F448769

General Info

Members Datasets Scaffolds Average Seq Length
461 309 922 353

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10071699|Ga0307510_100716993
Length 392
Sequence MSQPRAPFTGPCKARFGRLPRAWHDAFMSTALTDLCRLPIVQAPMAGGASCPQLAAAVSEAGGLGYLAAGYKTADGMYQEIKQLRGLTSRPFGVNLFMPQPEYADAAAVDVYRNQLAGEASWYETQLGDPDSGRDDGYDAKLAILIEDPVPLVSFTFGCPTRDVFDSFARVGTITVATVTTPEEAQTAQWSGADAVCVQGIEAGGHQGTHRDNPETDGAGLGLLSLIAQVRDTVQIPIVAAGGLMRGSQIAAVLAAGADAAQLGTAFLVCPESGANVLHKQAMTNPLFTRTELTRAFSGRPARGLVNRFMREHGPYAPAAYPQIHHLTSGLRKAAAKAGDAQGMALWAGQGHRMSRELPAGQLVEVLEAELAEAKDALAAGGQQGTQPGSQG

Samples

Sample ID Description Type Environment
1 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
54 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
55 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
64 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
65 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
66 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
67 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
68 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
78 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
79 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
80 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
81 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
82 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
83 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
84 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
85 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
86 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
87 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
88 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
89 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
90 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
199 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
200 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
201 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
202 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
207 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
208 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
209 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
213 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
214 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
215 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
216 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
217 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
218 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
219 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
220 2643221548 Streptomyces sp. Root55 Isolate Unclassified
221 2643221578 Streptomyces sp. Root63 Isolate Unclassified
222 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
223 2643221647 Streptomyces sp. Root369 Isolate Unclassified
224 2643221670 Streptomyces sp. Root431 Isolate Unclassified
225 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
226 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
227 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
228 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
229 2643221714 Streptomyces sp. Root264 Isolate Unclassified
230 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
231 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
232 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
233 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
234 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
235 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
236 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
237 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
238 2808606448 Streptomyces sp. 193411 Isolate Unclassified
239 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
240 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
241 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
242 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
243 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
244 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
245 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
246 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
247 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
248 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
249 2862574272 Streptomyces sp. AcE210 Isolate Nodule
250 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
251 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
252 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
253 2867369537 Streptomyces sp. Z26 Isolate Unclassified
254 2867428634 Streptomyces sp. RP5T Isolate Unclassified
255 2867475112 Streptomyces sp. TM32 Isolate Unclassified
256 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
257 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
258 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
259 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
260 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
261 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
262 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
263 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
264 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
265 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
266 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
267 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
268 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
269 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
270 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
271 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
272 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
273 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
274 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
275 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
276 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
277 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
278 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
279 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
280 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
281 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
282 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
283 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
284 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
285 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
286 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
287 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
288 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
289 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
290 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
291 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
292 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
293 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
294 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
295 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
296 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
297 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
298 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
299 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
300 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
301 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
302 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
303 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
304 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
305 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
306 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
307 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
308 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
309 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.09
Metatranscriptomes 0.65
Isolates 21.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.34
Nodule 0.65
Rhizoplane 0.87
Rhizosphere 77.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307510_10071699 3300033180 Bacteria 3448
2 JGI24737J22298_10030592 3300001990 Bacteria 1684
3 JGI24738J21930_10014892 3300002075 Bacteria 1663
4 rootH1_10023543 3300003316 Bacteria 7057
5 rootH2_10016555 3300003320 Bacteria 4466
6 rootL2_10017186 3300003322 Bacteria 3932
7 JGI25160J50197_1005426 3300003354 Bacteria 5309
8 JGI25160J50197_1018356 3300003354 Bacteria 2185
9 Ga0006562J51391_1090125 3300003578 Bacteria 3594
10 Ga0006562J51391_1101131 3300003578 Bacteria 12980
11 Ga0006562J51391_1101135 3300003578 Bacteria 3100
12 Ga0068869_100196953 3300005334 Bacteria 1587
13 Ga0070668_100002789 3300005347 Bacteria 12852
14 Ga0070668_100003303 3300005347 Bacteria 11900
15 Ga0070667_100014145 3300005367 Bacteria 6592
16 Ga0070714_100117698 3300005435 Bacteria 2360
17 Ga0070714_100138691 3300005435 Bacteria 2180
18 Ga0070714_100347952 3300005435 Bacteria 1392
19 Ga0070713_100021429 3300005436 Bacteria 4971
20 Ga0070710_10000871 3300005437 Bacteria 14436
21 Ga0070700_100107662 3300005441 Bacteria 1848
22 Ga0070694_100173717 3300005444 Bacteria 1589
23 Ga0070708_100108311 3300005445 Bacteria 2552
24 Ga0070663_100000197 3300005455 Bacteria 30053
25 Ga0070662_100022181 3300005457 Bacteria 4342
26 Ga0070698_100192641 3300005471 Bacteria 1976
27 Ga0068853_100070576 3300005539 Bacteria 3041
28 Ga0070696_100005313 3300005546 Bacteria 8590
29 Ga0068857_100317656 3300005577 Bacteria 1438
30 Ga0068854_100148148 3300005578 Bacteria 1807
31 Ga0068852_100402137 3300005616 Bacteria 1347
32 Ga0068861_100009957 3300005719 Bacteria 6582
33 Ga0081455_10000024 3300005937 Bacteria 157764
34 Ga0075367_10003669 3300006178 Bacteria 7368
35 Ga0105246_10003954 3300011119 Bacteria 8987
36 Ga0157372_10128600 3300013307 Bacteria 2913
37 Ga0182008_10003738 3300014497 Bacteria 9067
38 Ga0182007_10001599 3300015262 Bacteria 12037
39 Ga0183367_1006 3300015688 Bacteria 648044
40 Ga0213875_10001975 3300021388 Bacteria 12683
41 Ga0207426_1001844 3300025302 Bacteria 15586
42 Ga0207426_1004448 3300025302 Bacteria 6833
43 Ga0207713_1039010 3300025735 Bacteria 2009
44 Ga0207692_10000449 3300025898 Bacteria 14590
45 Ga0207699_10042174 3300025906 Bacteria 2641
46 Ga0207693_10019982 3300025915 Bacteria 5328
47 Ga0207646_10094234 3300025922 Bacteria 2681
48 Ga0207700_10024813 3300025928 Bacteria 4154
49 Ga0207664_10249672 3300025929 Bacteria 1548
50 Ga0207706_10001848 3300025933 Bacteria 20745
51 Ga0207709_10083963 3300025935 Bacteria 2061
52 Ga0207712_10004096 3300025961 Bacteria 9201
53 Ga0207639_10054586 3300026041 Bacteria 3054
54 Ga0207678_10000250 3300026067 Bacteria 48489
55 Ga0207708_10042915 3300026075 Bacteria 3446
56 Ga0207675_100000091 3300026118 Bacteria 70559
57 Ga0207698_10141947 3300026142 Bacteria 2071
58 Ga0307517_10003237 3300028786 Bacteria 25516
59 Ga0307517_10013292 3300028786 Bacteria 11194
60 Ga0307517_10215371 3300028786 Bacteria 1176
61 Ga0307515_10001149 3300028794 Bacteria 60657
62 Ga0307515_10174119 3300028794 Bacteria 2130
63 Ga0307511_10002271 3300030521 Bacteria 20096
64 Ga0307511_10135759 3300030521 Bacteria 1465
65 Ga0316176_1084383 3300030732 Bacteria 3924
66 Ga0314311_1253183 3300030733 Bacteria 3477
67 Ga0265327_10000001 3300031251 Bacteria 894475
68 Ga0307513_10123245 3300031456 Bacteria 2554
69 Ga0307509_10011698 3300031507 Bacteria 10595
70 Ga0307509_10031187 3300031507 Bacteria 5888
71 Ga0307509_10162831 3300031507 Bacteria 2125
72 Ga0307514_10014783 3300031649 Bacteria 6452
73 Ga0307516_10042767 3300031730 Bacteria 4492
74 Ga0307516_10049720 3300031730 Bacteria 4117
75 Ga0307516_10116829 3300031730 Bacteria 2462
76 Ga0307516_10295185 3300031730 Bacteria 1298
77 Ga0307518_10058710 3300031838 Bacteria 2794
78 Ga0307518_10109445 3300031838 Bacteria 1969
79 Ga0307410_10210577 3300031852 Bacteria 1489
80 Ga0307507_10078268 3300033179 Bacteria 2933
81 Ga0307507_10085849 3300033179 Bacteria 2734
82 Ga0307510_10010652 3300033180 Bacteria 10927
83 Ga0307510_10136173 3300033180 Bacteria 2113
84 Ga0307510_10183734 3300033180 Bacteria 1649
85 Ga0373934_0006092 3300035086 Bacteria 4465
86 Ga0373953_0038183 3300035117 Bacteria 1898
87 Ga0373956_0021088 3300035119 Bacteria 2777
88 Ga0373957_0008043 3300035120 Bacteria 3400
89 Ga0373943_0148994 3300035170 Bacteria 1266
90 Ga0373955_0010518 3300035172 Bacteria 4373
91 Ga0373935_0074296 3300035692 Bacteria 2197
92 Ga0373933_0038796 3300035724 Bacteria 2799
93 Ga0373925_0079189 3300037068 Bacteria 2496
94 Ga0395900_0439801 3300037418 Bacteria 1262
95 Ga0395898_0019353 3300037466 Bacteria 6930
96 Ga0395898_0040180 3300037466 Bacteria 4627
97 Ga0436364_0808893 3300037853 Bacteria 22233
98 Ga0436363_0620884 3300039450 Bacteria 3767
99 Ga0439436_0000349 3300041404 Bacteria 11426
100 Ga0439436_0021739 3300041404 Bacteria 1903
101 Ga0439439_0000769 3300041406 Bacteria 5784
102 Ga0439439_0024210 3300041406 Bacteria 1523
103 Ga0451789_0766186 3300041443 Bacteria 1156
104 Ga0439433_0000444 3300041999 Bacteria 7608
105 Ga0439442_003308 3300042002 Bacteria 3187
106 Ga0439448_0016024 3300042005 Bacteria 2277
107 Ga0439449_0001677 3300042007 Bacteria 8713
108 Ga0439449_0018786 3300042007 Bacteria 2592
109 Ga0439455_0001105 3300042012 Bacteria 4314
110 Ga0439457_000554 3300042014 Bacteria 10919
111 Ga0439457_014849 3300042014 Bacteria 1740
112 Ga0439462_0001142 3300042015 Bacteria 5771
113 Ga0450894_001872 3300042131 Bacteria 2916
114 Ga0450906_015026 3300042145 Bacteria 1410
115 Ga0439458_0002682 3300042157 Bacteria 4296
116 Ga0439458_0011908 3300042157 Bacteria 1948
117 Ga0450901_006821 3300042533 Bacteria 1177
118 Ga0466969_0030428 3300044656 Bacteria 2751
119 Ga0466972_0001389 3300044658 Bacteria 11736
120 Ga0466972_0003418 3300044658 Bacteria 7876
121 Ga0466972_0018269 3300044658 Bacteria 3504
122 Ga0466972_0029874 3300044658 Bacteria 2683
123 Ga0466972_0037475 3300044658 Bacteria 2370
124 Ga0466965_0009292 3300044683 Bacteria 4568
125 Ga0466965_0016365 3300044683 Bacteria 3528
126 Ga0466965_0023819 3300044683 Bacteria 2957
127 Ga0466966_0003579 3300044684 Bacteria 10253
128 Ga0466966_0006569 3300044684 Bacteria 7698
129 Ga0466961_0003838 3300044693 Bacteria 9403
130 Ga0466961_0016236 3300044693 Bacteria 4781
131 Ga0466961_0019927 3300044693 Bacteria 4317
132 Ga0466963_0010432 3300044694 Bacteria 5624
133 Ga0466963_0125557 3300044694 Bacteria 1769
134 Ga0466971_0002493 3300044719 Bacteria 7784
135 Ga0466971_0006305 3300044719 Bacteria 5149
136 Ga0466971_0021947 3300044719 Bacteria 2842
137 Ga0466968_0014632 3300044735 Bacteria 3102
138 Ga0466970_0000617 3300044765 Bacteria 17468
139 Ga0466970_0017497 3300044765 Bacteria 3705
140 Ga0466970_0059997 3300044765 Bacteria 2037
141 Ga0466957_0003815 3300044842 Bacteria 8330
142 Ga0466960_0003377 3300044901 Bacteria 6128
143 Ga0466959_0006733 3300045049 Bacteria 7998
144 Ga0466959_0040673 3300045049 Bacteria 3433
145 Ga0466958_0031289 3300045836 Bacteria 3162
146 Ga0466967_0036245 3300045976 Bacteria 4208
147 Ga0466967_0113035 3300045976 Bacteria 2497
148 Ga0466967_0131033 3300045976 Bacteria 2328
149 Ga0495592_0007400 3300046454 Bacteria 8219
150 Ga0495592_0038814 3300046454 Bacteria 3580
151 Ga0495603_0001982 3300046455 Bacteria 12061
152 Ga0495603_0011458 3300046455 Bacteria 5367
153 Ga0495603_0048832 3300046455 Bacteria 2519
154 Ga0495603_0060216 3300046455 Bacteria 2243
155 Ga0495603_0096548 3300046455 Bacteria 1726
156 Ga0495603_0118314 3300046455 Bacteria 1544
157 Ga0495629_0001208 3300046459 Bacteria 20277
158 Ga0495629_0011632 3300046459 Bacteria 6389
159 Ga0495629_0020592 3300046459 Bacteria 4710
160 Ga0495629_0020918 3300046459 Bacteria 4669
161 Ga0495629_0033153 3300046459 Bacteria 3654
162 Ga0495638_0065058 3300046460 Bacteria 2245
163 Ga0495638_0134362 3300046460 Bacteria 1450
164 Ga0495651_0005303 3300046462 Bacteria 9831
165 Ga0495651_0030261 3300046462 Bacteria 4222
166 Ga0495651_0044885 3300046462 Bacteria 3424
167 Ga0495653_0099035 3300046463 Bacteria 2116
168 Ga0495582_0005776 3300046473 Bacteria 6892
169 Ga0495582_0017866 3300046473 Bacteria 3877
170 Ga0495639_0006565 3300046475 Bacteria 5003
171 Ga0495639_0054935 3300046475 Bacteria 1816
172 Ga0495662_0014696 3300046476 Bacteria 3805
173 Ga0495662_0023319 3300046476 Bacteria 2987
174 Ga0495662_0039868 3300046476 Bacteria 2268
175 Ga0495662_0049676 3300046476 Bacteria 2024
176 Ga0495664_0019220 3300046477 Bacteria 3925
177 Ga0495664_0078959 3300046477 Bacteria 1972
178 Ga0495585_0010472 3300046492 Bacteria 5515
179 Ga0495585_0012506 3300046492 Bacteria 5000
180 Ga0495594_0002826 3300046499 Bacteria 9026
181 Ga0495594_0011605 3300046499 Bacteria 4582
182 Ga0495594_0182147 3300046499 Bacteria 1196
183 Ga0495607_0029775 3300046501 Bacteria 3358
184 Ga0495583_0053751 3300046506 Bacteria 1826
185 Ga0495606_0054469 3300046507 Bacteria 2590
186 Ga0495608_0027048 3300046511 Bacteria 3905
187 Ga0495618_0074785 3300046514 Bacteria 2157
188 Ga0495618_0097744 3300046514 Bacteria 1878
189 Ga0495620_0009439 3300046515 Bacteria 5190
190 Ga0495620_0064722 3300046515 Bacteria 1511
191 Ga0495628_0010106 3300046516 Bacteria 8026
192 Ga0495628_0080355 3300046516 Bacteria 2534
193 Ga0495630_0010493 3300046517 Bacteria 6692
194 Ga0495631_0021637 3300046518 Bacteria 2994
195 Ga0495632_0011558 3300046519 Bacteria 5146
196 Ga0495643_0002360 3300046522 Bacteria 15131
197 Ga0495643_0017534 3300046522 Bacteria 4183
198 Ga0495643_0129277 3300046522 Bacteria 1269
199 Ga0495648_0084688 3300046524 Bacteria 1793
200 Ga0495666_0155040 3300046526 Bacteria 1064
201 Ga0495652_0024382 3300046529 Bacteria 5355
202 Ga0495652_0090620 3300046529 Bacteria 2501
203 Ga0495652_0124609 3300046529 Bacteria 2049
204 Ga0495654_0036185 3300046530 Bacteria 2482
205 Ga0495665_0004571 3300046531 Bacteria 7471
206 Ga0495665_0169553 3300046531 Bacteria 1137
207 Ga0495640_0028551 3300046533 Bacteria 4015
208 Ga0495586_0017311 3300046535 Bacteria 3831
209 Ga0495587_0075487 3300046536 Bacteria 1957
210 Ga0495597_0006986 3300046542 Bacteria 5783
211 Ga0495597_0032611 3300046542 Bacteria 2363
212 Ga0495645_0010118 3300046543 Bacteria 6608
213 Ga0495645_0056078 3300046543 Bacteria 2861
214 Ga0495622_0014268 3300046557 Bacteria 3690
215 Ga0495633_0037858 3300046558 Bacteria 2306
216 Ga0495667_0025415 3300046559 Bacteria 3991
217 Ga0495634_0008018 3300046642 Bacteria 7881
218 Ga0495634_0028789 3300046642 Bacteria 3852
219 Ga0495634_0037933 3300046642 Bacteria 3288
220 Ga0495611_0008966 3300046648 Bacteria 4230
221 Ga0495611_0043215 3300046648 Bacteria 2014
222 Ga0495625_0094199 3300046660 Bacteria 2067
223 Ga0495625_0113144 3300046660 Bacteria 1854
224 Ga0495635_0000648 3300046663 Bacteria 22367
225 Ga0495635_0024636 3300046663 Bacteria 4193
226 Ga0495635_0042997 3300046663 Bacteria 3118
227 Ga0495635_0169102 3300046663 Bacteria 1487
228 Ga0495588_0006650 3300046674 Bacteria 5219
229 Ga0495588_0016746 3300046674 Bacteria 3545
230 Ga0495588_0019249 3300046674 Bacteria 3342
231 Ga0495657_0001640 3300046675 Bacteria 19226
232 Ga0495657_0005579 3300046675 Bacteria 9929
233 Ga0495657_0024626 3300046675 Bacteria 4284
234 Ga0495599_0086473 3300046678 Bacteria 1957
235 Ga0495623_0013590 3300046679 Bacteria 5277
236 Ga0495623_0056909 3300046679 Bacteria 2461
237 Ga0495646_0000297 3300046680 Bacteria 25413
238 Ga0495646_0032218 3300046680 Bacteria 3262
239 Ga0495658_0015419 3300046683 Bacteria 3920
240 Ga0495658_0031812 3300046683 Bacteria 2876
241 Ga0495613_0001356 3300046689 Bacteria 18654
242 Ga0495613_0009671 3300046689 Bacteria 7162
243 Ga0495613_0035126 3300046689 Bacteria 3721
244 Ga0495613_0049126 3300046689 Bacteria 3114
245 Ga0495613_0060409 3300046689 Bacteria 2776
246 Ga0495613_0068938 3300046689 Bacteria 2579
247 Ga0495613_0106844 3300046689 Bacteria 2019
248 Ga0495624_0019111 3300046690 Bacteria 4577
249 Ga0495624_0062354 3300046690 Bacteria 2332
250 Ga0495670_0060874 3300046691 Bacteria 1897
251 Ga0495649_0019333 3300046694 Bacteria 3828
252 Ga0495589_0004130 3300046794 Bacteria 7769
253 Ga0495589_0013574 3300046794 Bacteria 4201
254 Ga0495589_0013722 3300046794 Bacteria 4178
255 Ga0495589_0036514 3300046794 Bacteria 2463
256 Ga0495600_0054352 3300046809 Bacteria 2615
257 Ga0495660_0016997 3300046810 Bacteria 4189
258 Ga0495660_0035073 3300046810 Bacteria 2804
259 Ga0495581_0001876 3300047315 Bacteria 11760
260 Ga0495581_0014811 3300047315 Bacteria 4524
261 Ga0495581_0025805 3300047315 Bacteria 3407
262 Ga0495604_0071911 3300047317 Bacteria 2615
263 Ga0495604_0090784 3300047317 Bacteria 2267
264 Ga0495604_0155935 3300047317 Bacteria 1617
265 Ga0495636_0000860 3300047318 Bacteria 11223
266 Ga0495636_0001020 3300047318 Bacteria 10495
267 Ga0495636_0010021 3300047318 Bacteria 3735
268 Ga0495674_0310530 3300047319 Bacteria 1286
269 Ga0495676_0000404 3300047321 Bacteria 35030
270 Ga0495676_0000494 3300047321 Bacteria 32369
271 Ga0495676_0015864 3300047321 Bacteria 6696
272 Ga0495676_0041539 3300047321 Bacteria 3783
273 Ga0495676_0094650 3300047321 Bacteria 2224
274 Ga0495676_0104367 3300047321 Bacteria 2091
275 Ga0495680_0002821 3300047322 Bacteria 17481
276 Ga0495683_0042252 3300047323 Bacteria 2298
277 Ga0495687_008924 3300047443 Bacteria 5673
278 Ga0495687_013993 3300047443 Bacteria 4152
279 Ga0495687_052818 3300047443 Bacteria 1716
280 Ga0495687_068073 3300047443 Bacteria 1438
281 Ga0495675_0004219 3300047444 Bacteria 8696
282 Ga0495675_0012998 3300047444 Bacteria 5249
283 Ga0495685_000235 3300047447 Bacteria 19008
284 Ga0495685_001771 3300047447 Bacteria 6661
285 Ga0495685_006838 3300047447 Bacteria 3752
286 Ga0495685_048189 3300047447 Bacteria 1448
287 Ga0495681_0000676 3300047470 Bacteria 25904
288 Ga0495681_0001189 3300047470 Bacteria 19807
289 Ga0495681_0019088 3300047470 Bacteria 3755
290 Ga0495686_0021689 3300047472 Bacteria 4260
291 Ga0495686_0183313 3300047472 Bacteria 1212
292 Ga0495593_0004137 3300047673 Bacteria 8635
293 Ga0495593_0039260 3300047673 Bacteria 2553
294 Ga0495593_0047416 3300047673 Bacteria 2286
295 Ga0495593_0087858 3300047673 Bacteria 1602
296 Ga0495614_0000337 3300048089 Bacteria 18552
297 Ga0495614_0002612 3300048089 Bacteria 8006
298 Ga0495614_0060418 3300048089 Bacteria 1628
299 Ga0496102_0450854 3300048905 Bacteria 1207
300 Ga0496108_0172830 3300048911 Bacteria 1870
301 Ga0496109_0035520 3300048912 Bacteria 4497
302 Ga0496117_0000276 3300048920 Bacteria 95844
303 Ga0496122_0008214 3300048925 Bacteria 11339
304 Ga0496123_0017929 3300048926 Bacteria 5668
305 Ga0501032_0061523 3300049569 Bacteria 2516
306 Ga0501033_0003576 3300049570 Bacteria 12716
307 Ga0501033_0073894 3300049570 Bacteria 2503
308 Ga0501034_0034166 3300049571 Bacteria 5155
309 Ga0501034_0072473 3300049571 Bacteria 3453
310 Ga0501036_0003584 3300049572 Bacteria 12413
311 Ga0501036_0007621 3300049572 Bacteria 8834
312 Ga0501036_0041207 3300049572 Bacteria 3907
313 Ga0501037_0015657 3300049573 Bacteria 5582
314 Ga0501039_0012959 3300049575 Bacteria 6375
315 Ga0501043_0007474 3300049579 Bacteria 8678
316 Ga0501043_0174812 3300049579 Bacteria 1674
317 Ga0501043_0225811 3300049579 Bacteria 1447
318 Ga0501047_0036291 3300049581 Bacteria 4764
319 Ga0501047_0061566 3300049581 Bacteria 3621
320 Ga0501047_0082519 3300049581 Bacteria 3090
321 Ga0501047_0159778 3300049581 Bacteria 2125
322 Ga0501047_0253451 3300049581 Bacteria 1608
323 Ga0501048_0152638 3300049582 Bacteria 1634
324 Ga0501068_0041854 3300049584 Bacteria 2754
325 Ga0501070_0001738 3300049586 Bacteria 19257
326 Ga0501070_0096140 3300049586 Bacteria 2451
327 Ga0501070_0159889 3300049586 Bacteria 1857
328 Ga0501070_0232627 3300049586 Bacteria 1510
329 Ga0501073_0040737 3300049589 Bacteria 3286
330 Ga0501074_0004238 3300049590 Bacteria 10235
331 Ga0501080_0057428 3300049742 Bacteria 3623
332 Ga0501035_0077635 3300049822 Bacteria 2934
333 Ga0501035_0100076 3300049822 Bacteria 2545
334 Ga0501035_0105372 3300049822 Bacteria 2472
335 Ga0501044_0004053 3300049823 Bacteria 16437
336 Ga0501044_0038903 3300049823 Bacteria 4966
337 Ga0501044_0097001 3300049823 Bacteria 2969
338 Ga0501044_0218613 3300049823 Bacteria 1856
339 Ga0501044_0223746 3300049823 Bacteria 1832
340 Ga0501045_0051545 3300049824 Bacteria 3003
341 Ga0501045_0266313 3300049824 Bacteria 1276
342 nmdc:mga06z11_1768_c1 3300050494 Bacteria 8119
343 Ga0495601_0143261 3300053077 Bacteria 1559
344 Ga0495619_0012889 3300053085 Bacteria 5265
345 Ga0495619_0018256 3300053085 Bacteria 4450
346 Ga0500640_001595 3300053095 Bacteria 6984
347 Ga0500660_067085 3300053100 Bacteria 1700
348 Ga0500553_044667 3300053101 Bacteria 2152
349 Ga0500560_021322 3300053107 Bacteria 1850
350 Ga0500560_035357 3300053107 Bacteria 1537
351 Ga0500569_000261 3300053109 Bacteria 8351
352 Ga0500573_0021282 3300053140 Bacteria 3716
353 Ga0500600_0045495 3300053149 Bacteria 2511
354 Ga0500616_0000152 3300053153 Bacteria 116194
355 Ga0500633_0003006 3300053160 Bacteria 3599
356 Ga0500634_0031852 3300053161 Bacteria 2876
357 Ga0500634_0102913 3300053161 Bacteria 1426
358 Ga0500645_004945 3300053730 Bacteria 5004
359 Ga0500656_001298 3300053732 Bacteria 2128
360 Ga0501082_0257842 3300060353 Bacteria 1517
361 Ga0466962_0003448 3300061719 Bacteria 7535
362 Ga0466962_0006149 3300061719 Bacteria 5770
363 Ga0466962_0041249 3300061719 Bacteria 2208
364 2547407952 2547132111 Bacteria 8013147
365 2554258647 2554235005 Bacteria 6457341
366 2585301358 2582581312 Bacteria 7308206
367 2585304900 2582581313 Bacteria 10042643
368 2585318956 2582581314 Bacteria 11452267
369 2586063178 2585427649 Bacteria 9053857
370 2616701810 2616644814 Bacteria 11555299
371 2616899829 2616644941 Bacteria 8510691
372 2643759701 2643221548 Bacteria 8053412
373 2643897818 2643221578 Bacteria 9213798
374 2643944735 2643221587 Bacteria 7586415
375 2644269193 2643221647 Bacteria 10741251
376 2644385335 2643221670 Bacteria 6497041
377 2644408963 2643221673 Bacteria 9196637
378 2644431633 2643221677 Bacteria 7584031
379 2644436313 2643221678 Bacteria 9540101
380 2644462884 2643221682 Bacteria 6743283
381 2644625825 2643221714 Bacteria 9015452
382 2753070474 2751185734 Bacteria 8863695
383 2776376143 2775506925 Bacteria 7237746
384 2784587814 2784132148 Bacteria 8627943
385 2785368519 2784746768 Bacteria 10036182
386 2786669540 2786546132 Bacteria 10419719
387 2804844829 2802429296 Bacteria 7227771
388 2808841210 2808606359 Bacteria 9866990
389 2808919724 2808606375 Bacteria 9466072
390 2809231397 2808606448 Bacteria 8656184
391 2809587677 2808606522 Bacteria 9488490
392 2811848216 2808606982 Bacteria 7791042
393 2812359046 2811994879 Bacteria 9313447
394 2812481288 2811994917 Bacteria 7761064
395 2819693727 2818991463 Bacteria 7948711
396 2862182546 2862178590 Bacteria 8583590
397 2862288208 2862281513 Bacteria 9621493
398 2862296944 2862290372 Bacteria 7471434
399 2862384637 2862382967 Bacteria 10317375
400 2862513382 2862507626 Bacteria 9425308
401 2862580050 2862574272 Bacteria 10567477
402 2863068485 2863067949 Bacteria 8541735
403 2863405585 2863404153 Bacteria 9672205
404 2866556065 2866552031 Bacteria 5824618
405 2867371038 2867369537 Bacteria 6501581
406 2867429353 2867428634 Bacteria 9590268
407 2867480901 2867475112 Bacteria 6909112
408 2870729694 2870721527 Bacteria 9689237
409 2873156613 2873151551 Bacteria 8625867
410 2875393739 2875391855 Bacteria 7600475
411 2877682014 2877676314 Bacteria 9512378
412 2891331296 2891326441 Bacteria 6439512
413 2899362964 2899359706 Bacteria 10940472
414 2904769523 2904765812 Bacteria 5369154
415 2904773088 2904770941 Bacteria 5580202
416 2908814080 2908811453 Bacteria 5478616
417 2912720977 2912715099 Bacteria 9460473
418 2912725066 2912723979 Bacteria 8557534
419 2912759872 2912757875 Bacteria 7940295
420 2917737272 2917736166 Bacteria 9690793
421 2918503765 2918501144 Bacteria 8668083
422 2919422554 2919420072 Bacteria 5390363
423 2919435193 2919432681 Bacteria 5390474
424 2919468611 2919468124 Bacteria 9133025
425 2946050923 2946045630 Bacteria 8527308
426 2946066832 2946064051 Bacteria 8957905
427 2946075158 2946072368 Bacteria 8999607
428 2947230397 2947224130 Bacteria 9938529
429 2954003726 2954002825 Bacteria 9173742
430 2954387132 2954380949 Bacteria 10050426
431 2954676030 2954673503 Bacteria 9685905
432 2954688135 2954682443 Bacteria 9862841
433 2954697962 2954691527 Bacteria 10720516
434 2954704254 2954701450 Bacteria 10834262
435 2954717082 2954711539 Bacteria 10867210
436 2954727052 2954721474 Bacteria 10456478
437 2954734751 2954731030 Bacteria 10243860
438 2954745954 2954740390 Bacteria 10229294
439 2954753637 2954749733 Bacteria 10366972
440 2954764925 2954759201 Bacteria 9358192
441 2966603344 2966598605 Bacteria 7676064
442 2990061947 2990059506 Bacteria 9321252
443 2990090481 2990088156 Bacteria 6657676
444 2997456500 2997451912 Bacteria 8492419
445 2997608217 2997600082 Bacteria 9896405
446 3003002391 3002998708 Bacteria 11715108
447 3006501007 3006493962 Bacteria 8825450
448 8003318358 8003314358 Bacteria 10575343
449 8008559492 8008558824 Bacteria 10610750
450 8008579672 8008574985 Bacteria 7815457
451 8023628136 8023623736 Bacteria 8593882
452 8025419272 8025413630 Bacteria 7014048
453 8025480151 8025478263 Bacteria 8209203
454 8025535175 8025530807 Bacteria 8495698
455 8047711544 8047710418 Bacteria 11023148
456 8048408440 8048406513 Bacteria 8936924
457 8053951643 8053945823 Bacteria 8962862
458 8054165197 8054160619 Bacteria 7783213
459 8056453561 8056447290 Bacteria 7680491
460 8056836884 8056829672 Bacteria 9045328
461 8057347146 8057345674 Bacteria 4160394
462 Ga0307510_10071699
463 JGI24737J22298_10030592
464 JGI24738J21930_10014892
465 rootH1_10023543
466 rootH2_10016555
467 rootL2_10017186
468 JGI25160J50197_1005426
469 JGI25160J50197_1018356
470 Ga0006562J51391_1090125
471 Ga0006562J51391_1101131
472 Ga0006562J51391_1101135
473 Ga0068869_100196953
474 Ga0070668_100002789
475 Ga0070668_100003303
476 Ga0070667_100014145
477 Ga0070714_100117698
478 Ga0070714_100138691
479 Ga0070714_100347952
480 Ga0070713_100021429
481 Ga0070710_10000871
482 Ga0070700_100107662
483 Ga0070694_100173717
484 Ga0070708_100108311
485 Ga0070663_100000197
486 Ga0070662_100022181
487 Ga0070698_100192641
488 Ga0068853_100070576
489 Ga0070696_100005313
490 Ga0068857_100317656
491 Ga0068854_100148148
492 Ga0068852_100402137
493 Ga0068861_100009957
494 Ga0081455_10000024
495 Ga0075367_10003669
496 Ga0105246_10003954
497 Ga0157372_10128600
498 Ga0182008_10003738
499 Ga0182007_10001599
500 Ga0183367_1006
501 Ga0213875_10001975
502 Ga0207426_1001844
503 Ga0207426_1004448
504 Ga0207713_1039010
505 Ga0207692_10000449
506 Ga0207699_10042174
507 Ga0207693_10019982
508 Ga0207646_10094234
509 Ga0207700_10024813
510 Ga0207664_10249672
511 Ga0207706_10001848
512 Ga0207709_10083963
513 Ga0207712_10004096
514 Ga0207639_10054586
515 Ga0207678_10000250
516 Ga0207708_10042915
517 Ga0207675_100000091
518 Ga0207698_10141947
519 Ga0307517_10003237
520 Ga0307517_10013292
521 Ga0307517_10215371
522 Ga0307515_10001149
523 Ga0307515_10174119
524 Ga0307511_10002271
525 Ga0307511_10135759
526 Ga0316176_1084383
527 Ga0314311_1253183
528 Ga0265327_10000001
529 Ga0307513_10123245
530 Ga0307509_10011698
531 Ga0307509_10031187
532 Ga0307509_10162831
533 Ga0307514_10014783
534 Ga0307516_10042767
535 Ga0307516_10049720
536 Ga0307516_10116829
537 Ga0307516_10295185
538 Ga0307518_10058710
539 Ga0307518_10109445
540 Ga0307410_10210577
541 Ga0307507_10078268
542 Ga0307507_10085849
543 Ga0307510_10010652
544 Ga0307510_10136173
545 Ga0307510_10183734
546 Ga0373934_0006092
547 Ga0373953_0038183
548 Ga0373956_0021088
549 Ga0373957_0008043
550 Ga0373943_0148994
551 Ga0373955_0010518
552 Ga0373935_0074296
553 Ga0373933_0038796
554 Ga0373925_0079189
555 Ga0395900_0439801
556 Ga0395898_0019353
557 Ga0395898_0040180
558 Ga0436364_0808893
559 Ga0436363_0620884
560 Ga0439436_0000349
561 Ga0439436_0021739
562 Ga0439439_0000769
563 Ga0439439_0024210
564 Ga0451789_0766186
565 Ga0439433_0000444
566 Ga0439442_003308
567 Ga0439448_0016024
568 Ga0439449_0001677
569 Ga0439449_0018786
570 Ga0439455_0001105
571 Ga0439457_000554
572 Ga0439457_014849
573 Ga0439462_0001142
574 Ga0450894_001872
575 Ga0450906_015026
576 Ga0439458_0002682
577 Ga0439458_0011908
578 Ga0450901_006821
579 Ga0466969_0030428
580 Ga0466972_0001389
581 Ga0466972_0003418
582 Ga0466972_0018269
583 Ga0466972_0029874
584 Ga0466972_0037475
585 Ga0466965_0009292
586 Ga0466965_0016365
587 Ga0466965_0023819
588 Ga0466966_0003579
589 Ga0466966_0006569
590 Ga0466961_0003838
591 Ga0466961_0016236
592 Ga0466961_0019927
593 Ga0466963_0010432
594 Ga0466963_0125557
595 Ga0466971_0002493
596 Ga0466971_0006305
597 Ga0466971_0021947
598 Ga0466968_0014632
599 Ga0466970_0000617
600 Ga0466970_0017497
601 Ga0466970_0059997
602 Ga0466957_0003815
603 Ga0466960_0003377
604 Ga0466959_0006733
605 Ga0466959_0040673
606 Ga0466958_0031289
607 Ga0466967_0036245
608 Ga0466967_0113035
609 Ga0466967_0131033
610 Ga0495592_0007400
611 Ga0495592_0038814
612 Ga0495603_0001982
613 Ga0495603_0011458
614 Ga0495603_0048832
615 Ga0495603_0060216
616 Ga0495603_0096548
617 Ga0495603_0118314
618 Ga0495629_0001208
619 Ga0495629_0011632
620 Ga0495629_0020592
621 Ga0495629_0020918
622 Ga0495629_0033153
623 Ga0495638_0065058
624 Ga0495638_0134362
625 Ga0495651_0005303
626 Ga0495651_0030261
627 Ga0495651_0044885
628 Ga0495653_0099035
629 Ga0495582_0005776
630 Ga0495582_0017866
631 Ga0495639_0006565
632 Ga0495639_0054935
633 Ga0495662_0014696
634 Ga0495662_0023319
635 Ga0495662_0039868
636 Ga0495662_0049676
637 Ga0495664_0019220
638 Ga0495664_0078959
639 Ga0495585_0010472
640 Ga0495585_0012506
641 Ga0495594_0002826
642 Ga0495594_0011605
643 Ga0495594_0182147
644 Ga0495607_0029775
645 Ga0495583_0053751
646 Ga0495606_0054469
647 Ga0495608_0027048
648 Ga0495618_0074785
649 Ga0495618_0097744
650 Ga0495620_0009439
651 Ga0495620_0064722
652 Ga0495628_0010106
653 Ga0495628_0080355
654 Ga0495630_0010493
655 Ga0495631_0021637
656 Ga0495632_0011558
657 Ga0495643_0002360
658 Ga0495643_0017534
659 Ga0495643_0129277
660 Ga0495648_0084688
661 Ga0495666_0155040
662 Ga0495652_0024382
663 Ga0495652_0090620
664 Ga0495652_0124609
665 Ga0495654_0036185
666 Ga0495665_0004571
667 Ga0495665_0169553
668 Ga0495640_0028551
669 Ga0495586_0017311
670 Ga0495587_0075487
671 Ga0495597_0006986
672 Ga0495597_0032611
673 Ga0495645_0010118
674 Ga0495645_0056078
675 Ga0495622_0014268
676 Ga0495633_0037858
677 Ga0495667_0025415
678 Ga0495634_0008018
679 Ga0495634_0028789
680 Ga0495634_0037933
681 Ga0495611_0008966
682 Ga0495611_0043215
683 Ga0495625_0094199
684 Ga0495625_0113144
685 Ga0495635_0000648
686 Ga0495635_0024636
687 Ga0495635_0042997
688 Ga0495635_0169102
689 Ga0495588_0006650
690 Ga0495588_0016746
691 Ga0495588_0019249
692 Ga0495657_0001640
693 Ga0495657_0005579
694 Ga0495657_0024626
695 Ga0495599_0086473
696 Ga0495623_0013590
697 Ga0495623_0056909
698 Ga0495646_0000297
699 Ga0495646_0032218
700 Ga0495658_0015419
701 Ga0495658_0031812
702 Ga0495613_0001356
703 Ga0495613_0009671
704 Ga0495613_0035126
705 Ga0495613_0049126
706 Ga0495613_0060409
707 Ga0495613_0068938
708 Ga0495613_0106844
709 Ga0495624_0019111
710 Ga0495624_0062354
711 Ga0495670_0060874
712 Ga0495649_0019333
713 Ga0495589_0004130
714 Ga0495589_0013574
715 Ga0495589_0013722
716 Ga0495589_0036514
717 Ga0495600_0054352
718 Ga0495660_0016997
719 Ga0495660_0035073
720 Ga0495581_0001876
721 Ga0495581_0014811
722 Ga0495581_0025805
723 Ga0495604_0071911
724 Ga0495604_0090784
725 Ga0495604_0155935
726 Ga0495636_0000860
727 Ga0495636_0001020
728 Ga0495636_0010021
729 Ga0495674_0310530
730 Ga0495676_0000404
731 Ga0495676_0000494
732 Ga0495676_0015864
733 Ga0495676_0041539
734 Ga0495676_0094650
735 Ga0495676_0104367
736 Ga0495680_0002821
737 Ga0495683_0042252
738 Ga0495687_008924
739 Ga0495687_013993
740 Ga0495687_052818
741 Ga0495687_068073
742 Ga0495675_0004219
743 Ga0495675_0012998
744 Ga0495685_000235
745 Ga0495685_001771
746 Ga0495685_006838
747 Ga0495685_048189
748 Ga0495681_0000676
749 Ga0495681_0001189
750 Ga0495681_0019088
751 Ga0495686_0021689
752 Ga0495686_0183313
753 Ga0495593_0004137
754 Ga0495593_0039260
755 Ga0495593_0047416
756 Ga0495593_0087858
757 Ga0495614_0000337
758 Ga0495614_0002612
759 Ga0495614_0060418
760 Ga0496102_0450854
761 Ga0496108_0172830
762 Ga0496109_0035520
763 Ga0496117_0000276
764 Ga0496122_0008214
765 Ga0496123_0017929
766 Ga0501032_0061523
767 Ga0501033_0003576
768 Ga0501033_0073894
769 Ga0501034_0034166
770 Ga0501034_0072473
771 Ga0501036_0003584
772 Ga0501036_0007621
773 Ga0501036_0041207
774 Ga0501037_0015657
775 Ga0501039_0012959
776 Ga0501043_0007474
777 Ga0501043_0174812
778 Ga0501043_0225811
779 Ga0501047_0036291
780 Ga0501047_0061566
781 Ga0501047_0082519
782 Ga0501047_0159778
783 Ga0501047_0253451
784 Ga0501048_0152638
785 Ga0501068_0041854
786 Ga0501070_0001738
787 Ga0501070_0096140
788 Ga0501070_0159889
789 Ga0501070_0232627
790 Ga0501073_0040737
791 Ga0501074_0004238
792 Ga0501080_0057428
793 Ga0501035_0077635
794 Ga0501035_0100076
795 Ga0501035_0105372
796 Ga0501044_0004053
797 Ga0501044_0038903
798 Ga0501044_0097001
799 Ga0501044_0218613
800 Ga0501044_0223746
801 Ga0501045_0051545
802 Ga0501045_0266313
803 nmdc:mga06z11_1768_c1
804 Ga0495601_0143261
805 Ga0495619_0012889
806 Ga0495619_0018256
807 Ga0500640_001595
808 Ga0500660_067085
809 Ga0500553_044667
810 Ga0500560_021322
811 Ga0500560_035357
812 Ga0500569_000261
813 Ga0500573_0021282
814 Ga0500600_0045495
815 Ga0500616_0000152
816 Ga0500633_0003006
817 Ga0500634_0031852
818 Ga0500634_0102913
819 Ga0500645_004945
820 Ga0500656_001298
821 Ga0501082_0257842
822 Ga0466962_0003448
823 Ga0466962_0006149
824 Ga0466962_0041249
825 2547407952
826 2554258647
827 2585301358
828 2585304900
829 2585318956
830 2586063178
831 2616701810
832 2616899829
833 2643759701
834 2643897818
835 2643944735
836 2644269193
837 2644385335
838 2644408963
839 2644431633
840 2644436313
841 2644462884
842 2644625825
843 2753070474
844 2776376143
845 2784587814
846 2785368519
847 2786669540
848 2804844829
849 2808841210
850 2808919724
851 2809231397
852 2809587677
853 2811848216
854 2812359046
855 2812481288
856 2819693727
857 2862182546
858 2862288208
859 2862296944
860 2862384637
861 2862513382
862 2862580050
863 2863068485
864 2863405585
865 2866556065
866 2867371038
867 2867429353
868 2867480901
869 2870729694
870 2873156613
871 2875393739
872 2877682014
873 2891331296
874 2899362964
875 2904769523
876 2904773088
877 2908814080
878 2912720977
879 2912725066
880 2912759872
881 2917737272
882 2918503765
883 2919422554
884 2919435193
885 2919468611
886 2946050923
887 2946066832
888 2946075158
889 2947230397
890 2954003726
891 2954387132
892 2954676030
893 2954688135
894 2954697962
895 2954704254
896 2954717082
897 2954727052
898 2954734751
899 2954745954
900 2954753637
901 2954764925
902 2966603344
903 2990061947
904 2990090481
905 2997456500
906 2997608217
907 3003002391
908 3006501007
909 8003318358
910 8008559492
911 8008579672
912 8023628136
913 8025419272
914 8025480151
915 8025535175
916 8047711544
917 8048408440
918 8053951643
919 8054165197
920 8056453561
921 8056836884
922 8057347146

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03060

NMO

Nitronate monooxygenase

29

370

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bw4-assembly1.cif.gz_A-2 crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes 0.9916 3 351
3bw2-assembly1.cif.gz_A-2 crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes 0.9916 3 351
3bw3-assembly1.cif.gz_A-2 crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes 0.991 3 350
3bw4-assembly1.cif.gz_A-2 crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes 0.9859 3 351
3bw2-assembly1.cif.gz_A-2 crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes 0.9859 3 351
ID Description Score Start End Superfamily
3bw4A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9916 3 351 3.20.20.70
3bw4A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9859 3 351 3.20.20.70
af_I6X5C5_6_344_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9788 8 341 3.20.20.70
af_I6X5C5_6_344_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.956 8 341 3.20.20.70
af_Q2FZX9_3_354_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9446 1 349 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6G3X0M6-F1-model_v4 Propionate 3-nitronate monooxygenase 1.001 216 343 GO:0009636
GO:0018580
AF-A0A6B3HRN9-F1-model_v4 Propionate 3-nitronate monooxygenase 1 167 266 GO:0009636
GO:0018580
AF-B5H0H4-F1-model_v4 deleted 0.9971 51 350
AF-A0A1G5JAG4-F1-model_v4 Propionate 3-nitronate monooxygenase 0.997 209 356 GO:0009636
GO:0018580
AF-A0A0N1KGZ9-F1-model_v4 deleted 0.9969 127 347

Map