metagRoot

F448917

General Info

Members	Datasets	Scaffolds	Average Seq Length
462	319	361	283

Family's Representative Sequence

Representative Sequence	3300014325\|Ga0163163_10031457\|Ga0163163_100314575
Length	315
Sequence	MPHGDSPPAAESAVAGVVDALSFEHHGREIMKRRNILAAVAALSLLAPAAALAQAKDWSNIKIATEGAYKPWNFTDASGKLIGFEVDLAEDLCKRMKAKCEIVAQAFDGMIPALNTGKYDAIMAGMNITDKRKEAIAFTEPYGRTPSTFAVLKSSPLAKLPDADKVYSLNPDGLAAAEKSINDIKPMLKGKVIGVQTSTAQANFLEKYFKDVVDIRQYKTTEQHDLDLAAGRVDGVFASISYLKGVVEEPKNKDMTLAGPRYGGGPLGFGVAVGLRKGDAELISKFDAAVKAAVADGTVKTLSTKWFGFDITPAH

Samples

	Sample ID	Description	Type	Environment
1	2509276019	Ensifer aridi TW10	Isolate	Nodule
2	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
3	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
4	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
5	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
6	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
7	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
8	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
9	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
10	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
11	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
12	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
13	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
14	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
15	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
16	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
17	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
18	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
19	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
20	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
21	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
22	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
23	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
24	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
25	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
26	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
27	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
28	2643221557	Ensifer sp. Root558	Isolate	Unclassified
29	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
30	2643221610	Ensifer sp. Root74	Isolate	Unclassified
31	2643221618	Ensifer sp. Root231	Isolate	Unclassified
32	2643221626	Ensifer sp. Root31	Isolate	Unclassified
33	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
34	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
35	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
36	2643221659	Ensifer sp. Root127	Isolate	Unclassified
37	2643221668	Ensifer sp. Root423	Isolate	Unclassified
38	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
39	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
40	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
41	2643221698	Ensifer sp. Root142	Isolate	Unclassified
42	2643221712	Ensifer sp. Root258	Isolate	Unclassified
43	2643221723	Ensifer sp. Root278	Isolate	Unclassified
44	2643221726	Ensifer sp. Root954	Isolate	Unclassified
45	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
46	2671180139	Chelativorans sp. A52C2	Isolate	Unclassified
47	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
48	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
49	2751185800	Brucella pituitosa AA2	Isolate	Unclassified
50	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
51	2758568016	[Ochrobactrum] quorumnocens A44	Isolate	Rhizosphere
52	2773857925	Microvirga vignae BR3299	Isolate	Unclassified
53	2775506901	Microvirga ossetica V5/3m	Isolate	Unclassified
54	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
55	2791355260	Rhizobium sp. L9	Isolate	Nodule
56	2791355266	Rhizobium sp. L43	Isolate	Nodule
57	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
58	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
59	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
60	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
61	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
62	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
63	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
64	2818991461	Neorhizobium alkalisoli 1225	Isolate	Unclassified
65	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
66	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
67	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
68	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
69	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
70	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
71	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
72	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
73	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
74	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
75	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
76	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
77	2854911287	Brucella lupini LUP21	Isolate	Unclassified
78	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
79	2894652903	Phyllobacterium sp. SYP-B3895	Isolate	Rhizosphere
80	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
81	2904504865	Serratia marcescens 1822	Isolate	Unclassified
82	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
83	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
84	2915650412	Ochrobactrum sp. CM-21-5	Isolate	Rhizosphere
85	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
86	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
87	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
88	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
89	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
90	2929138655	Agrobacterium sp. R-72433 Hybrid assembly	Isolate	Unclassified
91	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
92	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
93	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
94	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
95	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
96	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
97	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
98	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
99	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
100	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
101	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
102	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
103	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
104	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
105	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
106	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
107	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
108	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
109	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
110	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
111	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
112	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
113	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
114	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
115	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
116	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
117	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
118	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
119	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
120	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
121	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
122	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
123	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
124	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
125	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
126	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
127	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
128	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
129	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
130	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
131	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
132	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
133	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
134	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
135	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
136	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
137	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
138	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
139	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
140	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
141	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
142	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
143	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
144	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
145	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
146	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
147	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
148	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
149	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
150	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
151	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
152	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
153	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
154	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
155	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
156	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
157	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
158	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
159	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
160	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
161	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
162	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
163	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
164	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
165	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
166	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
167	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
168	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
169	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
170	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
171	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
172	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
173	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
174	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
175	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
176	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
177	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
178	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
179	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
180	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
181	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
182	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
183	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
184	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
185	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
186	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
187	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
188	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
189	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
190	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
191	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
192	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
193	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
194	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
195	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
196	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
197	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
198	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
199	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
200	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
201	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
202	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
203	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
237	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
239	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
242	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
243	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
244	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
245	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
246	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
247	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
248	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
249	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
250	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
251	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
252	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
253	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
254	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
255	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
256	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
257	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
258	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
259	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
260	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
261	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
262	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
263	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
264	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
265	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
266	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
267	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
268	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
269	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
270	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
271	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
272	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
273	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
274	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
275	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
276	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
277	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
278	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
279	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
280	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
281	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
282	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
283	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
284	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
285	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
286	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
287	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
288	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
289	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
290	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
291	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
292	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
293	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
294	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
295	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
296	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
297	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
298	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
299	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
300	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
301	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
302	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
303	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
304	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
305	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
306	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
307	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
308	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
309	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
310	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
311	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
312	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
313	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
314	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
315	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
316	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
317	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
318	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
319	8018845410	Burkholderia reimsis BE51	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	78.14
Metatranscriptomes	0
Isolates	21.86

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	24.03
Nodule	7.14
Rhizoplane	3.9
Rhizosphere	43.72
Stem	0
Stem Tuber	0
Unclassified	21.21

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10000059	3300001979	Bacteria	35309
2	JGI25162J39368_1000238	3300002737	Bacteria	54861
3	JGI25162J39368_1002104	3300002737	Bacteria	8484
4	JGI25158J39367_1000212	3300002739	Bacteria	13735
5	JGI25152J39213_1001775	3300002773	Bacteria	8776
6	JGI25152J39213_1002026	3300002773	Bacteria	7990
7	JGI25152J39213_1003277	3300002773	Bacteria	5600
8	JGI25152J39213_1016215	3300002773	Bacteria	1445
9	JGI25159J45721_1000020	3300002987	Bacteria	124791
10	JGI25159J45721_1005113	3300002987	Bacteria	4166
11	JGI25151J46595_10000779	3300003187	Bacteria	25755
12	JGI25151J46595_10001540	3300003187	Bacteria	15391
13	JGI25151J46595_10015331	3300003187	Bacteria	3381
14	JGI25151J46595_10017237	3300003187	Bacteria	3138
15	JGI25165J46597_1000116	3300003214	Bacteria	137942
16	JGI25165J46597_1000635	3300003214	Bacteria	29060
17	JGI25153J46596_10005146	3300003215	Bacteria	6893
18	JGI25153J46596_10012246	3300003215	Bacteria	3719
19	rootH1_10057925	3300003316	Bacteria	1345
20	rootH2_10041489	3300003320	Bacteria	21483
21	rootL2_10009855	3300003322	Bacteria	11720
22	rootL2_10339782	3300003322	Bacteria	1138
23	rootH1_10021627	3300003323	Bacteria	2473
24	rootH1_10158633	3300003323	Bacteria	1699
25	JGI25160J50197_1000055	3300003354	Bacteria	124791
26	JGI25160J50197_1000713	3300003354	Bacteria	18319
27	JGI25160J50197_1014716	3300003354	Bacteria	2603
28	JGI25161J50226_1000233	3300003374	Bacteria	33741
29	JGI25161J50226_1000809	3300003374	Bacteria	11775
30	Ga0055529_1007234	3300003763	Unclassified	1518
31	Ga0055526_1000656	3300003771	Bacteria	26693
32	Ga0055526_1002538	3300003771	Bacteria	12254
33	Ga0055526_1003653	3300003771	Bacteria	9627
34	Ga0055526_1013237	3300003771	Bacteria	3506
35	Ga0055524_1003284	3300003775	Bacteria	7914
36	Ga0055524_1006558	3300003775	Bacteria	5034
37	Ga0055524_1011909	3300003775	Bacteria	3368
38	Ga0055536_1005643	3300003781	Bacteria	6056
39	Ga0055528_1000343	3300003790	Bacteria	38462
40	Ga0055528_1010733	3300003790	Bacteria	3698
41	Ga0055528_1024397	3300003790	Bacteria	1812
42	Ga0055531_10029166	3300003794	Bacteria	1885
43	Ga0055543_1000140	3300004625	Bacteria	60103
44	Ga0055543_1000717	3300004625	Bacteria	16806
45	Ga0055543_1007457	3300004625	Bacteria	2525
46	Ga0065165_1000265	3300005262	Bacteria	90352
47	Ga0065165_1015412	3300005262	Bacteria	2916
48	Ga0070676_10028063	3300005328	Bacteria	3196
49	Ga0070676_10117562	3300005328	Bacteria	1664
50	Ga0070670_100000816	3300005331	Bacteria	24269
51	Ga0070670_100112297	3300005331	Bacteria	2349
52	Ga0070677_10042829	3300005333	Bacteria	1795
53	Ga0068869_100210586	3300005334	Bacteria	1536
54	Ga0068868_100548316	3300005338	Bacteria	1019
55	Ga0070687_100256091	3300005343	Bacteria	1090
56	Ga0070668_100010254	3300005347	Bacteria	6954
57	Ga0070668_100152159	3300005347	Bacteria	1872
58	Ga0070668_100480455	3300005347	Bacteria	1073
59	Ga0070669_100035809	3300005353	Bacteria	3596
60	Ga0070669_100186573	3300005353	Bacteria	1625
61	Ga0070675_100023468	3300005354	Bacteria	4934
62	Ga0070675_100025554	3300005354	Bacteria	4734
63	Ga0070675_100159448	3300005354	Bacteria	1939
64	Ga0070671_100040845	3300005355	Bacteria	3854
65	Ga0070671_100262786	3300005355	Bacteria	1467
66	Ga0070674_100227753	3300005356	Bacteria	1453
67	Ga0070673_100289228	3300005364	Bacteria	1440
68	Ga0070673_100333051	3300005364	Bacteria	1343
69	Ga0070688_100263545	3300005365	Bacteria	1232
70	Ga0070667_100063266	3300005367	Bacteria	3135
71	Ga0070667_100286383	3300005367	Bacteria	1481
72	Ga0070700_100063220	3300005441	Bacteria	2341
73	Ga0070700_100115367	3300005441	Bacteria	1792
74	Ga0070678_100294173	3300005456	Bacteria	1378
75	Ga0070678_100380887	3300005456	Bacteria	1220
76	Ga0070662_100041516	3300005457	Bacteria	3282
77	Ga0068867_100209258	3300005459	Bacteria	1566
78	Ga0068867_100397759	3300005459	Bacteria	1161
79	Ga0070698_100060775	3300005471	Bacteria	3812
80	Ga0068853_100649454	3300005539	Bacteria	1004
81	Ga0070672_100015872	3300005543	Bacteria	5377
82	Ga0070672_100022621	3300005543	Bacteria	4622
83	Ga0070672_100069657	3300005543	Bacteria	2793
84	Ga0070686_100043949	3300005544	Bacteria	2805
85	Ga0070665_100033310	3300005548	Bacteria	5185
86	Ga0070665_100054572	3300005548	Bacteria	4008
87	Ga0070665_100373485	3300005548	Bacteria	1433
88	Ga0068855_100129498	3300005563	Bacteria	2883
89	Ga0068856_100008790	3300005614	Bacteria	9828
90	Ga0068852_100063160	3300005616	Bacteria	3224
91	Ga0068859_100068072	3300005617	Bacteria	3596
92	Ga0068864_100016052	3300005618	Bacteria	6231
93	Ga0068864_100027182	3300005618	Bacteria	4829
94	Ga0068864_100040570	3300005618	Bacteria	3982
95	Ga0068861_100175694	3300005719	Bacteria	1778
96	Ga0068851_10024901	3300005834	Bacteria	2932
97	Ga0068863_100006074	3300005841	Bacteria	11852
98	Ga0068863_100177322	3300005841	Bacteria	2045
99	Ga0068863_100328892	3300005841	Bacteria	1486
100	Ga0068860_100068590	3300005843	Bacteria	3369
101	Ga0068860_100080196	3300005843	Bacteria	3104
102	Ga0068860_100098820	3300005843	Bacteria	2783
103	Ga0081455_10130419	3300005937	Bacteria	1966
104	Ga0075365_10004676	3300006038	Bacteria	7296
105	Ga0075364_10010421	3300006051	Bacteria	5615
106	Ga0075362_10006660	3300006177	Bacteria	4315
107	Ga0075367_10012573	3300006178	Bacteria	4521
108	Ga0075369_10000529	3300006186	Bacteria	12027
109	Ga0075366_10005085	3300006195	Bacteria	7114
110	Ga0097621_100502284	3300006237	Bacteria	1099
111	Ga0075370_10003506	3300006353	Bacteria	7477
112	Ga0068871_100019362	3300006358	Bacteria	5196
113	Ga0075428_100093765	3300006844	Bacteria	3273
114	Ga0068865_100089327	3300006881	Bacteria	2231
115	Ga0068865_100340622	3300006881	Bacteria	1212
116	Ga0097620_100068071	3300006931	Bacteria	3596
117	Ga0079104_1000029	3300006946	Bacteria	207648
118	Ga0105250_10000002	3300009092	Bacteria	566949
119	Ga0105240_10000097	3300009093	Bacteria	179135
120	Ga0105242_10080727	3300009176	Bacteria	2719
121	Ga0105248_10067667	3300009177	Bacteria	4010
122	Ga0105248_10113749	3300009177	Bacteria	3052
123	Ga0105237_10001364	3300009545	Bacteria	32311
124	Ga0105249_10064966	3300009553	Bacteria	3355
125	Ga0105239_10000258	3300010375	Bacteria	78849
126	Ga0157370_10001877	3300013104	Bacteria	25906
127	Ga0157370_10284737	3300013104	Bacteria	1527
128	Ga0157369_10085285	3300013105	Bacteria	3375
129	Ga0171463_1003	3300013249	Bacteria	695693
130	Ga0157374_10150904	3300013296	Bacteria	2259
131	Ga0157378_10068672	3300013297	Bacteria	3178
132	Ga0157378_10217509	3300013297	Bacteria	1815
133	Ga0163162_10029789	3300013306	Bacteria	5403
134	Ga0163162_10122509	3300013306	Bacteria	2705
135	Ga0157375_10274014	3300013308	Bacteria	1850
136	Ga0157375_10670593	3300013308	Bacteria	1192
137	Ga0157375_10740565	3300013308	Bacteria	1135
138	Ga0163163_10031457	3300014325	Bacteria	5121
139	Ga0157380_10565117	3300014326	Bacteria	1119
140	Ga0157379_10505102	3300014968	Bacteria	1121
141	Ga0157376_10106048	3300014969	Bacteria	2465
142	Ga0157376_10429246	3300014969	Bacteria	1284
143	Ga0182007_10001017	3300015262	Bacteria	15332
144	Ga0182005_1006933	3300015265	Bacteria	3426
145	Ga0183363_1215	3300015690	Bacteria	11429
146	Ga0163161_10153049	3300017792	Bacteria	1754
147	Ga0214543_1005681	3300021327	Bacteria	22721
148	Ga0209436_100007	3300025208	Bacteria	149841
149	Ga0209436_105080	3300025208	Bacteria	3104
150	Ga0209672_103030	3300025228	Bacteria	3664
151	Ga0209437_100128	3300025233	Bacteria	190300
152	Ga0209437_100283	3300025233	Bacteria	74859
153	Ga0207425_1002547	3300025245	Bacteria	6344
154	Ga0209677_100172	3300025253	Bacteria	55396
155	Ga0209148_1000437	3300025254	Bacteria	45737
156	Ga0209148_1004042	3300025254	Bacteria	3739
157	Ga0209129_1000082	3300025258	Bacteria	183436
158	Ga0209129_1000333	3300025258	Bacteria	40851
159	Ga0209129_1000499	3300025258	Bacteria	28530
160	Ga0209233_1000072	3300025261	Bacteria	363074
161	Ga0209233_1000218	3300025261	Bacteria	105353
162	Ga0209233_1000268	3300025261	Bacteria	74859
163	Ga0209455_1002090	3300025272	Bacteria	7981
164	Ga0209455_1013818	3300025272	Bacteria	1858
165	Ga0209673_1000005	3300025273	Bacteria	692788
166	Ga0209673_1000433	3300025273	Bacteria	72554
167	Ga0209673_1007112	3300025273	Bacteria	5243
168	Ga0209130_1000001	3300025284	Bacteria	831557
169	Ga0209130_1000026	3300025284	Bacteria	334058
170	Ga0209676_1005071	3300025292	Bacteria	7036
171	Ga0209025_1000081	3300025294	Bacteria	265899
172	Ga0209025_1000162	3300025294	Bacteria	166313
173	Ga0209025_1014161	3300025294	Bacteria	4939
174	Ga0209025_1017757	3300025294	Bacteria	4084
175	Ga0209025_1026853	3300025294	Bacteria	2874
176	Ga0209564_1000208	3300025295	Bacteria	134794
177	Ga0209564_1002059	3300025295	Bacteria	17332
178	Ga0209564_1004552	3300025295	Bacteria	8418
179	Ga0209564_1009698	3300025295	Bacteria	4537
180	Ga0209758_1002405	3300025297	Bacteria	19187
181	Ga0209256_1000042	3300025299	Bacteria	341821
182	Ga0209256_1000475	3300025299	Bacteria	60194
183	Ga0209256_1001960	3300025299	Bacteria	18600
184	Ga0209256_1002938	3300025299	Bacteria	12793
185	Ga0209256_1010472	3300025299	Bacteria	3877
186	Ga0207426_1000006	3300025302	Bacteria	1025969
187	Ga0207426_1000045	3300025302	Bacteria	422847
188	Ga0207426_1000169	3300025302	Bacteria	164859
189	Ga0207426_1000537	3300025302	Bacteria	54262
190	Ga0209051_1003968	3300025303	Bacteria	9412
191	Ga0209051_1046416	3300025303	Bacteria	1494
192	Ga0209257_1020951	3300025304	Bacteria	2393
193	Ga0207697_10021473	3300025315	Bacteria	2642
194	Ga0207696_1000021	3300025711	Bacteria	432606
195	Ga0207682_10061493	3300025893	Bacteria	1572
196	Ga0207642_10093291	3300025899	Bacteria	1493
197	Ga0207645_10165731	3300025907	Bacteria	1447
198	Ga0207645_10290309	3300025907	Bacteria	1087
199	Ga0207705_10466141	3300025909	Bacteria	980
200	Ga0207695_10000187	3300025913	Bacteria	179183
201	Ga0207671_10001438	3300025914	Bacteria	27603
202	Ga0207662_10095720	3300025918	Bacteria	1833
203	Ga0207681_10035186	3300025923	Bacteria	3299
204	Ga0207650_10051888	3300025925	Bacteria	3036
205	Ga0207650_10110944	3300025925	Bacteria	2123
206	Ga0207659_10011311	3300025926	Bacteria	5637
207	Ga0207659_10017111	3300025926	Bacteria	4731
208	Ga0207687_10131662	3300025927	Bacteria	1886
209	Ga0207644_10116463	3300025931	Bacteria	2028
210	Ga0207706_10064869	3300025933	Bacteria	3216
211	Ga0207709_10225924	3300025935	Bacteria	1353
212	Ga0207669_10150370	3300025937	Bacteria	1630
213	Ga0207704_10080194	3300025938	Bacteria	2106
214	Ga0207691_10003580	3300025940	Bacteria	15123
215	Ga0207691_10005828	3300025940	Bacteria	11914
216	Ga0207691_10096549	3300025940	Bacteria	2642
217	Ga0207711_10147708	3300025941	Bacteria	2119
218	Ga0207689_10104759	3300025942	Bacteria	2324
219	Ga0207667_10014667	3300025949	Bacteria	8922
220	Ga0207651_10030120	3300025960	Bacteria	3450
221	Ga0207651_10557604	3300025960	Bacteria	997
222	Ga0207668_10005437	3300025972	Bacteria	7499
223	Ga0207668_10047494	3300025972	Bacteria	2940
224	Ga0207668_10328385	3300025972	Bacteria	1272
225	Ga0207658_10204937	3300025986	Bacteria	1649
226	Ga0207677_10354741	3300026023	Bacteria	1230
227	Ga0207703_10117290	3300026035	Bacteria	2280
228	Ga0207708_10113717	3300026075	Bacteria	2103
229	Ga0207702_10009628	3300026078	Bacteria	8110
230	Ga0207641_10026893	3300026088	Bacteria	4750
231	Ga0207641_10068668	3300026088	Bacteria	3039
232	Ga0207641_10121337	3300026088	Bacteria	2333
233	Ga0207676_10022365	3300026095	Bacteria	4650
234	Ga0207676_10099067	3300026095	Bacteria	2411
235	Ga0207675_100043510	3300026118	Bacteria	4193
236	Ga0207683_10006415	3300026121	Bacteria	10073
237	Ga0207683_10137459	3300026121	Bacteria	2200
238	Ga0207683_10432936	3300026121	Bacteria	1212
239	Ga0209281_1000118	3300027111	Bacteria	208448
240	Ga0209371_1001628	3300027312	Bacteria	14531
241	Ga0209813_10068297	3300027866	Bacteria	1150
242	Ga0268266_10049081	3300028379	Bacteria	3618
243	Ga0268264_10030605	3300028381	Bacteria	4412
244	Ga0268264_10033451	3300028381	Bacteria	4223
245	Ga0268264_10090090	3300028381	Bacteria	2643
246	Ga0307515_10249421	3300028794	Bacteria	1531
247	Ga0268256_1005242	3300030500	Bacteria	5140
248	Ga0265330_10007081	3300031235	Bacteria	5500
249	Ga0307412_10034685	3300031911	Bacteria	3218
250	Ga0307412_10360663	3300031911	Bacteria	1170
251	Ga0307409_100123936	3300031995	Bacteria	2194
252	Ga0307416_100013081	3300032002	Bacteria	5626
253	Ga0307411_10170868	3300032005	Bacteria	1639
254	Ga0373933_0209062	3300035724	Bacteria	1250
255	Ga0436361_0545407	3300039447	Bacteria	2834
256	Ga0436363_1336167	3300039450	Bacteria	1249
257	Ga0436362_0558375	3300039453	Bacteria	1229
258	Ga0439466_0064748	3300041411	Bacteria	1172
259	Ga0439465_0017552	3300041413	Bacteria	2235
260	Ga0439465_0039119	3300041413	Bacteria	1530
261	Ga0439465_0074917	3300041413	Bacteria	1139
262	Ga0466965_0082333	3300044683	Bacteria	1628
263	Ga0466968_0056974	3300044735	Bacteria	1679
264	Ga0466970_0000095	3300044765	Bacteria	37807
265	Ga0466957_0279969	3300044842	Bacteria	1116
266	Ga0466959_0112076	3300045049	Bacteria	1946
267	Ga0451576_0061038	3300045051	Bacteria	3932
268	Ga0466958_0442882	3300045836	Bacteria	841
269	Ga0466967_0023821	3300045976	Bacteria	5023
270	Ga0495654_0000643	3300046530	Bacteria	27533
271	Ga0495625_0033828	3300046660	Bacteria	3776
272	Ga0496100_0000286	3300048903	Bacteria	25474
273	Ga0496101_0278713	3300048904	Bacteria	1306
274	Ga0496102_0072076	3300048905	Bacteria	3173
275	Ga0496103_0018718	3300048906	Bacteria	4155
276	Ga0496104_0029683	3300048907	Bacteria	5074
277	Ga0496105_0000356	3300048908	Bacteria	30226
278	Ga0496106_0001676	3300048909	Bacteria	16601
279	Ga0496106_0265426	3300048909	Bacteria	1374
280	Ga0496107_0171817	3300048910	Bacteria	1609
281	Ga0496108_0264533	3300048911	Bacteria	1497
282	Ga0496108_0468333	3300048911	Bacteria	1101
283	Ga0496109_0445469	3300048912	Bacteria	1223
284	Ga0496109_0574295	3300048912	Bacteria	1063
285	Ga0496110_0043561	3300048913	Bacteria	3919
286	Ga0496112_0091269	3300048915	Bacteria	3015
287	Ga0496112_0530432	3300048915	Bacteria	1112
288	Ga0496116_0065418	3300048919	Bacteria	2332
289	Ga0496117_0000997	3300048920	Bacteria	43330
290	Ga0496117_0034161	3300048920	Bacteria	3836
291	Ga0496117_0088447	3300048920	Bacteria	2004
292	Ga0496117_0137614	3300048920	Bacteria	1468
293	Ga0496118_0005383	3300048921	Bacteria	14578
294	Ga0496119_0003133	3300048922	Bacteria	17420
295	Ga0496119_0005332	3300048922	Bacteria	12371
296	Ga0496119_0014092	3300048922	Bacteria	6291
297	Ga0496119_0100819	3300048922	Bacteria	1621
298	Ga0496120_0008701	3300048923	Bacteria	7311
299	Ga0496120_0022521	3300048923	Bacteria	3961
300	Ga0496121_0000084	3300048924	Bacteria	225942
301	Ga0496121_0000217	3300048924	Bacteria	126231
302	Ga0496121_0000875	3300048924	Bacteria	54487
303	Ga0496121_0012399	3300048924	Bacteria	9305
304	Ga0496121_0048881	3300048924	Bacteria	3593
305	Ga0496121_0055665	3300048924	Bacteria	3293
306	Ga0496122_0000634	3300048925	Bacteria	71553
307	Ga0496122_0001245	3300048925	Bacteria	42799
308	Ga0496122_0020083	3300048925	Bacteria	6064
309	Ga0496122_0021212	3300048925	Bacteria	5827
310	Ga0496122_0049573	3300048925	Bacteria	3213
311	Ga0496122_0100128	3300048925	Bacteria	1940
312	Ga0496123_0003042	3300048926	Bacteria	19315
313	Ga0496123_0005025	3300048926	Bacteria	13533
314	Ga0496123_0006765	3300048926	Bacteria	11019
315	Ga0496123_0010304	3300048926	Bacteria	8292
316	Ga0496123_0042049	3300048926	Bacteria	3160
317	Ga0496123_0045404	3300048926	Bacteria	2994
318	Ga0496123_0072897	3300048926	Bacteria	2133
319	Ga0496123_0102330	3300048926	Bacteria	1663
320	Ga0496124_0006967	3300048927	Bacteria	12138
321	Ga0496124_0025996	3300048927	Bacteria	5287
322	Ga0496124_0039713	3300048927	Bacteria	4076
323	Ga0496124_0077762	3300048927	Bacteria	2736
324	Ga0496124_0100232	3300048927	Bacteria	2348
325	Ga0496124_0121495	3300048927	Bacteria	2086
326	Ga0496124_0218270	3300048927	Bacteria	1436
327	Ga0496125_0000093	3300048928	Bacteria	210896
328	Ga0496125_0000876	3300048928	Bacteria	47916
329	Ga0496125_0006736	3300048928	Bacteria	12347
330	Ga0496125_0023998	3300048928	Bacteria	5618
331	Ga0496126_0017727	3300048929	Bacteria	7090
332	Ga0496126_0054824	3300048929	Bacteria	3608
333	Ga0496126_0062052	3300048929	Bacteria	3355
334	Ga0501032_0252001	3300049569	Bacteria	1146
335	Ga0501033_0208081	3300049570	Bacteria	1396
336	Ga0501038_0094755	3300049574	Bacteria	2495
337	Ga0501039_0050842	3300049575	Bacteria	3207
338	Ga0501047_0053385	3300049581	Bacteria	3908
339	Ga0501048_0103924	3300049582	Bacteria	2005
340	Ga0501073_0094047	3300049589	Bacteria	2082
341	Ga0501080_0014154	3300049742	Bacteria	7342
342	Ga0501083_0124162	3300049744	Bacteria	1692
343	Ga0501044_0425559	3300049823	Bacteria	1237
344	nmdc:mga03683_1034_c1	3300050489	Bacteria	8110
345	nmdc:mga00v17_115512_c1	3300050491	Bacteria	1706
346	nmdc:mga0yw44_27969_c1	3300050492	Bacteria	3238
347	nmdc:mga06z11_42628_c1	3300050494	Bacteria	2278
348	nmdc:mga07m45_93283_c1	3300050496	Bacteria	1726
349	nmdc:mga0sz30_1469_c1	3300050516	Bacteria	8404
350	Ga0500643_035481	3300053087	Bacteria	1495
351	Ga0500651_0148011	3300053093	Bacteria	1412
352	Ga0500556_0000022	3300053104	Bacteria	174894
353	Ga0500618_000008	3300053125	Bacteria	214678
354	Ga0500618_002036	3300053125	Bacteria	8170
355	Ga0500658_0001555	3300053134	Bacteria	9167
356	Ga0500568_0000076	3300053139	Bacteria	94411
357	Ga0500568_0112579	3300053139	Bacteria	1016
358	Ga0500616_0000093	3300053153	Bacteria	183114
359	Ga0500622_0002264	3300053156	Bacteria	14135
360	Ga0500622_0145203	3300053156	Bacteria	1127
361	Ga0500633_0000404	3300053160	Bacteria	6703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	iso_pu_bacteria	2643221557	2643803493	249
2	3300044842	Ga0466957_0279969	Ga0466957_0279969_254_1015	252
3	3300045049	Ga0466959_0112076	Ga0466959_0112076_670_1431	252
4	3300045836	Ga0466958_0442882	Ga0466958_0442882_69_830	252
5	3300048907	Ga0496104_0029683	Ga0496104_0029683_361_1131	256
6	3300048908	Ga0496105_0000356	Ga0496105_0000356_28718_29488	256
7	3300048915	Ga0496112_0530432	Ga0496112_0530432_122_892	256
8	3300048922	Ga0496119_0014092	Ga0496119_0014092_4388_5158	256
9	3300048927	Ga0496124_0039713	Ga0496124_0039713_848_1618	256
10	iso_pu_bacteria	2751185800	2753356454	262
11	3300021327	Ga0214543_1005681	Ga0214543_100568120	265
12	3300048927	Ga0496124_0218270	Ga0496124_0218270_74_931	272
13	3300013104	Ga0157370_10284737	Ga0157370_102847371	274
14	3300048910	Ga0496107_0171817	Ga0496107_0171817_264_1121	274
15	3300048920	Ga0496117_0137614	Ga0496117_0137614_612_1436	274
16	3300048924	Ga0496121_0048881	Ga0496121_0048881_2364_3221	274
17	3300048926	Ga0496123_0102330	Ga0496123_0102330_669_1526	274
18	3300005471	Ga0070698_100060775	Ga0070698_1000607753	275
19	3300025294	Ga0209025_1017757	Ga0209025_10177571	275
20	iso_pu_bacteria	2773857925	2774874626	275
21	iso_pu_bacteria	2775506901	2776266482	275
22	3300041413	Ga0439465_0017552	Ga0439465_0017552_272_1105	277
23	3300049569	Ga0501032_0252001	Ga0501032_0252001_80_913	277
24	3300049570	Ga0501033_0208081	Ga0501033_0208081_143_1000	277
25	3300049574	Ga0501038_0094755	Ga0501038_0094755_1121_1978	277
26	3300049575	Ga0501039_0050842	Ga0501039_0050842_1411_2268	277
27	3300049581	Ga0501047_0053385	Ga0501047_0053385_1446_2279	277
28	3300049582	Ga0501048_0103924	Ga0501048_0103924_146_1003	277
29	3300049589	Ga0501073_0094047	Ga0501073_0094047_38_895	277
30	3300049742	Ga0501080_0014154	Ga0501080_0014154_338_1195	277
31	3300049744	Ga0501083_0124162	Ga0501083_0124162_166_999	277
32	3300049823	Ga0501044_0425559	Ga0501044_0425559_47_904	277
33	iso_pu_bacteria	2585427633	2585993394	277
34	iso_pu_bacteria	2821123053	2821126834	277
35	iso_pu_bacteria	2838736955	2838740442	277
36	iso_pu_bacteria	2841840854	2841843434	277
37	iso_pu_bacteria	2842140634	2842143154	277
38	iso_pu_bacteria	2857531043	2857535382	277
39	3300041413	Ga0439465_0039119	Ga0439465_0039119_479_1324	278
40	3300048924	Ga0496121_0055665	Ga0496121_0055665_2325_3182	278
41	3300048925	Ga0496122_0049573	Ga0496122_0049573_2004_2861	278
42	3300048929	Ga0496126_0054824	Ga0496126_0054824_2291_3148	278
43	iso_pu_bacteria	2510917026	2511175884	278
44	iso_pu_bacteria	2585427634	2586004028	278
45	iso_pu_bacteria	2671180139	2671692254	278
46	iso_pu_bacteria	2818991461	2819687579	278
47	iso_pu_bacteria	2839993093	2839996371	278
48	3300005353	Ga0070669_100186573	Ga0070669_1001865732	279
49	3300014968	Ga0157379_10505102	Ga0157379_105051021	279
50	3300025927	Ga0207687_10131662	Ga0207687_101316622	279
51	3300031911	Ga0307412_10034685	Ga0307412_100346853	279
52	3300031995	Ga0307409_100123936	Ga0307409_1001239361	279
53	3300032002	Ga0307416_100013081	Ga0307416_1000130815	279
54	3300032005	Ga0307411_10170868	Ga0307411_101708681	279
55	3300045051	Ga0451576_0061038	Ga0451576_0061038_1519_2367	279
56	3300048911	Ga0496108_0468333	Ga0496108_0468333_144_995	279
57	3300048912	Ga0496109_0574295	Ga0496109_0574295_102_953	279
58	iso_pu_bacteria	2751185800	2753357543	279
59	iso_pu_bacteria	2758568016	2758640058	279
60	iso_pu_bacteria	2854911287	2854916687	279
61	iso_pu_bacteria	2915650412	2915652445	279
62	iso_pu_bacteria	2929138655	2929144009	279
63	iso_pu_bacteria	8018845410	8018853009	279
64	iso_pu_bacteria	2509276019	2509380642	280
65	iso_pu_bacteria	2513237138	2513871213	280
66	iso_pu_bacteria	2558860100	2558864884	280
67	iso_pu_bacteria	2582581867	2585401744	280
68	iso_pu_bacteria	2585427590	2585820135	280
69	iso_pu_bacteria	2751185821	2753460708	280
70	iso_pu_bacteria	2791355094	2792640827	280
71	iso_pu_bacteria	2838074704	2838080251	280
72	iso_pu_bacteria	2850079185	2850083812	280
73	iso_pu_bacteria	2894652903	2894656733	280
74	iso_pu_bacteria	2896384573	2896389196	280
75	iso_pu_bacteria	2904504865	2904507985	280
76	iso_pu_bacteria	2920760137	2920764247	280
77	iso_pu_bacteria	2923556063	2923560935	280
78	3300005328	Ga0070676_10028063	Ga0070676_100280632	281
79	3300005328	Ga0070676_10117562	Ga0070676_101175622	281
80	3300005331	Ga0070670_100000816	Ga0070670_10000081611	281
81	3300005331	Ga0070670_100112297	Ga0070670_1001122972	281
82	3300005333	Ga0070677_10042829	Ga0070677_100428292	281
83	3300005334	Ga0068869_100210586	Ga0068869_1002105862	281
84	3300005338	Ga0068868_100548316	Ga0068868_1005483161	281
85	3300005343	Ga0070687_100256091	Ga0070687_1002560912	281
86	3300005347	Ga0070668_100010254	Ga0070668_1000102547	281
87	3300005347	Ga0070668_100152159	Ga0070668_1001521592	281
88	3300005347	Ga0070668_100480455	Ga0070668_1004804551	281
89	3300005353	Ga0070669_100035809	Ga0070669_1000358094	281
90	3300005354	Ga0070675_100023468	Ga0070675_1000234684	281
91	3300005354	Ga0070675_100025554	Ga0070675_1000255543	281
92	3300005354	Ga0070675_100159448	Ga0070675_1001594482	281
93	3300005355	Ga0070671_100040845	Ga0070671_1000408452	281
94	3300005356	Ga0070674_100227753	Ga0070674_1002277532	281
95	3300005364	Ga0070673_100289228	Ga0070673_1002892281	281
96	3300005364	Ga0070673_100333051	Ga0070673_1003330511	281
97	3300005365	Ga0070688_100263545	Ga0070688_1002635451	281
98	3300005367	Ga0070667_100286383	Ga0070667_1002863832	281
99	3300005441	Ga0070700_100063220	Ga0070700_1000632202	281
100	3300005441	Ga0070700_100115367	Ga0070700_1001153672	281
101	3300005456	Ga0070678_100294173	Ga0070678_1002941732	281
102	3300005456	Ga0070678_100380887	Ga0070678_1003808872	281
103	3300005457	Ga0070662_100041516	Ga0070662_1000415164	281
104	3300005459	Ga0068867_100209258	Ga0068867_1002092581	281
105	3300005459	Ga0068867_100397759	Ga0068867_1003977591	281
106	3300005539	Ga0068853_100649454	Ga0068853_1006494541	281
107	3300005543	Ga0070672_100015872	Ga0070672_1000158724	281
108	3300005543	Ga0070672_100022621	Ga0070672_1000226212	281
109	3300005543	Ga0070672_100069657	Ga0070672_1000696572	281
110	3300005544	Ga0070686_100043949	Ga0070686_1000439494	281
111	3300005548	Ga0070665_100033310	Ga0070665_1000333105	281
112	3300005548	Ga0070665_100054572	Ga0070665_1000545723	281
113	3300005617	Ga0068859_100068072	Ga0068859_1000680722	281
114	3300005618	Ga0068864_100016052	Ga0068864_1000160527	281
115	3300005618	Ga0068864_100027182	Ga0068864_1000271825	281
116	3300005618	Ga0068864_100040570	Ga0068864_1000405702	281
117	3300005719	Ga0068861_100175694	Ga0068861_1001756942	281
118	3300005841	Ga0068863_100006074	Ga0068863_1000060749	281
119	3300005841	Ga0068863_100177322	Ga0068863_1001773222	281
120	3300005841	Ga0068863_100328892	Ga0068863_1003288922	281
121	3300005843	Ga0068860_100068590	Ga0068860_1000685902	281
122	3300005843	Ga0068860_100080196	Ga0068860_1000801964	281
123	3300005843	Ga0068860_100098820	Ga0068860_1000988202	281
124	3300006237	Ga0097621_100502284	Ga0097621_1005022842	281
125	3300006358	Ga0068871_100019362	Ga0068871_1000193623	281
126	3300006844	Ga0075428_100093765	Ga0075428_1000937654	281
127	3300006881	Ga0068865_100089327	Ga0068865_1000893271	281
128	3300006881	Ga0068865_100340622	Ga0068865_1003406222	281
129	3300006931	Ga0097620_100068071	Ga0097620_1000680715	281
130	3300006946	Ga0079104_1000029	Ga0079104_1000029119	281
131	3300009176	Ga0105242_10080727	Ga0105242_100807273	281
132	3300009177	Ga0105248_10067667	Ga0105248_100676673	281
133	3300009177	Ga0105248_10113749	Ga0105248_101137492	281
134	3300009553	Ga0105249_10064966	Ga0105249_100649664	281
135	3300013296	Ga0157374_10150904	Ga0157374_101509042	281
136	3300013297	Ga0157378_10068672	Ga0157378_100686723	281
137	3300013297	Ga0157378_10217509	Ga0157378_102175092	281
138	3300013306	Ga0163162_10029789	Ga0163162_100297892	281
139	3300013306	Ga0163162_10122509	Ga0163162_101225092	281
140	3300013308	Ga0157375_10274014	Ga0157375_102740142	281
141	3300013308	Ga0157375_10670593	Ga0157375_106705932	281
142	3300013308	Ga0157375_10740565	Ga0157375_107405651	281
143	3300014326	Ga0157380_10565117	Ga0157380_105651172	281
144	3300014969	Ga0157376_10106048	Ga0157376_101060481	281
145	3300014969	Ga0157376_10429246	Ga0157376_104292461	281
146	3300017792	Ga0163161_10153049	Ga0163161_101530492	281
147	3300025315	Ga0207697_10021473	Ga0207697_100214732	281
148	3300025893	Ga0207682_10061493	Ga0207682_100614932	281
149	3300025899	Ga0207642_10093291	Ga0207642_100932912	281
150	3300025907	Ga0207645_10165731	Ga0207645_101657312	281
151	3300025907	Ga0207645_10290309	Ga0207645_102903092	281
152	3300025918	Ga0207662_10095720	Ga0207662_100957203	281
153	3300025923	Ga0207681_10035186	Ga0207681_100351864	281
154	3300025925	Ga0207650_10051888	Ga0207650_100518882	281
155	3300025925	Ga0207650_10110944	Ga0207650_101109442	281
156	3300025926	Ga0207659_10011311	Ga0207659_100113114	281
157	3300025926	Ga0207659_10017111	Ga0207659_100171113	281
158	3300025931	Ga0207644_10116463	Ga0207644_101164632	281
159	3300025933	Ga0207706_10064869	Ga0207706_100648694	281
160	3300025935	Ga0207709_10225924	Ga0207709_102259242	281
161	3300025937	Ga0207669_10150370	Ga0207669_101503702	281
162	3300025938	Ga0207704_10080194	Ga0207704_100801941	281
163	3300025940	Ga0207691_10003580	Ga0207691_100035808	281
164	3300025940	Ga0207691_10005828	Ga0207691_100058284	281
165	3300025940	Ga0207691_10096549	Ga0207691_100965492	281
166	3300025941	Ga0207711_10147708	Ga0207711_101477083	281
167	3300025942	Ga0207689_10104759	Ga0207689_101047592	281
168	3300025960	Ga0207651_10030120	Ga0207651_100301202	281
169	3300025960	Ga0207651_10557604	Ga0207651_105576041	281
170	3300025972	Ga0207668_10005437	Ga0207668_100054378	281
171	3300025972	Ga0207668_10047494	Ga0207668_100474943	281
172	3300025972	Ga0207668_10328385	Ga0207668_103283852	281
173	3300026023	Ga0207677_10354741	Ga0207677_103547412	281
174	3300026035	Ga0207703_10117290	Ga0207703_101172902	281
175	3300026075	Ga0207708_10113717	Ga0207708_101137172	281
176	3300026088	Ga0207641_10026893	Ga0207641_100268935	281
177	3300026088	Ga0207641_10068668	Ga0207641_100686682	281
178	3300026088	Ga0207641_10121337	Ga0207641_101213372	281
179	3300026095	Ga0207676_10022365	Ga0207676_100223652	281
180	3300026095	Ga0207676_10099067	Ga0207676_100990672	281
181	3300026118	Ga0207675_100043510	Ga0207675_1000435106	281
182	3300026121	Ga0207683_10006415	Ga0207683_100064156	281
183	3300026121	Ga0207683_10137459	Ga0207683_101374592	281
184	3300026121	Ga0207683_10432936	Ga0207683_104329362	281
185	3300027111	Ga0209281_1000118	Ga0209281_1000118116	281
186	3300028379	Ga0268266_10049081	Ga0268266_100490812	281
187	3300028381	Ga0268264_10030605	Ga0268264_100306054	281
188	3300028381	Ga0268264_10033451	Ga0268264_100334513	281
189	3300028381	Ga0268264_10090090	Ga0268264_100900902	281
190	3300031235	Ga0265330_10007081	Ga0265330_100070813	281
191	3300035724	Ga0373933_0209062	Ga0373933_0209062_349_1209	281
192	3300039447	Ga0436361_0545407	Ga0436361_0545407_1870_2724	281
193	3300039450	Ga0436363_1336167	Ga0436363_1336167_335_1189	281
194	3300039453	Ga0436362_0558375	Ga0436362_0558375_55_990	281
195	3300048912	Ga0496109_0445469	Ga0496109_0445469_56_913	281
196	3300048915	Ga0496112_0091269	Ga0496112_0091269_840_1697	281
197	3300048924	Ga0496121_0000875	Ga0496121_0000875_12775_13620	281
198	3300048927	Ga0496124_0077762	Ga0496124_0077762_1201_2046	281
199	3300053087	Ga0500643_035481	Ga0500643_035481_10_855	281
200	iso_pu_bacteria	2510917030	2511200336	281
201	iso_pu_bacteria	2513237144	2513913394	281
202	iso_pu_bacteria	2513237146	2513924045	281
203	iso_pu_bacteria	2582581283	2585166980	281
204	iso_pu_bacteria	2582581298	2585222501	281
205	iso_pu_bacteria	2582581306	2585269172	281
206	iso_pu_bacteria	2582581308	2585277917	281
207	iso_pu_bacteria	2582581315	2585326862	281
208	iso_pu_bacteria	2582581316	2585332539	281
209	iso_pu_bacteria	2582581865	2585390832	281
210	iso_pu_bacteria	2585427527	2585533219	281
211	iso_pu_bacteria	2585427528	2585538769	281
212	iso_pu_bacteria	2585427529	2585544547	281
213	iso_pu_bacteria	2585427530	2585555640	281
214	iso_pu_bacteria	2585427593	2585836720	281
215	iso_pu_bacteria	2599185170	2599416089	281
216	iso_pu_bacteria	2599185352	2600195732	281
217	iso_pu_bacteria	2615840626	2616309160	281
218	iso_pu_bacteria	2615840698	2616555389	281
219	iso_pu_bacteria	2643221607	2644049861	281
220	iso_pu_bacteria	2643221610	2644067460	281
221	iso_pu_bacteria	2643221618	2644104192	281
222	iso_pu_bacteria	2643221626	2644149563	281
223	iso_pu_bacteria	2643221634	2644194938	281
224	iso_pu_bacteria	2643221636	2644202078	281
225	iso_pu_bacteria	2643221655	2644307066	281
226	iso_pu_bacteria	2643221659	2644331551	281
227	iso_pu_bacteria	2643221668	2644375140	281
228	iso_pu_bacteria	2643221675	2644418513	281
229	iso_pu_bacteria	2643221680	2644451880	281
230	iso_pu_bacteria	2643221686	2644482773	281
231	iso_pu_bacteria	2643221698	2644544566	281
232	iso_pu_bacteria	2643221712	2644619303	281
233	iso_pu_bacteria	2643221723	2644676471	281
234	iso_pu_bacteria	2643221726	2644690642	281
235	iso_pu_bacteria	2667528174	2671116221	281
236	iso_pu_bacteria	2738541317	2738944484	281
237	iso_pu_bacteria	2738541333	2739034191	281
238	iso_pu_bacteria	2791355260	2793322000	281
239	iso_pu_bacteria	2791355266	2793361831	281
240	iso_pu_bacteria	2802429633	2806042990	281
241	iso_pu_bacteria	2802429634	2806050944	281
242	iso_pu_bacteria	2802429635	2806057888	281
243	iso_pu_bacteria	2802429636	2806065396	281
244	iso_pu_bacteria	2802429637	2806075363	281
245	iso_pu_bacteria	2818991448	2819612352	281
246	iso_pu_bacteria	2818991453	2819641850	281
247	iso_pu_bacteria	2838022645	2838028137	281
248	iso_pu_bacteria	2838035591	2838036211	281
249	iso_pu_bacteria	2838661181	2838666481	281
250	iso_pu_bacteria	2842198810	2842203941	281
251	iso_pu_bacteria	2844163670	2844168714	281
252	iso_pu_bacteria	2913295892	2913297175	281
253	iso_pu_bacteria	2913308742	2913309103	281
254	iso_pu_bacteria	2919100787	2919103085	281
255	iso_pu_bacteria	2919408235	2919413934	281
256	iso_pu_bacteria	2920822456	2920824816	281
257	iso_pu_bacteria	2941499720	2941506284	281
258	iso_pu_bacteria	3005416602	3005422521	281
259	iso_pu_bacteria	8005301065	8005302577	281
260	iso_pu_bacteria	8005314921	8005320131	281
261	iso_pu_bacteria	8005484373	8005486773	281
262	iso_pu_bacteria	8005570704	8005575842	281
263	iso_pu_bacteria	8005645114	8005645605	281
264	iso_pu_bacteria	8005682033	8005685770	281
265	iso_pu_bacteria	8005688590	8005694590	281
266	3300005548	Ga0070665_100373485	Ga0070665_1003734852	282
267	3300031911	Ga0307412_10360663	Ga0307412_103606632	282
268	3300044735	Ga0466968_0056974	Ga0466968_0056974_333_1181	282
269	3300046530	Ga0495654_0000643	Ga0495654_0000643_22266_23114	282
270	3300048925	Ga0496122_0000634	Ga0496122_0000634_64095_64946	282
271	3300048926	Ga0496123_0003042	Ga0496123_0003042_1220_2071	282
272	3300048929	Ga0496126_0062052	Ga0496126_0062052_2231_3079	282
273	3300053125	Ga0500618_000008	Ga0500618_000008_155813_156661	282
274	3300053153	Ga0500616_0000093	Ga0500616_0000093_112975_113823	282
275	3300002737	JGI25162J39368_1002104	JGI25162J39368_10021049	283
276	3300003214	JGI25165J46597_1000116	JGI25165J46597_100011644	283
277	3300006051	Ga0075364_10010421	Ga0075364_100104213	283
278	3300025233	Ga0209437_100128	Ga0209437_10012896	283
279	3300025261	Ga0209233_1000072	Ga0209233_1000072259	283
280	3300044683	Ga0466965_0082333	Ga0466965_0082333_736_1587	283
281	3300048919	Ga0496116_0065418	Ga0496116_0065418_1283_2134	283
282	3300048920	Ga0496117_0034161	Ga0496117_0034161_71_922	283
283	3300048922	Ga0496119_0003133	Ga0496119_0003133_3480_4331	283
284	3300048922	Ga0496119_0100819	Ga0496119_0100819_421_1272	283
285	3300048923	Ga0496120_0022521	Ga0496120_0022521_2946_3797	283
286	3300048924	Ga0496121_0000217	Ga0496121_0000217_19784_20635	283
287	3300048925	Ga0496122_0021212	Ga0496122_0021212_4126_4977	283
288	3300048925	Ga0496122_0100128	Ga0496122_0100128_723_1574	283
289	3300048926	Ga0496123_0006765	Ga0496123_0006765_2422_3273	283
290	3300048927	Ga0496124_0006967	Ga0496124_0006967_9848_10699	283
291	3300048928	Ga0496125_0000093	Ga0496125_0000093_20002_20853	283
292	3300048928	Ga0496125_0000876	Ga0496125_0000876_17569_18420	283
293	3300048929	Ga0496126_0017727	Ga0496126_0017727_778_1629	283
294	3300050491	nmdc:mga00v17_115512_c1	nmdc:mga00v17_115512_c1_527_1378	283
295	3300005262	Ga0065165_1015412	Ga0065165_10154122	284
296	3300005937	Ga0081455_10130419	Ga0081455_101304192	284
297	3300009092	Ga0105250_10000002	Ga0105250_10000002250	284
298	3300025711	Ga0207696_1000021	Ga0207696_1000021257	284
299	3300027866	Ga0209813_10068297	Ga0209813_100682971	284
300	3300048925	Ga0496122_0001245	Ga0496122_0001245_322_1176	284
301	3300048926	Ga0496123_0010304	Ga0496123_0010304_1973_2827	284
302	3300053104	Ga0500556_0000022	Ga0500556_0000022_75020_75874	284
303	3300001979	JGI24740J21852_10000059	JGI24740J21852_1000005916	285
304	3300002737	JGI25162J39368_1000238	JGI25162J39368_100023829	285
305	3300002739	JGI25158J39367_1000212	JGI25158J39367_10002125	285
306	3300002773	JGI25152J39213_1001775	JGI25152J39213_10017759	285
307	3300002773	JGI25152J39213_1002026	JGI25152J39213_10020264	285
308	3300002773	JGI25152J39213_1003277	JGI25152J39213_10032775	285
309	3300002773	JGI25152J39213_1016215	JGI25152J39213_10162152	285
310	3300002987	JGI25159J45721_1000020	JGI25159J45721_100002093	285
311	3300002987	JGI25159J45721_1005113	JGI25159J45721_10051132	285
312	3300003187	JGI25151J46595_10000779	JGI25151J46595_1000077919	285
313	3300003187	JGI25151J46595_10001540	JGI25151J46595_100015402	285
314	3300003187	JGI25151J46595_10015331	JGI25151J46595_100153312	285
315	3300003187	JGI25151J46595_10017237	JGI25151J46595_100172372	285
316	3300003214	JGI25165J46597_1000635	JGI25165J46597_10006358	285
317	3300003215	JGI25153J46596_10005146	JGI25153J46596_100051463	285
318	3300003215	JGI25153J46596_10012246	JGI25153J46596_100122463	285
319	3300003316	rootH1_10057925	rootH1_100579252	285
320	3300003320	rootH2_10041489	rootH2_1004148922	285
321	3300003322	rootL2_10009855	rootL2_100098556	285
322	3300003322	rootL2_10339782	rootL2_103397822	285
323	3300003323	rootH1_10021627	rootH1_100216274	285
324	3300003323	rootH1_10158633	rootH1_101586333	285
325	3300003354	JGI25160J50197_1000055	JGI25160J50197_100005593	285
326	3300003354	JGI25160J50197_1000713	JGI25160J50197_100071313	285
327	3300003354	JGI25160J50197_1014716	JGI25160J50197_10147162	285
328	3300003374	JGI25161J50226_1000233	JGI25161J50226_100023329	285
329	3300003374	JGI25161J50226_1000809	JGI25161J50226_10008098	285
330	3300003763	Ga0055529_1007234	Ga0055529_10072341	285
331	3300003771	Ga0055526_1000656	Ga0055526_100065625	285
332	3300003771	Ga0055526_1002538	Ga0055526_100253813	285
333	3300003771	Ga0055526_1003653	Ga0055526_100365311	285
334	3300003771	Ga0055526_1013237	Ga0055526_10132373	285
335	3300003775	Ga0055524_1003284	Ga0055524_10032845	285
336	3300003775	Ga0055524_1006558	Ga0055524_10065583	285
337	3300003775	Ga0055524_1011909	Ga0055524_10119094	285
338	3300003781	Ga0055536_1005643	Ga0055536_10056432	285
339	3300003790	Ga0055528_1000343	Ga0055528_100034313	285
340	3300003790	Ga0055528_1010733	Ga0055528_10107335	285
341	3300003790	Ga0055528_1024397	Ga0055528_10243972	285
342	3300003794	Ga0055531_10029166	Ga0055531_100291663	285
343	3300004625	Ga0055543_1000140	Ga0055543_100014021	285
344	3300004625	Ga0055543_1000717	Ga0055543_100071715	285
345	3300004625	Ga0055543_1007457	Ga0055543_10074572	285
346	3300005262	Ga0065165_1000265	Ga0065165_100026541	285
347	3300005355	Ga0070671_100262786	Ga0070671_1002627862	285
348	3300005367	Ga0070667_100063266	Ga0070667_1000632663	285
349	3300005563	Ga0068855_100129498	Ga0068855_1001294982	285
350	3300005614	Ga0068856_100008790	Ga0068856_1000087903	285
351	3300005616	Ga0068852_100063160	Ga0068852_1000631602	285
352	3300005834	Ga0068851_10024901	Ga0068851_100249013	285
353	3300006038	Ga0075365_10004676	Ga0075365_100046762	285
354	3300006177	Ga0075362_10006660	Ga0075362_100066603	285
355	3300006178	Ga0075367_10012573	Ga0075367_100125733	285
356	3300006186	Ga0075369_10000529	Ga0075369_100005297	285
357	3300006195	Ga0075366_10005085	Ga0075366_100050855	285
358	3300006353	Ga0075370_10003506	Ga0075370_100035064	285
359	3300009093	Ga0105240_10000097	Ga0105240_1000009790	285
360	3300009545	Ga0105237_10001364	Ga0105237_1000136416	285
361	3300010375	Ga0105239_10000258	Ga0105239_1000025862	285
362	3300013104	Ga0157370_10001877	Ga0157370_100018779	285
363	3300013105	Ga0157369_10085285	Ga0157369_100852852	285
364	3300013249	Ga0171463_1003	Ga0171463_1003539	285
365	3300014325	Ga0163163_10031457	Ga0163163_100314575	285
366	3300015262	Ga0182007_10001017	Ga0182007_1000101713	285
367	3300015265	Ga0182005_1006933	Ga0182005_10069332	285
368	3300015690	Ga0183363_1215	Ga0183363_12153	285
369	3300025208	Ga0209436_100007	Ga0209436_100007121	285
370	3300025208	Ga0209436_105080	Ga0209436_1050803	285
371	3300025228	Ga0209672_103030	Ga0209672_1030302	285
372	3300025233	Ga0209437_100283	Ga0209437_10028344	285
373	3300025245	Ga0207425_1002547	Ga0207425_10025472	285
374	3300025253	Ga0209677_100172	Ga0209677_1001729	285
375	3300025254	Ga0209148_1000437	Ga0209148_100043737	285
376	3300025254	Ga0209148_1004042	Ga0209148_10040424	285
377	3300025258	Ga0209129_1000082	Ga0209129_1000082127	285
378	3300025258	Ga0209129_1000333	Ga0209129_100033316	285
379	3300025258	Ga0209129_1000499	Ga0209129_100049910	285
380	3300025261	Ga0209233_1000218	Ga0209233_100021891	285
381	3300025261	Ga0209233_1000268	Ga0209233_100026844	285
382	3300025272	Ga0209455_1002090	Ga0209455_10020904	285
383	3300025272	Ga0209455_1013818	Ga0209455_10138182	285
384	3300025273	Ga0209673_1000005	Ga0209673_1000005155	285
385	3300025273	Ga0209673_1000433	Ga0209673_100043354	285
386	3300025273	Ga0209673_1007112	Ga0209673_10071128	285
387	3300025284	Ga0209130_1000001	Ga0209130_1000001649	285
388	3300025284	Ga0209130_1000026	Ga0209130_1000026264	285
389	3300025292	Ga0209676_1005071	Ga0209676_10050717	285
390	3300025294	Ga0209025_1000081	Ga0209025_10000819	285
391	3300025294	Ga0209025_1000162	Ga0209025_100016247	285
392	3300025294	Ga0209025_1014161	Ga0209025_10141612	285
393	3300025294	Ga0209025_1026853	Ga0209025_10268532	285
394	3300025295	Ga0209564_1000208	Ga0209564_100020896	285
395	3300025295	Ga0209564_1002059	Ga0209564_100205913	285
396	3300025295	Ga0209564_1004552	Ga0209564_10045527	285
397	3300025295	Ga0209564_1009698	Ga0209564_10096985	285
398	3300025297	Ga0209758_1002405	Ga0209758_100240511	285
399	3300025299	Ga0209256_1000042	Ga0209256_1000042125	285
400	3300025299	Ga0209256_1000475	Ga0209256_100047531	285
401	3300025299	Ga0209256_1001960	Ga0209256_100196010	285
402	3300025299	Ga0209256_1002938	Ga0209256_10029384	285
403	3300025299	Ga0209256_1010472	Ga0209256_10104722	285
404	3300025302	Ga0207426_1000006	Ga0207426_1000006927	285
405	3300025302	Ga0207426_1000045	Ga0207426_1000045258	285
406	3300025302	Ga0207426_1000169	Ga0207426_1000169146	285
407	3300025302	Ga0207426_1000537	Ga0207426_100053717	285
408	3300025303	Ga0209051_1003968	Ga0209051_10039689	285
409	3300025303	Ga0209051_1046416	Ga0209051_10464161	285
410	3300025304	Ga0209257_1020951	Ga0209257_10209513	285
411	3300025909	Ga0207705_10466141	Ga0207705_104661411	285
412	3300025913	Ga0207695_10000187	Ga0207695_1000018794	285
413	3300025914	Ga0207671_10001438	Ga0207671_1000143816	285
414	3300025949	Ga0207667_10014667	Ga0207667_1001466711	285
415	3300025986	Ga0207658_10204937	Ga0207658_102049372	285
416	3300026078	Ga0207702_10009628	Ga0207702_100096289	285
417	3300027312	Ga0209371_1001628	Ga0209371_100162813	285
418	3300028794	Ga0307515_10249421	Ga0307515_102494212	285
419	3300030500	Ga0268256_1005242	Ga0268256_10052424	285
420	3300041411	Ga0439466_0064748	Ga0439466_0064748_282_1139	285
421	3300041413	Ga0439465_0074917	Ga0439465_0074917_10_867	285
422	3300044765	Ga0466970_0000095	Ga0466970_0000095_14448_15305	285
423	3300045976	Ga0466967_0023821	Ga0466967_0023821_1230_2087	285
424	3300046660	Ga0495625_0033828	Ga0495625_0033828_2755_3612	285
425	3300048903	Ga0496100_0000286	Ga0496100_0000286_9311_10168	285
426	3300048904	Ga0496101_0278713	Ga0496101_0278713_198_1055	285
427	3300048905	Ga0496102_0072076	Ga0496102_0072076_1875_2732	285
428	3300048906	Ga0496103_0018718	Ga0496103_0018718_350_1207	285
429	3300048909	Ga0496106_0001676	Ga0496106_0001676_9494_10351	285
430	3300048909	Ga0496106_0265426	Ga0496106_0265426_54_911	285
431	3300048911	Ga0496108_0264533	Ga0496108_0264533_292_1149	285
432	3300048913	Ga0496110_0043561	Ga0496110_0043561_391_1248	285
433	3300048920	Ga0496117_0000997	Ga0496117_0000997_8425_9282	285
434	3300048920	Ga0496117_0088447	Ga0496117_0088447_940_1797	285
435	3300048921	Ga0496118_0005383	Ga0496118_0005383_13660_14517	285
436	3300048922	Ga0496119_0005332	Ga0496119_0005332_10773_11645	285
437	3300048923	Ga0496120_0008701	Ga0496120_0008701_876_1733	285
438	3300048924	Ga0496121_0000084	Ga0496121_0000084_34042_34899	285
439	3300048924	Ga0496121_0012399	Ga0496121_0012399_5619_6476	285
440	3300048925	Ga0496122_0020083	Ga0496122_0020083_1596_2453	285
441	3300048926	Ga0496123_0005025	Ga0496123_0005025_8002_8859	285
442	3300048926	Ga0496123_0042049	Ga0496123_0042049_1101_1958	285
443	3300048926	Ga0496123_0045404	Ga0496123_0045404_280_1137	285
444	3300048926	Ga0496123_0072897	Ga0496123_0072897_420_1292	285
445	3300048927	Ga0496124_0025996	Ga0496124_0025996_3438_4295	285
446	3300048927	Ga0496124_0100232	Ga0496124_0100232_153_1025	285
447	3300048927	Ga0496124_0121495	Ga0496124_0121495_1056_1913	285
448	3300048928	Ga0496125_0006736	Ga0496125_0006736_11193_12050	285
449	3300048928	Ga0496125_0023998	Ga0496125_0023998_1753_2610	285
450	3300050489	nmdc:mga03683_1034_c1	nmdc:mga03683_1034_c1_2391_3248	285
451	3300050492	nmdc:mga0yw44_27969_c1	nmdc:mga0yw44_27969_c1_343_1200	285
452	3300050494	nmdc:mga06z11_42628_c1	nmdc:mga06z11_42628_c1_303_1160	285
453	3300050496	nmdc:mga07m45_93283_c1	nmdc:mga07m45_93283_c1_141_998	285
454	3300050516	nmdc:mga0sz30_1469_c1	nmdc:mga0sz30_1469_c1_2575_3432	285
455	3300053093	Ga0500651_0148011	Ga0500651_0148011_103_960	285
456	3300053125	Ga0500618_002036	Ga0500618_002036_1649_2506	285
457	3300053134	Ga0500658_0001555	Ga0500658_0001555_3806_4663	285
458	3300053139	Ga0500568_0000076	Ga0500568_0000076_6961_7818	285
459	3300053139	Ga0500568_0112579	Ga0500568_0112579_88_945	285
460	3300053156	Ga0500622_0002264	Ga0500622_0002264_4195_5052	285
461	3300053156	Ga0500622_0145203	Ga0500622_0145203_169_1026	285
462	3300053160	Ga0500633_0000404	Ga0500633_0000404_5594_6451	285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

61

309

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5org-assembly1.cif.gz_B	structure of the periplasmic binding protein (pbp) occj from a. tumefaciens b6 in complex with octopine.	0.9688	32	284
5ovz-assembly1.cif.gz_A	high resolution structure of the pbp noct in complex with nopaline	0.965	29	285
5org-assembly1.cif.gz_B	structure of the periplasmic binding protein (pbp) occj from a. tumefaciens b6 in complex with octopine.	0.9614	32	284
5ovz-assembly1.cif.gz_A	high resolution structure of the pbp noct in complex with nopaline	0.9505	29	285
5ot8-assembly2.cif.gz_B	structure of the periplasmic binding protein (pbp) noct-g97s mutant from a. tumefaciens c58 in complex with octopine.	0.9467	30	285

ID	Description	Score	Start	End	Superfamily
af_P0AEU0_25_107_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9803	31	112	3.40.190.10
af_P0AEQ3_26_110_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9656	33	117	3.40.190.10
5orgB01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9647	32	284	3.40.190.10
af_P0AEU0_25_107_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9574	31	112	3.40.190.10
5l9mA02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9547	157	230	3.40.190.10

ID	Description	Score	Start	End	GO Terms
AF-W1Y4P5-F1-model_v4	Lysine-arginine-ornithine-binding periplasmic protein LAO-binding protein	0.9838	31	113	GO:0030313
AF-A0A4Q3IT41-F1-model_v4	deleted	0.9659	159	285
AF-A0A3D3T4E1-F1-model_v4	Nickel transporter	0.964	32	234
AF-K0VYQ6-F1-model_v4	Extracellular solute-binding protein family 3	0.956	70	285
AF-D4GN87-F1-model_v4	NocT	0.9513	20	117

Feature Viewer

pLDDT	pTM	Quality
91.12	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448917

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

61

309

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map