003926 169
299 3300009092 Ga0105250_10000421 Ga0105250_1000042133 169
300 3300009176 Ga0105242_10000126 Ga0105242_100001263 169
301 3300009545 Ga0105237_10002063 Ga0105237_100020639 169
302 3300013102 Ga0157371_10643687 Ga0157371_106436871 169
303 3300013306 Ga0163162_10000115 Ga0163162_1000011547 169
304 3300015261 Ga0182006_1006259 Ga0182006_10062595 169
305 3300025711 Ga0207696_1000416 Ga0207696_100041634 169
306 3300025914 Ga0207671_10000015 Ga0207671_10000015108 169
307 3300025920 Ga0207649_10000001 Ga0207649_10000001379 169
308 3300025934 Ga0207686_10000134 Ga0207686_1000013459 169
309 3300025945 Ga0207679_10000009 Ga0207679_10000009243 169
310 3300026067 Ga0207678_11014524 Ga0207678_110145242 169
311 3300042133 Ga0450896_000105 Ga0450896_000105_5002_5514 169
312 3300042134 Ga0450898_000033 Ga0450898_000033_1829_2341 169
313 3300042135 Ga0450899_000729 Ga0450899_000729_2741_3253 169
314 3300042993 Ga0439440_0008728 Ga0439440_0008728_573_1082 169
315 3300046492 Ga0495585_0000137 Ga0495585_0000137_18927_19436 169
316 3300046665 Ga0495661_0002199 Ga0495661_0002199_2122_2655 169
317 3300047323 Ga0495683_0001794 Ga0495683_0001794_4970_5503 169
318 3300047470 Ga0495681_0115425 Ga0495681_0115425_445_954 169
319 3300048922 Ga0496119_0010295 Ga0496119_0010295_3239_3751 169
320 3300048923 Ga0496120_0006983 Ga0496120_0006983_2243_2755 169
321 3300048927 Ga0496124_0015839 Ga0496124_0015839_2362_2874 169
322 3300048928 Ga0496125_0021617 Ga0496125_0021617_1079_1591 169
323 3300048929 Ga0496126_0000761 Ga0496126_0000761_9382_9894 169
324 3300049459 Ga0495678_001664 Ga0495678_001664_15838_16359 169
325 3300006946 Ga0079104_1017477 Ga0079104_10174774 171
326 3300027111 Ga0209281_1000015 Ga0209281_1000015517 171
327 3300042004 Ga0439445_0009674 Ga0439445_0009674_1214_1729 171
328 3300014497 Ga0182008_10005761 Ga0182008_100057617 172
329 3300015262 Ga0182007_10018675 Ga0182007_100186753 172
330 3300027111 Ga0209281_1000018 Ga0209281_100001884 172
331 3300046453 Ga0495627_014614 Ga0495627_014614_523_1041 172
332 3300046530 Ga0495654_0003402 Ga0495654_0003402_680_1198 172
333 3300047469 Ga0495673_0098428 Ga0495673_0098428_116_634 172
334 iso_pu_bacteria 2808606445 2809215973 172
335 3300046492 Ga0495585_0065890 Ga0495585_0065890_367_891 174
336 iso_pu_bacteria 2511231007 2511273531 174
337 iso_pu_bacteria 2597489887 2597856426 174
338 iso_pu_bacteria 2599185185 2599483321 174
339 iso_pu_bacteria 2599185248 2599770636 174
340 iso_pu_bacteria 2599185257 2599805222 174
341 iso_pu_bacteria 2599185289 2599886518 174
342 iso_pu_bacteria 2599185291 2599896883 174
343 iso_pu_bacteria 2599185300 2599933984 174
344 iso_pu_bacteria 2599185305 2599959582 174
345 iso_pu_bacteria 2599185311 2599996960 174
346 iso_pu_bacteria 2599185313 2600006428 174
347 iso_pu_bacteria 2599185315 2600016777 174
348 iso_pu_bacteria 2599185319 2600041201 174
349 iso_pu_bacteria 2599185321 2600054843 174
350 iso_pu_bacteria 2599185323 2600064001 174
351 iso_pu_bacteria 2599185324 2600073101 174
352 iso_pu_bacteria 2643221633 2644184777 174
353 iso_pu_bacteria 2643221650 2644285552 174
354 iso_pu_bacteria 2651869719 2652546531 174
355 iso_pu_bacteria 2667528170 2671092239 174
356 iso_pu_bacteria 2667528176 2671127536 174
357 iso_pu_bacteria 2671180172 2671768043 174
358 iso_pu_bacteria 2675903515 2678261717 174
359 iso_pu_bacteria 2744054620 2745008066 174
360 iso_pu_bacteria 2773857670 2774121587 174
361 iso_pu_bacteria 2784132072 2784317357 174
362 iso_pu_bacteria 2791355520 2794594523 174
363 iso_pu_bacteria 2825651385 2825653555 174
364 iso_pu_bacteria 2842854478 2842857105 174
365 iso_pu_bacteria 2913036834 2913038070 174
366 iso_pu_bacteria 2919481497 2919482977 174
367 iso_pu_bacteria 2923586266 2923590811 174
368 iso_pu_bacteria 2929144301 2929145510 174
369 iso_pu_bacteria 2931369376 2931371155 174
370 iso_pu_bacteria 8056143049 8056147759 174
371 3300015265 Ga0182005_1024207 Ga0182005_10242072 175
372 3300042139 Ga0450904_001692 Ga0450904_001692_682_1212 176
373 2124908027 MRS2a_Contig_5 MRS2a_00381970 178
374 3300003791 Ga0055530_10000454 Ga0055530_100004542 178
375 3300003791 Ga0055530_10000608 Ga0055530_100006082 178
376 3300003792 Ga0055540_1000782 Ga0055540_10007822 178
377 3300003792 Ga0055540_1000856 Ga0055540_10008562 178
378 3300005289 Ga0065704_10073082 Ga0065704_100730822 178
379 3300005293 Ga0065715_10560056 Ga0065715_105600562 178
380 3300006948 Ga0099826_10006316 Ga0099826_1000631610 178
381 3300013100 Ga0157373_10008567 Ga0157373_100085678 178
382 3300013104 Ga0157370_10060438 Ga0157370_100604383 178
383 3300013104 Ga0157370_10799758 Ga0157370_107997582 178
384 3300013308 Ga0157375_10561811 Ga0157375_105618112 178
385 3300014497 Ga0182008_10011005 Ga0182008_100110056 178
386 3300015261 Ga0182006_1013403 Ga0182006_10134032 178
387 3300015262 Ga0182007_10006372 Ga0182007_100063727 178
388 3300025284 Ga0209130_1055818 Ga0209130_10558182 178
389 3300025292 Ga0209676_1000080 Ga0209676_1000080249 178
390 3300025292 Ga0209676_1003328 Ga0209676_10033282 178
391 3300025298 Ga0209050_1000588 Ga0209050_100058829 178
392 3300025298 Ga0209050_1000978 Ga0209050_10009782 178
393 3300025303 Ga0209051_1000422 Ga0209051_100042229 178
394 3300025303 Ga0209051_1000498 Ga0209051_100049858 178
395 3300025304 Ga0209257_1013664 Ga0209257_10136644 178
396 3300025728 Ga0207655_1040365 Ga0207655_10403652 178
397 3300025735 Ga0207713_1003301 Ga0207713_10033015 178
398 3300027111 Ga0209281_1000015 Ga0209281_1000015543 178
399 3300030731 Ga0316177_1018096 Ga0316177_10180963 178
400 3300030733 Ga0314311_1217906 Ga0314311_12179062 178
401 3300031548 Ga0307408_100001454 Ga0307408_10000145423 178
402 3300031548 Ga0307408_100044212 Ga0307408_1000442122 178
403 3300031548 Ga0307408_100210556 Ga0307408_1002105562 178
404 3300031548 Ga0307408_100310528 Ga0307408_1003105282 178
405 3300031548 Ga0307408_101070751 Ga0307408_1010707511 178
406 3300031731 Ga0307405_10000211 Ga0307405_1000021127 178
407 3300031731 Ga0307405_10197066 Ga0307405_101970662 178
408 3300031824 Ga0307413_10521042 Ga0307413_105210421 178
409 3300031901 Ga0307406_10271502 Ga0307406_102715022 178
410 3300031903 Ga0307407_10007545 Ga0307407_100075452 178
411 3300031911 Ga0307412_10011765 Ga0307412_100117657 178
412 3300031911 Ga0307412_10047832 Ga0307412_100478323 178
413 3300031911 Ga0307412_10272245 Ga0307412_102722452 178
414 3300032004 Ga0307414_10003310 Ga0307414_100033102 178
415 3300032004 Ga0307414_10141110 Ga0307414_101411102 178
416 3300032005 Ga0307411_10039977 Ga0307411_100399774 178
417 3300041405 Ga0439438_000891 Ga0439438_000891_12071_12607 178
418 3300041405 Ga0439438_002272 Ga0439438_002272_603_1139 178
419 3300041405 Ga0439438_004960 Ga0439438_004960_3862_4398 178
420 3300041411 Ga0439466_0015241 Ga0439466_0015241_194_733 178
421 3300041411 Ga0439466_0076494 Ga0439466_0076494_431_967 178
422 3300041997 Ga0439431_0000533 Ga0439431_0000533_7052_7588 178
423 3300042006 Ga0439432_032717 Ga0439432_032717_609_1145 178
424 3300042009 Ga0439451_035526 Ga0439451_035526_105_641 178
425 3300042010 Ga0439452_001916 Ga0439452_001916_486_1022 178
426 3300042010 Ga0439452_005916 Ga0439452_005916_2654_3193 178
427 3300042010 Ga0439452_012867 Ga0439452_012867_296_832 178
428 3300042013 Ga0439456_001887 Ga0439456_001887_3415_3951 178
429 3300042016 Ga0439463_019522 Ga0439463_019522_749_1285 178
430 3300042156 Ga0439446_0001038 Ga0439446_0001038_470_1006 178
431 3300046452 Ga0495617_002992 Ga0495617_002992_5226_5762 178
432 3300046455 Ga0495603_0006254 Ga0495603_0006254_6499_7035 178
433 3300046455 Ga0495603_0047025 Ga0495603_0047025_1414_1950 178
434 3300046492 Ga0495585_0007091 Ga0495585_0007091_1123_1659 178
435 3300046499 Ga0495594_0102705 Ga0495594_0102705_291_827 178
436 3300046506 Ga0495583_0103672 Ga0495583_0103672_290_826 178
437 3300046513 Ga0495616_0008468 Ga0495616_0008468_5218_5754 178
438 3300046524 Ga0495648_0011860 Ga0495648_0011860_5226_5762 178
439 3300046526 Ga0495666_0044436 Ga0495666_0044436_649_1185 178
440 3300046528 Ga0495642_0001901 Ga0495642_0001901_670_1206 178
441 3300046530 Ga0495654_0045503 Ga0495654_0045503_1333_1869 178
442 3300046538 Ga0495609_0005745 Ga0495609_0005745_696_1232 178
443 3300046542 Ga0495597_0140180 Ga0495597_0140180_323_859 178
444 3300046557 Ga0495622_0003752 Ga0495622_0003752_5880_6416 178
445 3300046615 Ga0495656_0340608 Ga0495656_0340608_220_756 178
446 3300046660 Ga0495625_0016586 Ga0495625_0016586_41_577 178
447 3300046674 Ga0495588_0087197 Ga0495588_0087197_671_1207 178
448 3300046691 Ga0495670_0006925 Ga0495670_0006925_625_1161 178
449 3300046692 Ga0495671_0011346 Ga0495671_0011346_3833_4369 178
450 3300046692 Ga0495671_0013003 Ga0495671_0013003_3320_3856 178
451 3300046810 Ga0495660_0005070 Ga0495660_0005070_2153_2689 178
452 3300047318 Ga0495636_0088705 Ga0495636_0088705_61_597 178
453 3300047320 Ga0495672_0015401 Ga0495672_0015401_3961_4497 178
454 3300047469 Ga0495673_0032229 Ga0495673_0032229_566_1102 178
455 3300047469 Ga0495673_0050229 Ga0495673_0050229_234_770 178
456 3300048913 Ga0496110_0199368 Ga0496110_0199368_792_1328 178
457 3300048927 Ga0496124_0045821 Ga0496124_0045821_2564_3100 178
458 3300048927 Ga0496124_0069003 Ga0496124_0069003_1791_2327 178
459 3300048928 Ga0496125_0018324 Ga0496125_0018324_5535_6071 178
460 3300049460 Ga0495682_0004119 Ga0495682_0004119_681_1217 178
461 3300049460 Ga0495682_0009124 Ga0495682_0009124_3035_3571 178
462 3300049662 Ga0501222_000335 Ga0501222_000335_6863_7399 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03245

Phage_lysis

Bacteriophage Rz lysis protein

31

166

0.87

Feature Viewer

pLDDT pTM Quality
80.64 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map