F448696

General Info

Members Datasets Scaffolds Average Seq Length
461 156 461 197

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100242282|Ga0068855_1002422822
Length 202
Sequence MTRRMPIVPTIIVVAAVALMVWLGFWQLRRAHENERLLAQYHAAAKLPPISYPVGPIKGPLPLFRWASGFCPKVTGQREAAGRNRNGDVGWAHIVDCAIGPGGMGMSVELGWSEDPNRKVSWSGGLVSGVIVPDRLHQIRLVAAAAPAGLDPAGLPSVENAVPVTPGRNRMYALQWFSFAAIALLIYVLAVRKKWREERRKS

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 6.51
Rhizosphere 92.84
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1004228 3300001915 Bacteria 3226
2 JGI24740J21852_10011719 3300001979 Bacteria 3330
3 JGI24737J22298_10015575 3300001990 Bacteria 2461
4 JGI24735J21928_10011796 3300002067 Bacteria 2767
5 rootH1_10018332 3300003316 Bacteria 1499
6 rootL2_10247766 3300003322 Bacteria 1179
7 Ga0070658_10017721 3300005327 Bacteria 5696
8 Ga0070658_10032345 3300005327 Bacteria 4206
9 Ga0070658_10076859 3300005327 Bacteria 2738
10 Ga0070658_10198934 3300005327 Bacteria 1690
11 Ga0070658_10245805 3300005327 Bacteria 1517
12 Ga0070676_10229238 3300005328 Bacteria 1230
13 Ga0070683_100352945 3300005329 Bacteria 1400
14 Ga0070683_100406504 3300005329 Bacteria 1298
15 Ga0070683_100729762 3300005329 Bacteria 949
16 Ga0070690_100009956 3300005330 Bacteria 5516
17 Ga0070670_100027209 3300005331 Bacteria 4919
18 Ga0070670_100036244 3300005331 Bacteria 4245
19 Ga0070670_100088561 3300005331 Bacteria 2661
20 Ga0070670_100202292 3300005331 Bacteria 1726
21 Ga0070670_100780268 3300005331 Unclassified 862
22 Ga0068869_100145876 3300005334 Bacteria 1832
23 Ga0070666_10006211 3300005335 Bacteria 7350
24 Ga0070666_10800629 3300005335 Unclassified 694
25 Ga0070680_100002339 3300005336 Bacteria 14005
26 Ga0070680_100110820 3300005336 Bacteria 2285
27 Ga0070680_100398130 3300005336 Bacteria 1174
28 Ga0068868_100091424 3300005338 Bacteria 2452
29 Ga0068868_100378999 3300005338 Bacteria 1217
30 Ga0070660_100010776 3300005339 Bacteria 6471
31 Ga0070660_100024355 3300005339 Bacteria 4489
32 Ga0070660_100295657 3300005339 Bacteria 1327
33 Ga0070660_100491490 3300005339 Bacteria 1020
34 Ga0070687_100035373 3300005343 Bacteria 2480
35 Ga0070661_100006896 3300005344 Bacteria 7837
36 Ga0070661_100094169 3300005344 Bacteria 2219
37 Ga0070661_100112088 3300005344 Bacteria 2038
38 Ga0070661_100466648 3300005344 Archaea 1006
39 Ga0070692_10048347 3300005345 Bacteria 2203
40 Ga0070692_10134100 3300005345 Bacteria 1395
41 Ga0070668_100993381 3300005347 Bacteria 754
42 Ga0070669_100027852 3300005353 Bacteria 4068
43 Ga0070669_100044551 3300005353 Bacteria 3232
44 Ga0070675_100011423 3300005354 Bacteria 6950
45 Ga0070675_100051701 3300005354 Bacteria 3377
46 Ga0070671_100005172 3300005355 Bacteria 10388
47 Ga0070671_100006087 3300005355 Bacteria 9612
48 Ga0070671_100018146 3300005355 Bacteria 5713
49 Ga0070671_100025631 3300005355 Bacteria 4840
50 Ga0070671_100075000 3300005355 Bacteria 2825
51 Ga0070671_100087416 3300005355 Bacteria 2608
52 Ga0070671_100129706 3300005355 Bacteria 2123
53 Ga0070671_100933703 3300005355 Bacteria 759
54 Ga0070674_100003944 3300005356 Bacteria 8403
55 Ga0070673_100014589 3300005364 Bacteria 5481
56 Ga0070673_100023528 3300005364 Bacteria 4502
57 Ga0070673_100106228 3300005364 Bacteria 2321
58 Ga0070673_100162215 3300005364 Bacteria 1902
59 Ga0070673_100433834 3300005364 Bacteria 1180
60 Ga0070673_100531305 3300005364 Bacteria 1067
61 Ga0070659_100031866 3300005366 Bacteria 4086
62 Ga0070659_100072982 3300005366 Bacteria 2731
63 Ga0070659_100097596 3300005366 Bacteria 2362
64 Ga0070659_100229220 3300005366 Bacteria 1535
65 Ga0070659_100292973 3300005366 Bacteria 1356
66 Ga0070659_100304595 3300005366 Bacteria 1329
67 Ga0070659_100810183 3300005366 Unclassified 815
68 Ga0070659_100854964 3300005366 Bacteria 793
69 Ga0070667_100009715 3300005367 Bacteria 7974
70 Ga0070667_100015073 3300005367 Bacteria 6386
71 Ga0070667_100115962 3300005367 Bacteria 2326
72 Ga0070667_100154242 3300005367 Bacteria 2019
73 Ga0070667_100236408 3300005367 Bacteria 1630
74 Ga0070667_100824867 3300005367 Bacteria 862
75 Ga0070663_100028963 3300005455 Bacteria 3777
76 Ga0070663_100048766 3300005455 Bacteria 3004
77 Ga0070663_101036232 3300005455 Unclassified 715
78 Ga0070662_100051693 3300005457 Bacteria 2968
79 Ga0070662_100069302 3300005457 Bacteria 2595
80 Ga0070662_100196376 3300005457 Bacteria 1598
81 Ga0070662_100266385 3300005457 Bacteria 1382
82 Ga0070662_100355716 3300005457 Bacteria 1201
83 Ga0070679_100199670 3300005530 Bacteria 1966
84 Ga0070679_100466702 3300005530 Bacteria 1207
85 Ga0070679_100502407 3300005530 Bacteria 1156
86 Ga0070684_100437900 3300005535 Bacteria 1207
87 Ga0068853_100051418 3300005539 Bacteria 3546
88 Ga0068853_100053328 3300005539 Bacteria 3483
89 Ga0068853_100086528 3300005539 Bacteria 2749
90 Ga0068853_100707001 3300005539 Bacteria 962
91 Ga0070672_100499886 3300005543 Bacteria 1052
92 Ga0070686_100155418 3300005544 Bacteria 1605
93 Ga0070665_100023752 3300005548 Bacteria 6175
94 Ga0070665_100347359 3300005548 Bacteria 1489
95 Ga0070665_100633538 3300005548 Bacteria 1082
96 Ga0068855_100035666 3300005563 Bacteria 5923
97 Ga0068855_100242282 3300005563 Bacteria 2014
98 Ga0068855_100368981 3300005563 Bacteria 1578
99 Ga0068855_100457211 3300005563 Bacteria 1392
100 Ga0070664_100004835 3300005564 Bacteria 10793
101 Ga0070664_100014969 3300005564 Bacteria 6330
102 Ga0070664_100024181 3300005564 Bacteria 5023
103 Ga0070664_100041277 3300005564 Bacteria 3893
104 Ga0070664_100071046 3300005564 Bacteria 2982
105 Ga0070664_100074367 3300005564 Bacteria 2916
106 Ga0070664_100170729 3300005564 Bacteria 1929
107 Ga0070664_100226493 3300005564 Bacteria 1674
108 Ga0070664_100238847 3300005564 Bacteria 1631
109 Ga0068857_100056710 3300005577 Bacteria 3476
110 Ga0068857_100332981 3300005577 Bacteria 1403
111 Ga0068854_100047178 3300005578 Bacteria 3069
112 Ga0068854_100120404 3300005578 Bacteria 1992
113 Ga0068854_100188758 3300005578 Bacteria 1614
114 Ga0068854_100415002 3300005578 Bacteria 1117
115 Ga0068856_100065488 3300005614 Bacteria 3591
116 Ga0068856_100078493 3300005614 Bacteria 3273
117 Ga0068856_100182940 3300005614 Bacteria 2109
118 Ga0068852_100040686 3300005616 Bacteria 3923
119 Ga0068852_100046036 3300005616 Bacteria 3714
120 Ga0068852_100085648 3300005616 Bacteria 2808
121 Ga0068852_100162297 3300005616 Bacteria 2088
122 Ga0068852_100316078 3300005616 Bacteria 1515
123 Ga0068852_100526787 3300005616 Bacteria 1180
124 Ga0068859_100001678 3300005617 Bacteria 22539
125 Ga0068859_100037436 3300005617 Bacteria 4868
126 Ga0068859_100041180 3300005617 Bacteria 4640
127 Ga0068859_100354360 3300005617 Bacteria 1562
128 Ga0068864_100001178 3300005618 Bacteria 21779
129 Ga0068864_100009260 3300005618 Bacteria 8119
130 Ga0068864_100018705 3300005618 Bacteria 5789
131 Ga0068864_100033226 3300005618 Bacteria 4385
132 Ga0068864_100079811 3300005618 Bacteria 2866
133 Ga0068864_100102892 3300005618 Bacteria 2535
134 Ga0068866_10076239 3300005718 Bacteria 1788
135 Ga0068851_10034280 3300005834 Bacteria 2533
136 Ga0068851_10056006 3300005834 Bacteria 2010
137 Ga0068851_10058548 3300005834 Bacteria 1969
138 Ga0068863_100001789 3300005841 Bacteria 21336
139 Ga0068863_100001894 3300005841 Bacteria 20763
140 Ga0068863_100024293 3300005841 Bacteria 5780
141 Ga0068863_100034196 3300005841 Bacteria 4842
142 Ga0068863_100057814 3300005841 Bacteria 3670
143 Ga0068858_100012230 3300005842 Bacteria 8093
144 Ga0068858_100025351 3300005842 Bacteria 5518
145 Ga0068858_100053896 3300005842 Bacteria 3719
146 Ga0068858_100077505 3300005842 Bacteria 3088
147 Ga0068858_100747159 3300005842 Bacteria 953
148 Ga0068860_100003488 3300005843 Bacteria 16188
149 Ga0068860_100037295 3300005843 Bacteria 4653
150 Ga0068860_100100112 3300005843 Bacteria 2765
151 Ga0068860_101006038 3300005843 Bacteria 852
152 Ga0068862_100016644 3300005844 Bacteria 6122
153 Ga0068862_100073429 3300005844 Bacteria 2956
154 Ga0068862_100500235 3300005844 Bacteria 1153
155 Ga0097621_100125975 3300006237 Bacteria 2175
156 Ga0097621_100338360 3300006237 Bacteria 1336
157 Ga0097621_100454916 3300006237 Bacteria 1154
158 Ga0068871_100751877 3300006358 Bacteria 896
159 Ga0097620_100001678 3300006931 Bacteria 22539
160 Ga0097620_100037436 3300006931 Bacteria 4868
161 Ga0097620_100041181 3300006931 Bacteria 4640
162 Ga0097620_100354365 3300006931 Bacteria 1562
163 Ga0105250_10011922 3300009092 Bacteria 3601
164 Ga0105240_10264610 3300009093 Bacteria 1982
165 Ga0105245_10306003 3300009098 Bacteria 1561
166 Ga0105247_10432486 3300009101 Bacteria 945
167 Ga0105243_10281825 3300009148 Bacteria 1497
168 Ga0105241_10370339 3300009174 Bacteria 1249
169 Ga0105248_10000862 3300009177 Bacteria 34132
170 Ga0105248_10001135 3300009177 Bacteria 29633
171 Ga0105248_10023597 3300009177 Bacteria 6833
172 Ga0105248_10240392 3300009177 Bacteria 2038
173 Ga0105248_10253285 3300009177 Bacteria 1981
174 Ga0105248_10289274 3300009177 Bacteria 1845
175 Ga0105248_10447346 3300009177 Bacteria 1456
176 Ga0105237_10054857 3300009545 Bacteria 3992
177 Ga0105249_10057772 3300009553 Bacteria 3555
178 Ga0105249_10106875 3300009553 Bacteria 2641
179 Ga0157373_10025749 3300013100 Bacteria 4252
180 Ga0157373_10093248 3300013100 Bacteria 2121
181 Ga0157373_10127567 3300013100 Bacteria 1789
182 Ga0157373_10358603 3300013100 Bacteria 1041
183 Ga0157371_10116998 3300013102 Bacteria 1895
184 Ga0157371_10174995 3300013102 Bacteria 1534
185 Ga0157371_10211452 3300013102 Bacteria 1392
186 Ga0157370_10180667 3300013104 Bacteria 1961
187 Ga0157370_10186608 3300013104 Bacteria 1925
188 Ga0157370_10400083 3300013104 Bacteria 1264
189 Ga0157369_10130216 3300013105 Bacteria 2667
190 Ga0157369_10207062 3300013105 Bacteria 2057
191 Ga0157369_10254866 3300013105 Bacteria 1831
192 Ga0157378_10326952 3300013297 Bacteria 1491
193 Ga0157378_11824755 3300013297 Bacteria 656
194 Ga0157372_10346445 3300013307 Bacteria 1731
195 Ga0157372_10453596 3300013307 Bacteria 1494
196 Ga0157372_10689072 3300013307 Bacteria 1189
197 Ga0157372_10954957 3300013307 Bacteria 994
198 Ga0157375_10474675 3300013308 Bacteria 1416
199 Ga0157375_10698445 3300013308 Bacteria 1168
200 Ga0163163_10000735 3300014325 Bacteria 27886
201 Ga0163163_10629432 3300014325 Bacteria 1136
202 Ga0163163_11377211 3300014325 Bacteria 767
203 Ga0163163_11517438 3300014325 Unclassified 731
204 Ga0157379_10015840 3300014968 Bacteria 6625
205 Ga0157379_10154210 3300014968 Bacteria 2072
206 Ga0163161_10360430 3300017792 Bacteria 1158
207 Ga0206354_10455799 3300020081 Bacteria 1115
208 Ga0206353_10968963 3300020082 Bacteria 998
209 Ga0206353_11626991 3300020082 Bacteria 2339
210 Ga0207656_10079373 3300025321 Bacteria 1472
211 Ga0207642_10057180 3300025899 Bacteria 1793
212 Ga0207680_10001446 3300025903 Bacteria 11267
213 Ga0207645_10132729 3300025907 Bacteria 1621
214 Ga0207645_10282813 3300025907 Bacteria 1102
215 Ga0207705_10002265 3300025909 Bacteria 14887
216 Ga0207705_10003743 3300025909 Bacteria 11585
217 Ga0207705_10019462 3300025909 Bacteria 4855
218 Ga0207705_10025904 3300025909 Bacteria 4185
219 Ga0207705_10032412 3300025909 Bacteria 3734
220 Ga0207705_10033760 3300025909 Bacteria 3656
221 Ga0207705_10046611 3300025909 Bacteria 3115
222 Ga0207705_10052347 3300025909 Bacteria 2939
223 Ga0207705_10153644 3300025909 Bacteria 1726
224 Ga0207705_10371619 3300025909 Bacteria 1104
225 Ga0207707_10007637 3300025912 Bacteria 9422
226 Ga0207707_10189760 3300025912 Bacteria 1793
227 Ga0207660_10007321 3300025917 Bacteria 7142
228 Ga0207660_10137599 3300025917 Bacteria 1865
229 Ga0207660_10273645 3300025917 Bacteria 1338
230 Ga0207657_10008735 3300025919 Bacteria 10253
231 Ga0207657_10009638 3300025919 Bacteria 9691
232 Ga0207657_10024747 3300025919 Bacteria 5550
233 Ga0207657_10037175 3300025919 Bacteria 4352
234 Ga0207657_10041687 3300025919 Bacteria 4057
235 Ga0207657_10109833 3300025919 Bacteria 2278
236 Ga0207657_10221566 3300025919 Bacteria 1515
237 Ga0207657_10518379 3300025919 Bacteria 933
238 Ga0207649_10031541 3300025920 Bacteria 3151
239 Ga0207649_10084289 3300025920 Bacteria 2066
240 Ga0207649_10182634 3300025920 Bacteria 1469
241 Ga0207652_10063613 3300025921 Bacteria 3191
242 Ga0207652_10183569 3300025921 Bacteria 1880
243 Ga0207652_10432776 3300025921 Bacteria 1186
244 Ga0207681_10023803 3300025923 Bacteria 3922
245 Ga0207681_10156227 3300025923 Bacteria 1714
246 Ga0207650_10011484 3300025925 Bacteria 6096
247 Ga0207650_10648936 3300025925 Unclassified 890
248 Ga0207659_10006899 3300025926 Bacteria 6982
249 Ga0207659_10037139 3300025926 Bacteria 3380
250 Ga0207644_10000747 3300025931 Bacteria 20633
251 Ga0207644_10005487 3300025931 Bacteria 8258
252 Ga0207644_10010759 3300025931 Bacteria 6035
253 Ga0207644_10012501 3300025931 Bacteria 5641
254 Ga0207644_10036429 3300025931 Bacteria 3453
255 Ga0207644_10055447 3300025931 Bacteria 2856
256 Ga0207644_10071448 3300025931 Bacteria 2539
257 Ga0207644_10181310 3300025931 Bacteria 1651
258 Ga0207644_10532254 3300025931 Bacteria 971
259 Ga0207644_10595148 3300025931 Bacteria 918
260 Ga0207690_10041458 3300025932 Bacteria 3017
261 Ga0207690_10047137 3300025932 Bacteria 2858
262 Ga0207690_10058978 3300025932 Bacteria 2599
263 Ga0207690_10072570 3300025932 Bacteria 2377
264 Ga0207690_10141672 3300025932 Bacteria 1772
265 Ga0207690_10230418 3300025932 Bacteria 1422
266 Ga0207690_10307280 3300025932 Bacteria 1243
267 Ga0207690_10601140 3300025932 Bacteria 898
268 Ga0207690_10694145 3300025932 Bacteria 836
269 Ga0207706_10094633 3300025933 Bacteria 2628
270 Ga0207706_10095766 3300025933 Bacteria 2611
271 Ga0207706_10102586 3300025933 Bacteria 2517
272 Ga0207706_10426631 3300025933 Bacteria 1148
273 Ga0207706_10550896 3300025933 Bacteria 993
274 Ga0207669_10016923 3300025937 Bacteria 3724
275 Ga0207691_10263907 3300025940 Bacteria 1484
276 Ga0207691_10477144 3300025940 Bacteria 1060
277 Ga0207711_10000213 3300025941 Bacteria 62174
278 Ga0207711_10000344 3300025941 Bacteria 49354
279 Ga0207711_10028323 3300025941 Bacteria 4713
280 Ga0207711_10349126 3300025941 Bacteria 1370
281 Ga0207711_10431466 3300025941 Bacteria 1226
282 Ga0207689_10047301 3300025942 Bacteria 3553
283 Ga0207689_10062089 3300025942 Bacteria 3073
284 Ga0207661_10051264 3300025944 Bacteria 3292
285 Ga0207661_10282739 3300025944 Bacteria 1483
286 Ga0207679_10008749 3300025945 Bacteria 6458
287 Ga0207679_10030499 3300025945 Bacteria 3766
288 Ga0207679_10063088 3300025945 Bacteria 2764
289 Ga0207679_10073218 3300025945 Bacteria 2591
290 Ga0207679_10127994 3300025945 Bacteria 2033
291 Ga0207679_10140372 3300025945 Bacteria 1952
292 Ga0207679_10387508 3300025945 Bacteria 1226
293 Ga0207667_10095127 3300025949 Bacteria 3075
294 Ga0207667_10127777 3300025949 Bacteria 2618
295 Ga0207651_10030292 3300025960 Bacteria 3443
296 Ga0207651_10108957 3300025960 Bacteria 2074
297 Ga0207651_10642262 3300025960 Bacteria 931
298 Ga0207651_11118758 3300025960 Bacteria 706
299 Ga0207712_10010115 3300025961 Bacteria 5982
300 Ga0207668_10219402 3300025972 Bacteria 1526
301 Ga0207640_10053777 3300025981 Bacteria 2630
302 Ga0207640_10061021 3300025981 Bacteria 2495
303 Ga0207640_10108592 3300025981 Bacteria 1961
304 Ga0207640_10119729 3300025981 Bacteria 1883
305 Ga0207658_10034627 3300025986 Bacteria 3610
306 Ga0207658_10053067 3300025986 Bacteria 2993
307 Ga0207658_10075177 3300025986 Bacteria 2569
308 Ga0207658_10298262 3300025986 Bacteria 1387
309 Ga0207677_10133789 3300026023 Bacteria 1887
310 Ga0207703_10007259 3300026035 Bacteria 8812
311 Ga0207703_10022069 3300026035 Bacteria 4988
312 Ga0207703_10023978 3300026035 Bacteria 4800
313 Ga0207703_10148668 3300026035 Bacteria 2040
314 Ga0207639_10065566 3300026041 Bacteria 2820
315 Ga0207639_10080850 3300026041 Bacteria 2572
316 Ga0207639_10169354 3300026041 Bacteria 1848
317 Ga0207639_10446153 3300026041 Bacteria 1174
318 Ga0207678_10009554 3300026067 Bacteria 8531
319 Ga0207678_10059916 3300026067 Bacteria 3275
320 Ga0207678_10068950 3300026067 Bacteria 3033
321 Ga0207678_10074022 3300026067 Bacteria 2918
322 Ga0207678_10111796 3300026067 Bacteria 2330
323 Ga0207678_10275392 3300026067 Unclassified 1444
324 Ga0207702_10069157 3300026078 Bacteria 3035
325 Ga0207702_10164400 3300026078 Bacteria 2029
326 Ga0207702_10172131 3300026078 Bacteria 1986
327 Ga0207641_10001671 3300026088 Bacteria 21575
328 Ga0207641_10017477 3300026088 Bacteria 5871
329 Ga0207641_10068990 3300026088 Bacteria 3033
330 Ga0207641_10175075 3300026088 Bacteria 1961
331 Ga0207641_10255155 3300026088 Bacteria 1639
332 Ga0207676_10001683 3300026095 Bacteria 16306
333 Ga0207676_10002153 3300026095 Bacteria 14229
334 Ga0207676_10009605 3300026095 Bacteria 6886
335 Ga0207676_10025079 3300026095 Bacteria 4422
336 Ga0207676_10050724 3300026095 Bacteria 3237
337 Ga0207674_10001507 3300026116 Bacteria 30052
338 Ga0207674_10003513 3300026116 Bacteria 19141
339 Ga0207674_10015063 3300026116 Bacteria 8516
340 Ga0207698_10006430 3300026142 Bacteria 7334
341 Ga0207698_10163437 3300026142 Bacteria 1950
342 Ga0207698_10502487 3300026142 Bacteria 1180
343 Ga0207698_10905377 3300026142 Bacteria 889
344 Ga0268266_10020162 3300028379 Bacteria 5683
345 Ga0268266_10511991 3300028379 Bacteria 1147
346 Ga0268265_10007667 3300028380 Bacteria 7284
347 Ga0268265_10019944 3300028380 Bacteria 4670
348 Ga0268265_10414827 3300028380 Bacteria 1248
349 Ga0268264_10002330 3300028381 Bacteria 16791
350 Ga0373940_0062319 3300035088 Bacteria 1069
351 Ga0373941_0219899 3300035115 Unclassified 730
352 Ga0395899_0013002 3300037312 Bacteria 6369
353 Ga0395899_0263707 3300037312 Bacteria 1177
354 Ga0395900_0001571 3300037418 Bacteria 27038
355 Ga0395900_0043887 3300037418 Bacteria 4608
356 Ga0395900_0198622 3300037418 Bacteria 2030
357 Ga0395900_0415991 3300037418 Bacteria 1306
358 Ga0395900_0553697 3300037418 Bacteria 1094
359 Ga0395898_0127223 3300037466 Bacteria 2441
360 Ga0395898_0358657 3300037466 Bacteria 1390
361 Ga0395898_0642333 3300037466 Bacteria 1004
362 Ga0395898_0685576 3300037466 Unclassified 967
363 Ga0395905_0000104 3300037471 Bacteria 141965
364 Ga0395905_0033324 3300037471 Bacteria 4839
365 Ga0395905_0036601 3300037471 Bacteria 4609
366 Ga0395905_0165485 3300037471 Bacteria 2078
367 Ga0395901_0015662 3300038443 Bacteria 7723
368 Ga0395901_0088538 3300038443 Bacteria 3238
369 Ga0395901_0093226 3300038443 Bacteria 3153
370 Ga0395901_0178739 3300038443 Bacteria 2225
371 Ga0395901_0222797 3300038443 Bacteria 1971
372 Ga0395901_0867941 3300038443 Bacteria 886
373 Ga0466969_0029825 3300044656 Bacteria 2783
374 Ga0466972_0053000 3300044658 Bacteria 1954
375 Ga0466972_0168047 3300044658 Bacteria 1030
376 Ga0466966_0129599 3300044684 Bacteria 1545
377 Ga0466966_0130108 3300044684 Bacteria 1542
378 Ga0466966_0224016 3300044684 Bacteria 1135
379 Ga0466966_0246149 3300044684 Bacteria 1077
380 Ga0466961_0007193 3300044693 Bacteria 7080
381 Ga0466961_0036169 3300044693 Bacteria 3169
382 Ga0466961_0103274 3300044693 Bacteria 1795
383 Ga0466961_0711599 3300044693 Unclassified 601
384 Ga0466963_0017697 3300044694 Bacteria 4445
385 Ga0466963_0051136 3300044694 Bacteria 2738
386 Ga0466963_0052846 3300044694 Bacteria 2696
387 Ga0466963_0056367 3300044694 Bacteria 2615
388 Ga0466963_0082272 3300044694 Bacteria 2182
389 Ga0466963_0165852 3300044694 Bacteria 1538
390 Ga0466964_0004778 3300044706 Bacteria 5010
391 Ga0466964_0052307 3300044706 Bacteria 1679
392 Ga0466971_0070527 3300044719 Bacteria 1587
393 Ga0466971_0088758 3300044719 Bacteria 1414
394 Ga0466968_0002423 3300044735 Bacteria 6841
395 Ga0466970_0019719 3300044765 Bacteria 3498
396 Ga0466970_0035293 3300044765 Bacteria 2649
397 Ga0466970_0182710 3300044765 Bacteria 1164
398 Ga0466957_0001422 3300044842 Bacteria 12499
399 Ga0466957_0047644 3300044842 Bacteria 2604
400 Ga0466957_0052952 3300044842 Bacteria 2473
401 Ga0466959_0005408 3300045049 Bacteria 8740
402 Ga0466959_0339157 3300045049 Bacteria 1025
403 Ga0466959_0435186 3300045049 Bacteria 890
404 Ga0466958_0002868 3300045836 Bacteria 8783
405 Ga0466967_0130257 3300045976 Bacteria 2334
406 Ga0466967_0155832 3300045976 Bacteria 2139
407 Ga0466967_0199503 3300045976 Bacteria 1894
408 Ga0466967_0240066 3300045976 Bacteria 1728
409 Ga0466967_0493168 3300045976 Bacteria 1201
410 Ga0466967_0493941 3300045976 Bacteria 1200
411 Ga0466967_1199143 3300045976 Unclassified 756
412 Ga0495629_0315136 3300046459 Unclassified 1070
413 Ga0495642_0022491 3300046528 Bacteria 2485
414 Ga0495598_0000235 3300046537 Bacteria 9904
415 Ga0495633_0017029 3300046558 Bacteria 3728
416 Ga0495668_0010948 3300046616 Bacteria 5460
417 Ga0495668_0027367 3300046616 Bacteria 3231
418 Ga0495668_0043338 3300046616 Bacteria 2503
419 Ga0495669_0004858 3300046684 Bacteria 5575
420 Ga0495669_0005373 3300046684 Bacteria 5341
421 Ga0495669_0009099 3300046684 Bacteria 4186
422 Ga0495669_0010841 3300046684 Bacteria 3859
423 Ga0495669_0019311 3300046684 Bacteria 2941
424 Ga0495669_0030453 3300046684 Bacteria 2369
425 Ga0495669_0056786 3300046684 Bacteria 1765
426 Ga0495669_0292518 3300046684 Unclassified 784
427 Ga0495670_0005232 3300046691 Bacteria 6383
428 Ga0495677_0032211 3300047445 Bacteria 1909
429 Ga0496100_0109983 3300048903 Bacteria 1913
430 Ga0496101_0028175 3300048904 Bacteria 3920
431 Ga0496101_0267514 3300048904 Bacteria 1334
432 Ga0496102_0073280 3300048905 Bacteria 3148
433 Ga0496103_0018532 3300048906 Bacteria 4176
434 Ga0496105_0199448 3300048908 Bacteria 1634
435 Ga0496106_0028752 3300048909 Bacteria 4141
436 Ga0496106_0460243 3300048909 Bacteria 1022
437 Ga0496107_0009925 3300048910 Bacteria 6607
438 Ga0496107_0031289 3300048910 Bacteria 3796
439 Ga0496108_0014931 3300048911 Bacteria 6338
440 Ga0496108_0021559 3300048911 Bacteria 5293
441 Ga0496108_0022658 3300048911 Bacteria 5166
442 Ga0496108_0198997 3300048911 Bacteria 1738
443 Ga0496109_0023306 3300048912 Bacteria 5492
444 Ga0496109_0184565 3300048912 Bacteria 1960
445 Ga0496109_0248996 3300048912 Bacteria 1673
446 Ga0496109_0672678 3300048912 Bacteria 972
447 Ga0496109_1055829 3300048912 Bacteria 750
448 Ga0496110_0010682 3300048913 Bacteria 7477
449 Ga0496110_0100447 3300048913 Bacteria 2593
450 Ga0496110_0164964 3300048913 Bacteria 2009
451 Ga0496110_0327497 3300048913 Bacteria 1395
452 Ga0496111_0002231 3300048914 Bacteria 11626
453 Ga0496111_0028798 3300048914 Bacteria 3938
454 Ga0496112_0023946 3300048915 Bacteria 5841
455 Ga0496112_0049534 3300048915 Bacteria 4118
456 Ga0496112_0090453 3300048915 Bacteria 3029
457 Ga0496113_0020228 3300048916 Bacteria 4675
458 Ga0496113_0125394 3300048916 Bacteria 2010
459 Ga0500658_0000036 3300053134 Bacteria 85304
460 Ga0466962_0009093 3300061719 Bacteria 4758
461 Ga0466962_0076200 3300061719 Bacteria 1603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0155832 Ga0466967_0155832_16_513 161
2 3300044684 Ga0466966_0246149 Ga0466966_0246149_531_1067 178
3 3300044693 Ga0466961_0711599 Ga0466961_0711599_46_585 179
4 3300046684 Ga0495669_0005373 Ga0495669_0005373_831_1370 179
5 3300048904 Ga0496101_0267514 Ga0496101_0267514_303_842 179
6 3300061719 Ga0466962_0076200 Ga0466962_0076200_242_835 184
7 3300044693 Ga0466961_0103274 Ga0466961_0103274_656_1213 185
8 3300044694 Ga0466963_0017697 Ga0466963_0017697_1317_1913 185
9 3300044719 Ga0466971_0070527 Ga0466971_0070527_763_1359 185
10 3300025933 Ga0207706_10550896 Ga0207706_105508962 186
11 3300005548 Ga0070665_100023752 Ga0070665_1000237528 187
12 3300005843 Ga0068860_100100112 Ga0068860_1001001122 187
13 3300028379 Ga0268266_10020162 Ga0268266_100201628 187
14 3300044684 Ga0466966_0224016 Ga0466966_0224016_12_575 187
15 3300046459 Ga0495629_0315136 Ga0495629_0315136_420_983 187
16 3300037312 Ga0395899_0013002 Ga0395899_0013002_3415_4023 188
17 3300037418 Ga0395900_0043887 Ga0395900_0043887_633_1241 188
18 3300037471 Ga0395905_0036601 Ga0395905_0036601_2966_3574 188
19 3300038443 Ga0395901_0015662 Ga0395901_0015662_5995_6603 188
20 3300046616 Ga0495668_0043338 Ga0495668_0043338_1861_2460 188
21 3300053134 Ga0500658_0000036 Ga0500658_0000036_25018_25617 188
22 3300005334 Ga0068869_100145876 Ga0068869_1001458762 189
23 3300005842 Ga0068858_100053896 Ga0068858_1000538964 189
24 3300025942 Ga0207689_10047301 Ga0207689_100473016 189
25 3300005331 Ga0070670_100088561 Ga0070670_1000885613 191
26 3300005343 Ga0070687_100035373 Ga0070687_1000353732 191
27 3300005347 Ga0070668_100993381 Ga0070668_1009933811 191
28 3300005353 Ga0070669_100027852 Ga0070669_1000278526 191
29 3300005354 Ga0070675_100051701 Ga0070675_1000517012 191
30 3300005364 Ga0070673_100162215 Ga0070673_1001622152 191
31 3300005366 Ga0070659_100292973 Ga0070659_1002929731 191
32 3300005455 Ga0070663_100048766 Ga0070663_1000487666 191
33 3300005457 Ga0070662_100051693 Ga0070662_1000516932 191
34 3300005530 Ga0070679_100502407 Ga0070679_1005024072 191
35 3300005539 Ga0068853_100707001 Ga0068853_1007070012 191
36 3300005543 Ga0070672_100499886 Ga0070672_1004998862 191
37 3300005564 Ga0070664_100024181 Ga0070664_1000241813 191
38 3300005577 Ga0068857_100332981 Ga0068857_1003329813 191
39 3300005578 Ga0068854_100188758 Ga0068854_1001887582 191
40 3300005617 Ga0068859_100354360 Ga0068859_1003543603 191
41 3300005618 Ga0068864_100018705 Ga0068864_1000187055 191
42 3300005841 Ga0068863_100034196 Ga0068863_1000341964 191
43 3300005843 Ga0068860_100037295 Ga0068860_1000372956 191
44 3300005844 Ga0068862_100016644 Ga0068862_1000166445 191
45 3300006931 Ga0097620_100354365 Ga0097620_1003543653 191
46 3300009148 Ga0105243_10281825 Ga0105243_102818252 191
47 3300009553 Ga0105249_10106875 Ga0105249_101068752 191
48 3300014325 Ga0163163_10629432 Ga0163163_106294322 191
49 3300014968 Ga0157379_10154210 Ga0157379_101542102 191
50 3300025907 Ga0207645_10132729 Ga0207645_101327292 191
51 3300025923 Ga0207681_10156227 Ga0207681_101562272 191
52 3300025926 Ga0207659_10037139 Ga0207659_100371393 191
53 3300025932 Ga0207690_10230418 Ga0207690_102304183 191
54 3300025981 Ga0207640_10061021 Ga0207640_100610213 191
55 3300026035 Ga0207703_10023978 Ga0207703_100239785 191
56 3300026041 Ga0207639_10446153 Ga0207639_104461532 191
57 3300026067 Ga0207678_10074022 Ga0207678_100740223 191
58 3300026088 Ga0207641_10017477 Ga0207641_100174775 191
59 3300026095 Ga0207676_10009605 Ga0207676_100096058 191
60 3300026116 Ga0207674_10003513 Ga0207674_100035134 191
61 3300028380 Ga0268265_10019944 Ga0268265_100199443 191
62 3300035088 Ga0373940_0062319 Ga0373940_0062319_383_982 191
63 3300035115 Ga0373941_0219899 Ga0373941_0219899_21_620 191
64 3300037418 Ga0395900_0415991 Ga0395900_0415991_438_1037 191
65 3300037466 Ga0395898_0685576 Ga0395898_0685576_340_939 191
66 3300038443 Ga0395901_0222797 Ga0395901_0222797_437_1036 191
67 3300046684 Ga0495669_0292518 Ga0495669_0292518_78_677 191
68 3300048912 Ga0496109_0184565 Ga0496109_0184565_203_802 191
69 3300003316 rootH1_10018332 rootH1_100183321 192
70 3300005328 Ga0070676_10229238 Ga0070676_102292382 196
71 3300005330 Ga0070690_100009956 Ga0070690_1000099569 196
72 3300005335 Ga0070666_10006211 Ga0070666_100062119 196
73 3300005338 Ga0068868_100091424 Ga0068868_1000914243 196
74 3300005355 Ga0070671_100087416 Ga0070671_1000874163 196
75 3300005356 Ga0070674_100003944 Ga0070674_1000039449 196
76 3300005364 Ga0070673_100014589 Ga0070673_1000145898 196
77 3300005366 Ga0070659_100304595 Ga0070659_1003045952 196
78 3300005367 Ga0070667_100154242 Ga0070667_1001542422 196
79 3300005457 Ga0070662_100355716 Ga0070662_1003557162 196
80 3300005544 Ga0070686_100155418 Ga0070686_1001554182 196
81 3300005548 Ga0070665_100633538 Ga0070665_1006335382 196
82 3300005718 Ga0068866_10076239 Ga0068866_100762392 196
83 3300005842 Ga0068858_100025351 Ga0068858_1000253513 196
84 3300009093 Ga0105240_10264610 Ga0105240_102646102 196
85 3300009098 Ga0105245_10306003 Ga0105245_103060033 196
86 3300009177 Ga0105248_10023597 Ga0105248_100235973 196
87 3300025899 Ga0207642_10057180 Ga0207642_100571802 196
88 3300025903 Ga0207680_10001446 Ga0207680_1000144610 196
89 3300025907 Ga0207645_10282813 Ga0207645_102828133 196
90 3300025931 Ga0207644_10071448 Ga0207644_100714483 196
91 3300025933 Ga0207706_10426631 Ga0207706_104266312 196
92 3300025937 Ga0207669_10016923 Ga0207669_100169233 196
93 3300025960 Ga0207651_10030292 Ga0207651_100302923 196
94 3300025986 Ga0207658_10298262 Ga0207658_102982622 196
95 3300026023 Ga0207677_10133789 Ga0207677_101337892 196
96 3300026035 Ga0207703_10007259 Ga0207703_100072597 196
97 3300028379 Ga0268266_10511991 Ga0268266_105119912 196
98 3300048909 Ga0496106_0460243 Ga0496106_0460243_262_855 196
99 3300048912 Ga0496109_1055829 Ga0496109_1055829_146_739 196
100 3300003322 rootL2_10247766 rootL2_102477662 197
101 3300005336 Ga0070680_100002339 Ga0070680_10000233911 197
102 3300005336 Ga0070680_100110820 Ga0070680_1001108202 197
103 3300005345 Ga0070692_10048347 Ga0070692_100483474 197
104 3300005530 Ga0070679_100199670 Ga0070679_1001996703 197
105 3300005563 Ga0068855_100368981 Ga0068855_1003689812 197
106 3300005578 Ga0068854_100415002 Ga0068854_1004150022 197
107 3300005614 Ga0068856_100182940 Ga0068856_1001829402 197
108 3300006358 Ga0068871_100751877 Ga0068871_1007518772 197
109 3300013102 Ga0157371_10116998 Ga0157371_101169982 197
110 3300013104 Ga0157370_10180667 Ga0157370_101806672 197
111 3300013105 Ga0157369_10207062 Ga0157369_102070622 197
112 3300013297 Ga0157378_11824755 Ga0157378_118247551 197
113 3300020082 Ga0206353_11626991 Ga0206353_116269912 197
114 3300025909 Ga0207705_10019462 Ga0207705_100194624 197
115 3300025917 Ga0207660_10007321 Ga0207660_1000732111 197
116 3300025917 Ga0207660_10273645 Ga0207660_102736452 197
117 3300025949 Ga0207667_10127777 Ga0207667_101277772 197
118 3300026067 Ga0207678_10275392 Ga0207678_102753922 197
119 3300026078 Ga0207702_10164400 Ga0207702_101644002 197
120 3300026142 Ga0207698_10502487 Ga0207698_105024872 197
121 3300044684 Ga0466966_0130108 Ga0466966_0130108_619_1212 197
122 3300044693 Ga0466961_0036169 Ga0466961_0036169_476_1069 197
123 3300044694 Ga0466963_0056367 Ga0466963_0056367_894_1487 197
124 3300044706 Ga0466964_0052307 Ga0466964_0052307_457_1050 197
125 3300044719 Ga0466971_0088758 Ga0466971_0088758_481_1074 197
126 3300044765 Ga0466970_0035293 Ga0466970_0035293_812_1405 197
127 3300044765 Ga0466970_0182710 Ga0466970_0182710_166_759 197
128 3300044842 Ga0466957_0047644 Ga0466957_0047644_707_1300 197
129 3300044842 Ga0466957_0052952 Ga0466957_0052952_1088_1681 197
130 3300045049 Ga0466959_0339157 Ga0466959_0339157_21_614 197
131 3300045049 Ga0466959_0435186 Ga0466959_0435186_226_819 197
132 3300045976 Ga0466967_0493941 Ga0466967_0493941_35_628 197
133 3300046616 Ga0495668_0027367 Ga0495668_0027367_804_1397 197
134 3300048913 Ga0496110_0100447 Ga0496110_0100447_1072_1665 197
135 3300061719 Ga0466962_0009093 Ga0466962_0009093_1298_1891 197
136 3300001990 JGI24737J22298_10015575 JGI24737J22298_100155752 198
137 3300005327 Ga0070658_10032345 Ga0070658_100323453 198
138 3300005327 Ga0070658_10198934 Ga0070658_101989343 198
139 3300005327 Ga0070658_10245805 Ga0070658_102458052 198
140 3300005329 Ga0070683_100352945 Ga0070683_1003529452 198
141 3300005329 Ga0070683_100729762 Ga0070683_1007297622 198
142 3300005338 Ga0068868_100378999 Ga0068868_1003789992 198
143 3300005339 Ga0070660_100010776 Ga0070660_1000107762 198
144 3300005339 Ga0070660_100295657 Ga0070660_1002956572 198
145 3300005344 Ga0070661_100006896 Ga0070661_1000068968 198
146 3300005344 Ga0070661_100094169 Ga0070661_1000941694 198
147 3300005344 Ga0070661_100466648 Ga0070661_1004666482 198
148 3300005345 Ga0070692_10134100 Ga0070692_101341002 198
149 3300005355 Ga0070671_100005172 Ga0070671_1000051723 198
150 3300005355 Ga0070671_100006087 Ga0070671_1000060872 198
151 3300005355 Ga0070671_100025631 Ga0070671_1000256318 198
152 3300005364 Ga0070673_100023528 Ga0070673_1000235283 198
153 3300005364 Ga0070673_100106228 Ga0070673_1001062282 198
154 3300005366 Ga0070659_100031866 Ga0070659_1000318662 198
155 3300005366 Ga0070659_100072982 Ga0070659_1000729822 198
156 3300005366 Ga0070659_100229220 Ga0070659_1002292202 198
157 3300005366 Ga0070659_100854964 Ga0070659_1008549641 198
158 3300005367 Ga0070667_100824867 Ga0070667_1008248672 198
159 3300005455 Ga0070663_100028963 Ga0070663_1000289633 198
160 3300005457 Ga0070662_100266385 Ga0070662_1002663853 198
161 3300005530 Ga0070679_100466702 Ga0070679_1004667022 198
162 3300005539 Ga0068853_100051418 Ga0068853_1000514182 198
163 3300005539 Ga0068853_100086528 Ga0068853_1000865282 198
164 3300005563 Ga0068855_100035666 Ga0068855_1000356662 198
165 3300005563 Ga0068855_100242282 Ga0068855_1002422822 198
166 3300005564 Ga0070664_100014969 Ga0070664_1000149693 198
167 3300005564 Ga0070664_100071046 Ga0070664_1000710463 198
168 3300005564 Ga0070664_100170729 Ga0070664_1001707292 198
169 3300005564 Ga0070664_100238847 Ga0070664_1002388472 198
170 3300005578 Ga0068854_100047178 Ga0068854_1000471783 198
171 3300005578 Ga0068854_100120404 Ga0068854_1001204042 198
172 3300005616 Ga0068852_100040686 Ga0068852_1000406863 198
173 3300005616 Ga0068852_100085648 Ga0068852_1000856482 198
174 3300005616 Ga0068852_100162297 Ga0068852_1001622972 198
175 3300005616 Ga0068852_100316078 Ga0068852_1003160782 198
176 3300005618 Ga0068864_100009260 Ga0068864_1000092607 198
177 3300005618 Ga0068864_100079811 Ga0068864_1000798112 198
178 3300005834 Ga0068851_10056006 Ga0068851_100560062 198
179 3300005834 Ga0068851_10058548 Ga0068851_100585483 198
180 3300006237 Ga0097621_100338360 Ga0097621_1003383602 198
181 3300006237 Ga0097621_100454916 Ga0097621_1004549161 198
182 3300009177 Ga0105248_10000862 Ga0105248_100008628 198
183 3300013100 Ga0157373_10127567 Ga0157373_101275672 198
184 3300013100 Ga0157373_10358603 Ga0157373_103586032 198
185 3300013102 Ga0157371_10211452 Ga0157371_102114522 198
186 3300013104 Ga0157370_10186608 Ga0157370_101866082 198
187 3300013105 Ga0157369_10130216 Ga0157369_101302162 198
188 3300013297 Ga0157378_10326952 Ga0157378_103269522 198
189 3300013307 Ga0157372_10346445 Ga0157372_103464453 198
190 3300013307 Ga0157372_10689072 Ga0157372_106890722 198
191 3300020081 Ga0206354_10455799 Ga0206354_104557992 198
192 3300020082 Ga0206353_10968963 Ga0206353_109689632 198
193 3300025321 Ga0207656_10079373 Ga0207656_100793733 198
194 3300025909 Ga0207705_10002265 Ga0207705_1000226513 198
195 3300025909 Ga0207705_10032412 Ga0207705_100324124 198
196 3300025909 Ga0207705_10046611 Ga0207705_100466116 198
197 3300025909 Ga0207705_10052347 Ga0207705_100523474 198
198 3300025912 Ga0207707_10007637 Ga0207707_100076375 198
199 3300025919 Ga0207657_10008735 Ga0207657_100087357 198
200 3300025919 Ga0207657_10041687 Ga0207657_100416872 198
201 3300025919 Ga0207657_10109833 Ga0207657_101098333 198
202 3300025919 Ga0207657_10221566 Ga0207657_102215663 198
203 3300025920 Ga0207649_10031541 Ga0207649_100315412 198
204 3300025931 Ga0207644_10005487 Ga0207644_100054873 198
205 3300025931 Ga0207644_10012501 Ga0207644_100125012 198
206 3300025931 Ga0207644_10055447 Ga0207644_100554475 198
207 3300025931 Ga0207644_10532254 Ga0207644_105322541 198
208 3300025932 Ga0207690_10041458 Ga0207690_100414582 198
209 3300025932 Ga0207690_10058978 Ga0207690_100589783 198
210 3300025932 Ga0207690_10072570 Ga0207690_100725702 198
211 3300025932 Ga0207690_10601140 Ga0207690_106011402 198
212 3300025933 Ga0207706_10094633 Ga0207706_100946332 198
213 3300025933 Ga0207706_10102586 Ga0207706_101025863 198
214 3300025940 Ga0207691_10477144 Ga0207691_104771442 198
215 3300025941 Ga0207711_10000344 Ga0207711_1000034412 198
216 3300025944 Ga0207661_10051264 Ga0207661_100512642 198
217 3300025945 Ga0207679_10030499 Ga0207679_100304993 198
218 3300025945 Ga0207679_10127994 Ga0207679_101279942 198
219 3300025945 Ga0207679_10140372 Ga0207679_101403722 198
220 3300025945 Ga0207679_10387508 Ga0207679_103875083 198
221 3300025949 Ga0207667_10095127 Ga0207667_100951272 198
222 3300025960 Ga0207651_10108957 Ga0207651_101089572 198
223 3300025981 Ga0207640_10053777 Ga0207640_100537772 198
224 3300025981 Ga0207640_10108592 Ga0207640_101085922 198
225 3300026041 Ga0207639_10080850 Ga0207639_100808504 198
226 3300026067 Ga0207678_10009554 Ga0207678_100095547 198
227 3300026067 Ga0207678_10059916 Ga0207678_100599163 198
228 3300026095 Ga0207676_10001683 Ga0207676_100016837 198
229 3300026095 Ga0207676_10050724 Ga0207676_100507243 198
230 3300026142 Ga0207698_10006430 Ga0207698_100064306 198
231 3300026142 Ga0207698_10905377 Ga0207698_109053772 198
232 3300037471 Ga0395905_0033324 Ga0395905_0033324_1236_1832 198
233 3300038443 Ga0395901_0093226 Ga0395901_0093226_2225_2821 198
234 3300044656 Ga0466969_0029825 Ga0466969_0029825_391_987 198
235 3300044658 Ga0466972_0168047 Ga0466972_0168047_80_676 198
236 3300044684 Ga0466966_0129599 Ga0466966_0129599_804_1400 198
237 3300044694 Ga0466963_0052846 Ga0466963_0052846_1348_1956 198
238 3300044694 Ga0466963_0082272 Ga0466963_0082272_639_1235 198
239 3300044694 Ga0466963_0165852 Ga0466963_0165852_486_1094 198
240 3300044842 Ga0466957_0001422 Ga0466957_0001422_9899_10507 198
241 3300045976 Ga0466967_0130257 Ga0466967_0130257_1683_2291 198
242 3300045976 Ga0466967_0240066 Ga0466967_0240066_459_1055 198
243 3300045976 Ga0466967_1199143 Ga0466967_1199143_37_633 198
244 3300046528 Ga0495642_0022491 Ga0495642_0022491_1180_1776 198
245 3300046684 Ga0495669_0019311 Ga0495669_0019311_54_650 198
246 3300046684 Ga0495669_0030453 Ga0495669_0030453_1652_2248 198
247 3300047445 Ga0495677_0032211 Ga0495677_0032211_209_805 198
248 3300048904 Ga0496101_0028175 Ga0496101_0028175_1683_2279 198
249 3300048909 Ga0496106_0028752 Ga0496106_0028752_1969_2565 198
250 3300048910 Ga0496107_0009925 Ga0496107_0009925_4732_5328 198
251 3300048911 Ga0496108_0021559 Ga0496108_0021559_3730_4326 198
252 3300048911 Ga0496108_0198997 Ga0496108_0198997_337_933 198
253 3300048912 Ga0496109_0023306 Ga0496109_0023306_638_1234 198
254 3300048912 Ga0496109_0672678 Ga0496109_0672678_355_951 198
255 3300048913 Ga0496110_0327497 Ga0496110_0327497_16_612 198
256 3300048914 Ga0496111_0028798 Ga0496111_0028798_1772_2368 198
257 3300048915 Ga0496112_0023946 Ga0496112_0023946_922_1518 198
258 3300048915 Ga0496112_0090453 Ga0496112_0090453_2079_2675 198
259 3300048916 Ga0496113_0125394 Ga0496113_0125394_712_1308 198
260 3300001915 JGI24741J21665_1004228 JGI24741J21665_10042286 199
261 3300001979 JGI24740J21852_10011719 JGI24740J21852_100117195 199
262 3300002067 JGI24735J21928_10011796 JGI24735J21928_100117963 199
263 3300005327 Ga0070658_10017721 Ga0070658_100177216 199
264 3300005327 Ga0070658_10076859 Ga0070658_100768592 199
265 3300005329 Ga0070683_100406504 Ga0070683_1004065042 199
266 3300005331 Ga0070670_100027209 Ga0070670_1000272096 199
267 3300005331 Ga0070670_100036244 Ga0070670_1000362446 199
268 3300005331 Ga0070670_100202292 Ga0070670_1002022921 199
269 3300005331 Ga0070670_100780268 Ga0070670_1007802681 199
270 3300005335 Ga0070666_10800629 Ga0070666_108006291 199
271 3300005336 Ga0070680_100398130 Ga0070680_1003981302 199
272 3300005339 Ga0070660_100024355 Ga0070660_1000243554 199
273 3300005339 Ga0070660_100491490 Ga0070660_1004914902 199
274 3300005344 Ga0070661_100112088 Ga0070661_1001120883 199
275 3300005353 Ga0070669_100044551 Ga0070669_1000445513 199
276 3300005354 Ga0070675_100011423 Ga0070675_1000114233 199
277 3300005355 Ga0070671_100018146 Ga0070671_1000181463 199
278 3300005355 Ga0070671_100075000 Ga0070671_1000750003 199
279 3300005355 Ga0070671_100129706 Ga0070671_1001297062 199
280 3300005355 Ga0070671_100933703 Ga0070671_1009337031 199
281 3300005364 Ga0070673_100433834 Ga0070673_1004338342 199
282 3300005364 Ga0070673_100531305 Ga0070673_1005313051 199
283 3300005366 Ga0070659_100097596 Ga0070659_1000975963 199
284 3300005366 Ga0070659_100810183 Ga0070659_1008101832 199
285 3300005367 Ga0070667_100009715 Ga0070667_1000097157 199
286 3300005367 Ga0070667_100015073 Ga0070667_10001507311 199
287 3300005367 Ga0070667_100115962 Ga0070667_1001159624 199
288 3300005367 Ga0070667_100236408 Ga0070667_1002364082 199
289 3300005455 Ga0070663_101036232 Ga0070663_1010362321 199
290 3300005457 Ga0070662_100069302 Ga0070662_1000693023 199
291 3300005457 Ga0070662_100196376 Ga0070662_1001963762 199
292 3300005535 Ga0070684_100437900 Ga0070684_1004379002 199
293 3300005539 Ga0068853_100053328 Ga0068853_1000533283 199
294 3300005548 Ga0070665_100347359 Ga0070665_1003473592 199
295 3300005563 Ga0068855_100457211 Ga0068855_1004572113 199
296 3300005564 Ga0070664_100004835 Ga0070664_1000048359 199
297 3300005564 Ga0070664_100041277 Ga0070664_1000412774 199
298 3300005564 Ga0070664_100074367 Ga0070664_1000743673 199
299 3300005564 Ga0070664_100226493 Ga0070664_1002264932 199
300 3300005577 Ga0068857_100056710 Ga0068857_1000567102 199
301 3300005614 Ga0068856_100065488 Ga0068856_1000654886 199
302 3300005614 Ga0068856_100078493 Ga0068856_1000784934 199
303 3300005616 Ga0068852_100046036 Ga0068852_1000460363 199
304 3300005616 Ga0068852_100526787 Ga0068852_1005267872 199
305 3300005617 Ga0068859_100001678 Ga0068859_10000167819 199
306 3300005617 Ga0068859_100037436 Ga0068859_1000374367 199
307 3300005617 Ga0068859_100041180 Ga0068859_1000411803 199
308 3300005618 Ga0068864_100001178 Ga0068864_1000011788 199
309 3300005618 Ga0068864_100033226 Ga0068864_1000332262 199
310 3300005618 Ga0068864_100102892 Ga0068864_1001028923 199
311 3300005834 Ga0068851_10034280 Ga0068851_100342803 199
312 3300005841 Ga0068863_100001789 Ga0068863_10000178920 199
313 3300005841 Ga0068863_100001894 Ga0068863_1000018943 199
314 3300005841 Ga0068863_100024293 Ga0068863_1000242932 199
315 3300005841 Ga0068863_100057814 Ga0068863_1000578142 199
316 3300005842 Ga0068858_100012230 Ga0068858_1000122303 199
317 3300005842 Ga0068858_100077505 Ga0068858_1000775054 199
318 3300005842 Ga0068858_100747159 Ga0068858_1007471592 199
319 3300005843 Ga0068860_100003488 Ga0068860_1000034887 199
320 3300005843 Ga0068860_101006038 Ga0068860_1010060382 199
321 3300005844 Ga0068862_100073429 Ga0068862_1000734292 199
322 3300005844 Ga0068862_100500235 Ga0068862_1005002352 199
323 3300006237 Ga0097621_100125975 Ga0097621_1001259752 199
324 3300006931 Ga0097620_100001678 Ga0097620_10000167819 199
325 3300006931 Ga0097620_100037436 Ga0097620_1000374362 199
326 3300006931 Ga0097620_100041181 Ga0097620_1000411813 199
327 3300009092 Ga0105250_10011922 Ga0105250_100119223 199
328 3300009101 Ga0105247_10432486 Ga0105247_104324862 199
329 3300009174 Ga0105241_10370339 Ga0105241_103703393 199
330 3300009177 Ga0105248_10001135 Ga0105248_1000113529 199
331 3300009177 Ga0105248_10240392 Ga0105248_102403922 199
332 3300009177 Ga0105248_10253285 Ga0105248_102532852 199
333 3300009177 Ga0105248_10289274 Ga0105248_102892742 199
334 3300009177 Ga0105248_10447346 Ga0105248_104473462 199
335 3300009545 Ga0105237_10054857 Ga0105237_100548577 199
336 3300009553 Ga0105249_10057772 Ga0105249_100577726 199
337 3300013100 Ga0157373_10025749 Ga0157373_100257497 199
338 3300013100 Ga0157373_10093248 Ga0157373_100932483 199
339 3300013102 Ga0157371_10174995 Ga0157371_101749952 199
340 3300013104 Ga0157370_10400083 Ga0157370_104000832 199
341 3300013105 Ga0157369_10254866 Ga0157369_102548662 199
342 3300013307 Ga0157372_10453596 Ga0157372_104535961 199
343 3300013307 Ga0157372_10954957 Ga0157372_109549572 199
344 3300013308 Ga0157375_10474675 Ga0157375_104746752 199
345 3300013308 Ga0157375_10698445 Ga0157375_106984452 199
346 3300014325 Ga0163163_10000735 Ga0163163_1000073517 199
347 3300014325 Ga0163163_11377211 Ga0163163_113772112 199
348 3300014325 Ga0163163_11517438 Ga0163163_115174382 199
349 3300014968 Ga0157379_10015840 Ga0157379_100158402 199
350 3300017792 Ga0163161_10360430 Ga0163161_103604302 199
351 3300025909 Ga0207705_10003743 Ga0207705_1000374310 199
352 3300025909 Ga0207705_10025904 Ga0207705_100259042 199
353 3300025909 Ga0207705_10033760 Ga0207705_100337603 199
354 3300025909 Ga0207705_10153644 Ga0207705_101536442 199
355 3300025909 Ga0207705_10371619 Ga0207705_103716191 199
356 3300025912 Ga0207707_10189760 Ga0207707_101897602 199
357 3300025917 Ga0207660_10137599 Ga0207660_101375992 199
358 3300025919 Ga0207657_10009638 Ga0207657_100096388 199
359 3300025919 Ga0207657_10024747 Ga0207657_100247473 199
360 3300025919 Ga0207657_10037175 Ga0207657_100371757 199
361 3300025919 Ga0207657_10518379 Ga0207657_105183791 199
362 3300025920 Ga0207649_10084289 Ga0207649_100842892 199
363 3300025920 Ga0207649_10182634 Ga0207649_101826343 199
364 3300025921 Ga0207652_10063613 Ga0207652_100636132 199
365 3300025921 Ga0207652_10183569 Ga0207652_101835693 199
366 3300025921 Ga0207652_10432776 Ga0207652_104327762 199
367 3300025923 Ga0207681_10023803 Ga0207681_100238037 199
368 3300025925 Ga0207650_10011484 Ga0207650_100114846 199
369 3300025925 Ga0207650_10648936 Ga0207650_106489362 199
370 3300025926 Ga0207659_10006899 Ga0207659_100068993 199
371 3300025931 Ga0207644_10000747 Ga0207644_1000074724 199
372 3300025931 Ga0207644_10010759 Ga0207644_100107592 199
373 3300025931 Ga0207644_10036429 Ga0207644_100364296 199
374 3300025931 Ga0207644_10181310 Ga0207644_101813102 199
375 3300025931 Ga0207644_10595148 Ga0207644_105951482 199
376 3300025932 Ga0207690_10047137 Ga0207690_100471372 199
377 3300025932 Ga0207690_10141672 Ga0207690_101416722 199
378 3300025932 Ga0207690_10307280 Ga0207690_103072803 199
379 3300025932 Ga0207690_10694145 Ga0207690_106941451 199
380 3300025933 Ga0207706_10095766 Ga0207706_100957663 199
381 3300025940 Ga0207691_10263907 Ga0207691_102639073 199
382 3300025941 Ga0207711_10000213 Ga0207711_1000021341 199
383 3300025941 Ga0207711_10028323 Ga0207711_100283232 199
384 3300025941 Ga0207711_10349126 Ga0207711_103491262 199
385 3300025941 Ga0207711_10431466 Ga0207711_104314662 199
386 3300025942 Ga0207689_10062089 Ga0207689_100620894 199
387 3300025944 Ga0207661_10282739 Ga0207661_102827393 199
388 3300025945 Ga0207679_10008749 Ga0207679_100087495 199
389 3300025945 Ga0207679_10063088 Ga0207679_100630884 199
390 3300025945 Ga0207679_10073218 Ga0207679_100732182 199
391 3300025960 Ga0207651_10642262 Ga0207651_106422622 199
392 3300025960 Ga0207651_11118758 Ga0207651_111187581 199
393 3300025961 Ga0207712_10010115 Ga0207712_100101156 199
394 3300025972 Ga0207668_10219402 Ga0207668_102194022 199
395 3300025981 Ga0207640_10119729 Ga0207640_101197292 199
396 3300025986 Ga0207658_10034627 Ga0207658_100346276 199
397 3300025986 Ga0207658_10053067 Ga0207658_100530673 199
398 3300025986 Ga0207658_10075177 Ga0207658_100751771 199
399 3300026035 Ga0207703_10022069 Ga0207703_100220692 199
400 3300026035 Ga0207703_10148668 Ga0207703_101486683 199
401 3300026041 Ga0207639_10065566 Ga0207639_100655663 199
402 3300026041 Ga0207639_10169354 Ga0207639_101693543 199
403 3300026067 Ga0207678_10068950 Ga0207678_100689502 199
404 3300026067 Ga0207678_10111796 Ga0207678_101117962 199
405 3300026078 Ga0207702_10069157 Ga0207702_100691572 199
406 3300026078 Ga0207702_10172131 Ga0207702_101721312 199
407 3300026088 Ga0207641_10001671 Ga0207641_1000167114 199
408 3300026088 Ga0207641_10068990 Ga0207641_100689904 199
409 3300026088 Ga0207641_10175075 Ga0207641_101750753 199
410 3300026088 Ga0207641_10255155 Ga0207641_102551552 199
411 3300026095 Ga0207676_10002153 Ga0207676_100021539 199
412 3300026095 Ga0207676_10025079 Ga0207676_100250793 199
413 3300026116 Ga0207674_10001507 Ga0207674_1000150712 199
414 3300026116 Ga0207674_10015063 Ga0207674_100150637 199
415 3300026142 Ga0207698_10163437 Ga0207698_101634372 199
416 3300028380 Ga0268265_10007667 Ga0268265_1000766710 199
417 3300028380 Ga0268265_10414827 Ga0268265_104148272 199
418 3300028381 Ga0268264_10002330 Ga0268264_1000233011 199
419 3300037312 Ga0395899_0263707 Ga0395899_0263707_536_1135 199
420 3300037418 Ga0395900_0001571 Ga0395900_0001571_25414_26013 199
421 3300037418 Ga0395900_0198622 Ga0395900_0198622_217_816 199
422 3300037418 Ga0395900_0553697 Ga0395900_0553697_473_1072 199
423 3300037466 Ga0395898_0127223 Ga0395898_0127223_125_724 199
424 3300037466 Ga0395898_0358657 Ga0395898_0358657_591_1202 199
425 3300037466 Ga0395898_0642333 Ga0395898_0642333_198_797 199
426 3300037471 Ga0395905_0000104 Ga0395905_0000104_111476_112075 199
427 3300037471 Ga0395905_0165485 Ga0395905_0165485_149_748 199
428 3300038443 Ga0395901_0088538 Ga0395901_0088538_1052_1651 199
429 3300038443 Ga0395901_0178739 Ga0395901_0178739_1043_1654 199
430 3300038443 Ga0395901_0867941 Ga0395901_0867941_213_812 199
431 3300044658 Ga0466972_0053000 Ga0466972_0053000_1077_1676 199
432 3300044693 Ga0466961_0007193 Ga0466961_0007193_1275_1874 199
433 3300044694 Ga0466963_0051136 Ga0466963_0051136_505_1107 199
434 3300044706 Ga0466964_0004778 Ga0466964_0004778_3843_4442 199
435 3300044735 Ga0466968_0002423 Ga0466968_0002423_3239_3838 199
436 3300044765 Ga0466970_0019719 Ga0466970_0019719_2322_2921 199
437 3300045049 Ga0466959_0005408 Ga0466959_0005408_5822_6421 199
438 3300045836 Ga0466958_0002868 Ga0466958_0002868_2276_2875 199
439 3300045976 Ga0466967_0199503 Ga0466967_0199503_643_1242 199
440 3300045976 Ga0466967_0493168 Ga0466967_0493168_275_877 199
441 3300046537 Ga0495598_0000235 Ga0495598_0000235_7346_7948 199
442 3300046558 Ga0495633_0017029 Ga0495633_0017029_423_1025 199
443 3300046616 Ga0495668_0010948 Ga0495668_0010948_1279_1878 199
444 3300046684 Ga0495669_0004858 Ga0495669_0004858_3400_3999 199
445 3300046684 Ga0495669_0009099 Ga0495669_0009099_3451_4050 199
446 3300046684 Ga0495669_0010841 Ga0495669_0010841_3087_3689 199
447 3300046684 Ga0495669_0056786 Ga0495669_0056786_199_798 199
448 3300046691 Ga0495670_0005232 Ga0495670_0005232_455_1057 199
449 3300048903 Ga0496100_0109983 Ga0496100_0109983_283_882 199
450 3300048905 Ga0496102_0073280 Ga0496102_0073280_288_887 199
451 3300048906 Ga0496103_0018532 Ga0496103_0018532_3327_3926 199
452 3300048908 Ga0496105_0199448 Ga0496105_0199448_799_1398 199
453 3300048910 Ga0496107_0031289 Ga0496107_0031289_1221_1820 199
454 3300048911 Ga0496108_0014931 Ga0496108_0014931_1687_2286 199
455 3300048911 Ga0496108_0022658 Ga0496108_0022658_1626_2228 199
456 3300048912 Ga0496109_0248996 Ga0496109_0248996_479_1078 199
457 3300048913 Ga0496110_0010682 Ga0496110_0010682_6812_7411 199
458 3300048913 Ga0496110_0164964 Ga0496110_0164964_1394_1996 199
459 3300048914 Ga0496111_0002231 Ga0496111_0002231_5662_6261 199
460 3300048915 Ga0496112_0049534 Ga0496112_0049534_103_702 199
461 3300048916 Ga0496113_0020228 Ga0496113_0020228_1998_2597 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02104

SURF1

SURF1 family

14

181

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w5z-assembly1.cif.gz_h cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.6592 21 134
8gym-assembly1.cif.gz_d cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.6448 7 186
7w5z-assembly1.cif.gz_d cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.605 7 187
8gym-assembly1.cif.gz_d cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.5906 7 186
7obz-assembly3.cif.gz_E structure of rslov d109g 0.5731 74 104
ID Description Score Start End Superfamily
af_Q2G065_1_109_3.40.50.10350 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycerate kinase; domain 1 0.7058 74 108 3.40.50.10350
af_Q3L8U1_691_750_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.6654 72 103 2.40.50.40
af_A0A0G2L879_262_377_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.626 156 199 1.20.58.390
af_A4ICV0_26_193_3.30.800.10 Alpha Beta;2-Layer Sandwich;Phosphatidylinositol Phosphate Kinase II Beta;Phosphatidylinositol Phosphate Kinase II Beta 0.6213 77 98 3.30.800.10
af_Q5A6N1_855_1055_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.6036 74 102 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A7H0GBL5-F1-model_v4 deleted 0.9672 1 198
AF-A0A7H0GBL5-F1-model_v4 deleted 0.9624 1 198
AF-A0A7W0D0Q6-F1-model_v4 SURF1-like protein 0.9449 2 191 GO:0005886
AF-A0A520YAK5-F1-model_v4 SURF1-like protein 0.9438 5 179 GO:0005886
AF-A0A840HS97-F1-model_v4 SURF1-like protein 0.9356 2 190 GO:0005886

Feature Viewer

pLDDT pTM Quality
87.79 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map