F448617

General Info

Members Datasets Scaffolds Average Seq Length
460 133 449 314

Family's Representative Sequence

Representative Sequence 3300047469|Ga0495673_0000008|Ga0495673_0000008_141099_142085
Length 328
Sequence MDAIFTAFAVLLFAAVILMIEGAWLWWSGAHGGGARRIAKRLRLMAASANGGAERIDILKRRTYSGNPALERQLRRVAKVARLALLDRLLLQAGVRWSVAQFLGCSLLMLALGSLLPLMAGVPPAPAIGALALAGGLPGMLLMRTRRARLRKLEEQLPEAADFLGRALRAGHSFANVMQMVGEEMPDPIAGEFKFAYEEVNYGVPMSEALHNLALRVPLTDLRYLVIAVLIQRESGGNLAEVFGNISRLIRARLKLLAQVRVMSAEGRMSAWILGLLPLGVLALMALANPTYVRVLWTDPIGVRLAWYAVGVAGFGVLWMRKLIRIRI

Samples

Sample ID Description Type Environment
1 2738541297 Duganella sp. GV083 Isolate Unclassified
2 2738541357 Duganella sp. GV053 Isolate Unclassified
3 2738543003 Duganella sp. GV066 Isolate Unclassified
4 2738543026 Duganella sp. GV089 Isolate Unclassified
5 2738543029 Duganella sp. GV039 Isolate Unclassified
6 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
7 2821131069 Duganella sp. 1224 Isolate Unclassified
8 2842711865 Duganella sp. R-73148 Isolate Unclassified
9 2857558681 Duganella sp. R-74565 Isolate Unclassified
10 2857564685 Duganella sp. R-74599 Isolate Unclassified
11 2904424332 Duganella sp. 1411 Isolate Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
19 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
20 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
21 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
22 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
24 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
26 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
28 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
29 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
30 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
31 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
32 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
33 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
34 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
35 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
36 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
37 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
38 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
39 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
40 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
41 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
42 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
43 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
44 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
45 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
46 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
47 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
48 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
49 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
50 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
51 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
52 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
53 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
54 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
55 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
56 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
57 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
58 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
59 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
60 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
61 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
62 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
63 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
64 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
65 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
66 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
67 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
68 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
69 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
70 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
71 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
72 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
73 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
74 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
75 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
76 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
77 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
81 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
82 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
83 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
86 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
101 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
102 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
103 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
104 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
109 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
110 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
128 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
129 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
130 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
131 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
132 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
133 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 0
Isolates 2.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0
Rhizoplane 2.61
Rhizosphere 89.78
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10016202 3300003322 Bacteria 5152
2 rootL2_10029269 3300003322 Bacteria 23509
3 Ga0055529_1000097 3300003763 Bacteria 132109
4 Ga0055526_1000030 3300003771 Bacteria 143833
5 Ga0065165_1000578 3300005262 Bacteria 54130
6 Ga0070664_100170969 3300005564 Bacteria 1928
7 Ga0105244_10001062 3300009036 Bacteria 22951
8 Ga0213872_10000041 3300021361 Bacteria 118955
9 Ga0213872_10000567 3300021361 Bacteria 28586
10 Ga0213872_10003014 3300021361 Bacteria 9518
11 Ga0209437_113372 3300025233 Bacteria 1174
12 Ga0207425_1000317 3300025245 Bacteria 34719
13 Ga0209646_1000272 3300025246 Bacteria 47609
14 Ga0209455_1000031 3300025272 Bacteria 519952
15 Ga0209025_1007506 3300025294 Bacteria 8104
16 Ga0209564_1000010 3300025295 Bacteria 885399
17 Ga0209564_1000978 3300025295 Bacteria 35985
18 Ga0209758_1003573 3300025297 Bacteria 13935
19 Ga0207655_1002698 3300025728 Bacteria 13918
20 Ga0207655_1002753 3300025728 Bacteria 13711
21 Ga0316181_1095903 3300030744 Bacteria 2963
22 Ga0265314_10024957 3300031711 Bacteria 4518
23 Ga0395905_0121797 3300037471 Bacteria 2452
24 Ga0395905_0396315 3300037471 Bacteria 1275
25 Ga0395901_0561801 3300038443 Bacteria 1155
26 Ga0436361_0054112 3300039447 Bacteria 18123
27 Ga0436361_0438991 3300039447 Bacteria 100787
28 Ga0436361_1123781 3300039447 Bacteria 10880
29 Ga0436361_1200035 3300039447 Bacteria 23576
30 Ga0495617_000025 3300046452 Bacteria 164547
31 Ga0495617_003744 3300046452 Bacteria 5644
32 Ga0495627_001852 3300046453 Bacteria 11209
33 Ga0495627_014150 3300046453 Bacteria 2792
34 Ga0495603_0035118 3300046455 Bacteria 3012
35 Ga0495590_0000014 3300046457 Bacteria 258314
36 Ga0495590_0003328 3300046457 Bacteria 6574
37 Ga0495590_0018471 3300046457 Bacteria 2496
38 Ga0495590_0058805 3300046457 Bacteria 1344
39 Ga0495591_000034 3300046458 Bacteria 170328
40 Ga0495591_009167 3300046458 Bacteria 3957
41 Ga0495629_0059080 3300046459 Bacteria 2681
42 Ga0495638_0025898 3300046460 Bacteria 3808
43 Ga0495638_0028833 3300046460 Bacteria 3582
44 Ga0495653_0000016 3300046463 Bacteria 200976
45 Ga0495653_0076873 3300046463 Bacteria 2480
46 Ga0495650_0000136 3300046471 Bacteria 171758
47 Ga0495650_0000201 3300046471 Bacteria 130128
48 Ga0495650_0000489 3300046471 Bacteria 60283
49 Ga0495650_0001615 3300046471 Bacteria 21031
50 Ga0495650_0002644 3300046471 Bacteria 13997
51 Ga0495650_0026444 3300046471 Bacteria 2699
52 Ga0495580_0024491 3300046472 Bacteria 4417
53 Ga0495582_0001809 3300046473 Bacteria 12092
54 Ga0495582_0050524 3300046473 Bacteria 2291
55 Ga0495605_0000127 3300046474 Bacteria 100664
56 Ga0495605_0001346 3300046474 Bacteria 16238
57 Ga0495605_0007903 3300046474 Bacteria 6024
58 Ga0495605_0021211 3300046474 Bacteria 3443
59 Ga0495639_0027618 3300046475 Bacteria 2512
60 Ga0495639_0085985 3300046475 Bacteria 1470
61 Ga0495584_0000807 3300046491 Bacteria 20613
62 Ga0495584_0002480 3300046491 Bacteria 10451
63 Ga0495584_0003132 3300046491 Bacteria 9189
64 Ga0495584_0004324 3300046491 Bacteria 7648
65 Ga0495584_0120689 3300046491 Bacteria 1327
66 Ga0495585_0000043 3300046492 Bacteria 125158
67 Ga0495585_0000809 3300046492 Bacteria 27251
68 Ga0495585_0000822 3300046492 Bacteria 26833
69 Ga0495585_0001697 3300046492 Bacteria 16817
70 Ga0495585_0003075 3300046492 Bacteria 11473
71 Ga0495585_0005799 3300046492 Bacteria 7744
72 Ga0495585_0008013 3300046492 Bacteria 6421
73 Ga0495585_0014162 3300046492 Bacteria 4653
74 Ga0495585_0023878 3300046492 Bacteria 3507
75 Ga0495585_0025643 3300046492 Bacteria 3373
76 Ga0495585_0039087 3300046492 Bacteria 2668
77 Ga0495585_0056642 3300046492 Bacteria 2164
78 Ga0495585_0153287 3300046492 Bacteria 1200
79 Ga0495594_0002718 3300046499 Bacteria 9177
80 Ga0495594_0006482 3300046499 Bacteria 6024
81 Ga0495594_0008266 3300046499 Bacteria 5356
82 Ga0495594_0011768 3300046499 Bacteria 4547
83 Ga0495596_0000806 3300046500 Bacteria 18994
84 Ga0495596_0002515 3300046500 Bacteria 9823
85 Ga0495596_0006694 3300046500 Bacteria 5275
86 Ga0495596_0009912 3300046500 Bacteria 4174
87 Ga0495596_0035355 3300046500 Bacteria 1981
88 Ga0495596_0039938 3300046500 Bacteria 1852
89 Ga0495607_0001313 3300046501 Bacteria 22171
90 Ga0495607_0001804 3300046501 Bacteria 18288
91 Ga0495607_0002303 3300046501 Bacteria 15695
92 Ga0495607_0015393 3300046501 Bacteria 4958
93 Ga0495607_0019594 3300046501 Bacteria 4295
94 Ga0495607_0057216 3300046501 Bacteria 2235
95 Ga0495583_0000137 3300046506 Bacteria 123815
96 Ga0495583_0001103 3300046506 Bacteria 29860
97 Ga0495583_0001202 3300046506 Bacteria 27775
98 Ga0495583_0001632 3300046506 Bacteria 21876
99 Ga0495583_0008511 3300046506 Bacteria 6260
100 Ga0495583_0011384 3300046506 Bacteria 5111
101 Ga0495583_0011568 3300046506 Bacteria 5060
102 Ga0495583_0029917 3300046506 Bacteria 2659
103 Ga0495606_0000046 3300046507 Bacteria 210855
104 Ga0495606_0000807 3300046507 Bacteria 47620
105 Ga0495606_0001871 3300046507 Bacteria 26390
106 Ga0495606_0002145 3300046507 Bacteria 23785
107 Ga0495606_0002280 3300046507 Bacteria 22694
108 Ga0495606_0003294 3300046507 Bacteria 17274
109 Ga0495606_0005105 3300046507 Bacteria 12758
110 Ga0495606_0011202 3300046507 Bacteria 7339
111 Ga0495606_0017712 3300046507 Bacteria 5373
112 Ga0495606_0035385 3300046507 Bacteria 3413
113 Ga0495606_0088762 3300046507 Bacteria 1905
114 Ga0495606_0143106 3300046507 Bacteria 1410
115 Ga0495606_0146652 3300046507 Bacteria 1389
116 Ga0495606_0154374 3300046507 Bacteria 1344
117 Ga0495610_0000027 3300046512 Bacteria 275273
118 Ga0495610_0000775 3300046512 Bacteria 30121
119 Ga0495610_0000837 3300046512 Bacteria 28700
120 Ga0495610_0004320 3300046512 Bacteria 10552
121 Ga0495610_0005374 3300046512 Bacteria 9135
122 Ga0495610_0005908 3300046512 Bacteria 8572
123 Ga0495616_0000257 3300046513 Bacteria 42962
124 Ga0495616_0000370 3300046513 Bacteria 35032
125 Ga0495616_0003772 3300046513 Bacteria 9670
126 Ga0495616_0014750 3300046513 Bacteria 4362
127 Ga0495616_0029102 3300046513 Bacteria 2919
128 Ga0495616_0036647 3300046513 Bacteria 2529
129 Ga0495616_0050164 3300046513 Bacteria 2088
130 Ga0495616_0082368 3300046513 Bacteria 1537
131 Ga0495616_0108052 3300046513 Bacteria 1295
132 Ga0495630_0004827 3300046517 Bacteria 9457
133 Ga0495631_0000822 3300046518 Bacteria 19836
134 Ga0495631_0000881 3300046518 Bacteria 18788
135 Ga0495631_0000957 3300046518 Bacteria 17994
136 Ga0495631_0001162 3300046518 Bacteria 16269
137 Ga0495631_0003893 3300046518 Bacteria 8075
138 Ga0495631_0005417 3300046518 Bacteria 6678
139 Ga0495631_0010643 3300046518 Bacteria 4549
140 Ga0495631_0011431 3300046518 Bacteria 4364
141 Ga0495631_0065342 3300046518 Bacteria 1574
142 Ga0495632_0000297 3300046519 Bacteria 48149
143 Ga0495632_0000510 3300046519 Bacteria 36555
144 Ga0495632_0000666 3300046519 Bacteria 31428
145 Ga0495632_0002285 3300046519 Bacteria 14768
146 Ga0495632_0006414 3300046519 Bacteria 7569
147 Ga0495632_0011523 3300046519 Bacteria 5154
148 Ga0495632_0019504 3300046519 Bacteria 3691
149 Ga0495637_0000003 3300046520 Bacteria 623293
150 Ga0495637_0000150 3300046520 Bacteria 53429
151 Ga0495637_0007035 3300046520 Bacteria 5602
152 Ga0495637_0011596 3300046520 Bacteria 4231
153 Ga0495643_0000108 3300046522 Bacteria 136032
154 Ga0495643_0000912 3300046522 Bacteria 31145
155 Ga0495643_0026223 3300046522 Bacteria 3290
156 Ga0495643_0037213 3300046522 Bacteria 2671
157 Ga0495643_0111053 3300046522 Bacteria 1394
158 Ga0495643_0125753 3300046522 Bacteria 1291
159 Ga0495644_0007833 3300046523 Bacteria 4114
160 Ga0495644_0010248 3300046523 Bacteria 3611
161 Ga0495644_0011796 3300046523 Bacteria 3363
162 Ga0495644_0037548 3300046523 Bacteria 1828
163 Ga0495648_0000006 3300046524 Bacteria 361208
164 Ga0495648_0000073 3300046524 Bacteria 130626
165 Ga0495648_0001885 3300046524 Bacteria 20052
166 Ga0495648_0003445 3300046524 Bacteria 13913
167 Ga0495648_0006052 3300046524 Bacteria 9925
168 Ga0495648_0007673 3300046524 Bacteria 8603
169 Ga0495648_0010742 3300046524 Bacteria 6952
170 Ga0495648_0017678 3300046524 Bacteria 5087
171 Ga0495648_0063652 3300046524 Bacteria 2177
172 Ga0495663_0000743 3300046525 Bacteria 11215
173 Ga0495663_0020170 3300046525 Bacteria 1912
174 Ga0495666_0002158 3300046526 Bacteria 9778
175 Ga0495666_0025401 3300046526 Bacteria 2924
176 Ga0495666_0031083 3300046526 Bacteria 2617
177 Ga0495642_0000405 3300046528 Bacteria 23196
178 Ga0495642_0000939 3300046528 Bacteria 13643
179 Ga0495642_0002171 3300046528 Bacteria 8056
180 Ga0495642_0003830 3300046528 Bacteria 5899
181 Ga0495642_0003981 3300046528 Bacteria 5772
182 Ga0495642_0005558 3300046528 Bacteria 4846
183 Ga0495642_0011747 3300046528 Bacteria 3372
184 Ga0495642_0015276 3300046528 Bacteria 2982
185 Ga0495642_0015361 3300046528 Bacteria 2975
186 Ga0495642_0017337 3300046528 Bacteria 2814
187 Ga0495642_0041127 3300046528 Bacteria 1879
188 Ga0495652_0001082 3300046529 Bacteria 30856
189 Ga0495654_0000022 3300046530 Bacteria 260104
190 Ga0495654_0001583 3300046530 Bacteria 15445
191 Ga0495654_0001792 3300046530 Bacteria 14303
192 Ga0495654_0017046 3300046530 Bacteria 3824
193 Ga0495665_0002185 3300046531 Bacteria 10580
194 Ga0495665_0114067 3300046531 Bacteria 1416
195 Ga0495640_0043547 3300046533 Bacteria 3125
196 Ga0495586_0010722 3300046535 Bacteria 4875
197 Ga0495586_0031915 3300046535 Bacteria 2823
198 Ga0495587_0009906 3300046536 Bacteria 6081
199 Ga0495609_0001000 3300046538 Bacteria 20077
200 Ga0495609_0005317 3300046538 Bacteria 6807
201 Ga0495609_0005914 3300046538 Bacteria 6322
202 Ga0495609_0007165 3300046538 Bacteria 5602
203 Ga0495609_0007396 3300046538 Bacteria 5487
204 Ga0495609_0009860 3300046538 Bacteria 4605
205 Ga0495609_0014410 3300046538 Bacteria 3716
206 Ga0495609_0019565 3300046538 Bacteria 3131
207 Ga0495597_0000091 3300046542 Bacteria 80111
208 Ga0495597_0000223 3300046542 Bacteria 51556
209 Ga0495597_0000475 3300046542 Bacteria 34029
210 Ga0495597_0000592 3300046542 Bacteria 29840
211 Ga0495597_0000617 3300046542 Bacteria 29041
212 Ga0495597_0000794 3300046542 Bacteria 24955
213 Ga0495597_0003224 3300046542 Bacteria 9700
214 Ga0495597_0018688 3300046542 Bacteria 3250
215 Ga0495622_0000013 3300046557 Bacteria 186778
216 Ga0495622_0000322 3300046557 Bacteria 35249
217 Ga0495622_0021968 3300046557 Bacteria 2972
218 Ga0495622_0038272 3300046557 Bacteria 2233
219 Ga0495633_0000158 3300046558 Bacteria 88850
220 Ga0495633_0000442 3300046558 Bacteria 42817
221 Ga0495633_0001067 3300046558 Bacteria 22186
222 Ga0495633_0004993 3300046558 Bacteria 8275
223 Ga0495633_0015338 3300046558 Bacteria 3976
224 Ga0495633_0016224 3300046558 Bacteria 3848
225 Ga0495633_0025179 3300046558 Bacteria 2931
226 Ga0495633_0025357 3300046558 Bacteria 2920
227 Ga0495633_0032275 3300046558 Bacteria 2531
228 Ga0495633_0038811 3300046558 Bacteria 2273
229 Ga0495633_0043679 3300046558 Bacteria 2125
230 Ga0495633_0166858 3300046558 Bacteria 1015
231 Ga0495656_0002311 3300046615 Bacteria 6304
232 Ga0495656_0012903 3300046615 Bacteria 3096
233 Ga0495656_0035900 3300046615 Bacteria 2039
234 Ga0495668_0000119 3300046616 Bacteria 118812
235 Ga0495668_0000420 3300046616 Bacteria 55257
236 Ga0495668_0001552 3300046616 Bacteria 21773
237 Ga0495668_0002053 3300046616 Bacteria 17496
238 Ga0495668_0003529 3300046616 Bacteria 11646
239 Ga0495668_0004404 3300046616 Bacteria 10019
240 Ga0495668_0011276 3300046616 Bacteria 5362
241 Ga0495668_0013873 3300046616 Bacteria 4739
242 Ga0495668_0015634 3300046616 Bacteria 4427
243 Ga0495668_0019432 3300046616 Bacteria 3916
244 Ga0495668_0033588 3300046616 Bacteria 2881
245 Ga0495668_0053072 3300046616 Bacteria 2242
246 Ga0495634_0022041 3300046642 Bacteria 4491
247 Ga0495611_0000388 3300046648 Bacteria 27907
248 Ga0495611_0000698 3300046648 Bacteria 19010
249 Ga0495611_0002276 3300046648 Bacteria 8889
250 Ga0495611_0005126 3300046648 Bacteria 5613
251 Ga0495611_0008783 3300046648 Bacteria 4273
252 Ga0495611_0024292 3300046648 Bacteria 2636
253 Ga0495611_0029432 3300046648 Bacteria 2408
254 Ga0495625_0001864 3300046660 Bacteria 23968
255 Ga0495625_0002373 3300046660 Bacteria 20480
256 Ga0495625_0004117 3300046660 Bacteria 13875
257 Ga0495625_0006702 3300046660 Bacteria 10212
258 Ga0495625_0010822 3300046660 Bacteria 7507
259 Ga0495625_0028182 3300046660 Bacteria 4215
260 Ga0495625_0074250 3300046660 Bacteria 2382
261 Ga0495635_0016912 3300046663 Bacteria 5094
262 Ga0495661_0000721 3300046665 Bacteria 32506
263 Ga0495661_0001149 3300046665 Bacteria 23111
264 Ga0495661_0007987 3300046665 Bacteria 7346
265 Ga0495661_0010199 3300046665 Bacteria 6419
266 Ga0495661_0016636 3300046665 Bacteria 4869
267 Ga0495661_0021099 3300046665 Bacteria 4249
268 Ga0495661_0028232 3300046665 Bacteria 3595
269 Ga0495661_0032507 3300046665 Bacteria 3297
270 Ga0495661_0034281 3300046665 Bacteria 3194
271 Ga0495661_0037378 3300046665 Bacteria 3032
272 Ga0495661_0055414 3300046665 Bacteria 2376
273 Ga0495661_0066059 3300046665 Bacteria 2129
274 Ga0495661_0067244 3300046665 Bacteria 2105
275 Ga0495661_0099236 3300046665 Bacteria 1642
276 Ga0495588_0002889 3300046674 Bacteria 7406
277 Ga0495588_0006923 3300046674 Bacteria 5138
278 Ga0495588_0095302 3300046674 Bacteria 1560
279 Ga0495623_0006214 3300046679 Bacteria 7766
280 Ga0495623_0046011 3300046679 Bacteria 2770
281 Ga0495669_0001478 3300046684 Bacteria 9690
282 Ga0495669_0005010 3300046684 Bacteria 5506
283 Ga0495669_0006985 3300046684 Bacteria 4727
284 Ga0495669_0022671 3300046684 Bacteria 2728
285 Ga0495669_0026208 3300046684 Bacteria 2546
286 Ga0495669_0031013 3300046684 Bacteria 2346
287 Ga0495669_0157666 3300046684 Bacteria 1076
288 Ga0495613_0005690 3300046689 Bacteria 9340
289 Ga0495670_0000118 3300046691 Bacteria 34643
290 Ga0495670_0002787 3300046691 Bacteria 8643
291 Ga0495670_0003156 3300046691 Bacteria 8122
292 Ga0495670_0005643 3300046691 Bacteria 6135
293 Ga0495670_0007165 3300046691 Bacteria 5491
294 Ga0495670_0014301 3300046691 Bacteria 3903
295 Ga0495670_0019687 3300046691 Bacteria 3326
296 Ga0495670_0045563 3300046691 Bacteria 2190
297 Ga0495670_0069359 3300046691 Bacteria 1782
298 Ga0495671_0000064 3300046692 Bacteria 106374
299 Ga0495671_0002870 3300046692 Bacteria 10776
300 Ga0495671_0013275 3300046692 Bacteria 4468
301 Ga0495671_0023629 3300046692 Bacteria 3210
302 Ga0495671_0059307 3300046692 Bacteria 1892
303 Ga0495649_0001108 3300046694 Bacteria 20990
304 Ga0495649_0001691 3300046694 Bacteria 16345
305 Ga0495649_0002571 3300046694 Bacteria 12703
306 Ga0495649_0002828 3300046694 Bacteria 12048
307 Ga0495649_0004390 3300046694 Bacteria 9223
308 Ga0495649_0026996 3300046694 Bacteria 3188
309 Ga0495649_0048842 3300046694 Bacteria 2299
310 Ga0495649_0063510 3300046694 Bacteria 1983
311 Ga0495649_0121968 3300046694 Bacteria 1378
312 Ga0495589_0000688 3300046794 Bacteria 22021
313 Ga0495589_0005007 3300046794 Bacteria 7017
314 Ga0495589_0016234 3300046794 Bacteria 3826
315 Ga0495589_0016317 3300046794 Bacteria 3818
316 Ga0495589_0032555 3300046794 Bacteria 2621
317 Ga0495589_0065010 3300046794 Bacteria 1788
318 Ga0495600_0004932 3300046809 Bacteria 8013
319 Ga0495600_0010542 3300046809 Bacteria 5740
320 Ga0495660_0001936 3300046810 Bacteria 13477
321 Ga0495660_0004305 3300046810 Bacteria 8633
322 Ga0495660_0017458 3300046810 Bacteria 4131
323 Ga0495660_0020608 3300046810 Bacteria 3779
324 Ga0495660_0031010 3300046810 Bacteria 3008
325 Ga0495660_0064122 3300046810 Bacteria 1964
326 Ga0495660_0084696 3300046810 Bacteria 1657
327 Ga0495581_0098470 3300047315 Bacteria 1698
328 Ga0495604_0007623 3300047317 Bacteria 8569
329 Ga0495604_0011005 3300047317 Bacteria 7182
330 Ga0495604_0019145 3300047317 Bacteria 5482
331 Ga0495674_0016383 3300047319 Bacteria 6912
332 Ga0495672_0000197 3300047320 Bacteria 86233
333 Ga0495672_0000412 3300047320 Bacteria 51876
334 Ga0495672_0000656 3300047320 Bacteria 38441
335 Ga0495672_0004884 3300047320 Bacteria 10780
336 Ga0495672_0013029 3300047320 Bacteria 5756
337 Ga0495672_0031995 3300047320 Bacteria 3277
338 Ga0495672_0105524 3300047320 Bacteria 1520
339 Ga0495676_0000075 3300047321 Bacteria 73476
340 Ga0495676_0010369 3300047321 Bacteria 8451
341 Ga0495680_0025592 3300047322 Bacteria 4881
342 Ga0495680_0089748 3300047322 Bacteria 2307
343 Ga0495680_0224543 3300047322 Bacteria 1339
344 Ga0495683_0000052 3300047323 Bacteria 121895
345 Ga0495683_0002274 3300047323 Bacteria 11720
346 Ga0495683_0005616 3300047323 Bacteria 6947
347 Ga0495683_0007227 3300047323 Bacteria 6027
348 Ga0495683_0052075 3300047323 Bacteria 2044
349 Ga0495683_0072763 3300047323 Bacteria 1686
350 Ga0495683_0102946 3300047323 Bacteria 1371
351 Ga0495687_000115 3300047443 Bacteria 122883
352 Ga0495687_000488 3300047443 Bacteria 47978
353 Ga0495687_001414 3300047443 Bacteria 22102
354 Ga0495687_007353 3300047443 Bacteria 6504
355 Ga0495687_039315 3300047443 Bacteria 2094
356 Ga0495675_0000427 3300047444 Bacteria 28155
357 Ga0495675_0001177 3300047444 Bacteria 15871
358 Ga0495675_0146815 3300047444 Bacteria 1459
359 Ga0495677_0000310 3300047445 Bacteria 21153
360 Ga0495677_0000551 3300047445 Bacteria 15521
361 Ga0495677_0005370 3300047445 Bacteria 4862
362 Ga0495677_0005416 3300047445 Bacteria 4837
363 Ga0495677_0006623 3300047445 Bacteria 4367
364 Ga0495677_0011045 3300047445 Bacteria 3309
365 Ga0495677_0011141 3300047445 Bacteria 3292
366 Ga0495677_0018348 3300047445 Bacteria 2536
367 Ga0495677_0022770 3300047445 Bacteria 2273
368 Ga0495679_000840 3300047446 Bacteria 19523
369 Ga0495679_003178 3300047446 Bacteria 8008
370 Ga0495679_012692 3300047446 Bacteria 3192
371 Ga0495685_007726 3300047447 Bacteria 3558
372 Ga0495673_0000008 3300047469 Bacteria 752462
373 Ga0495673_0000009 3300047469 Bacteria 731993
374 Ga0495673_0000012 3300047469 Bacteria 656908
375 Ga0495681_0000492 3300047470 Bacteria 30331
376 Ga0495681_0001563 3300047470 Bacteria 17059
377 Ga0495681_0002948 3300047470 Bacteria 12016
378 Ga0495681_0004121 3300047470 Bacteria 9989
379 Ga0495681_0008628 3300047470 Bacteria 6363
380 Ga0495681_0009509 3300047470 Bacteria 5981
381 Ga0495681_0010785 3300047470 Bacteria 5503
382 Ga0495681_0014654 3300047470 Bacteria 4480
383 Ga0495681_0040570 3300047470 Bacteria 2265
384 Ga0495686_0000865 3300047472 Bacteria 38738
385 Ga0495686_0002374 3300047472 Bacteria 17929
386 Ga0495686_0009175 3300047472 Bacteria 7159
387 Ga0495686_0073985 3300047472 Bacteria 2091
388 Ga0495593_0000718 3300047673 Bacteria 19183
389 Ga0495602_0002359 3300048088 Bacteria 19114
390 Ga0495602_0096241 3300048088 Bacteria 2442
391 Ga0495614_0004733 3300048089 Bacteria 6135
392 Ga0495615_0043625 3300048090 Bacteria 1129
393 Ga0495626_0000043 3300048091 Bacteria 168109
394 Ga0495626_0001323 3300048091 Bacteria 20181
395 Ga0495626_0002016 3300048091 Bacteria 14949
396 Ga0495626_0002619 3300048091 Bacteria 12247
397 Ga0495626_0003084 3300048091 Bacteria 10926
398 Ga0495626_0005513 3300048091 Bacteria 7373
399 Ga0495626_0011970 3300048091 Bacteria 4565
400 Ga0495626_0016364 3300048091 Bacteria 3769
401 Ga0495626_0025043 3300048091 Bacteria 2921
402 Ga0495626_0029685 3300048091 Bacteria 2644
403 Ga0495626_0032298 3300048091 Bacteria 2514
404 Ga0495626_0041160 3300048091 Bacteria 2178
405 Ga0495626_0055394 3300048091 Bacteria 1817
406 Ga0495626_0062420 3300048091 Bacteria 1692
407 Ga0495626_0076149 3300048091 Bacteria 1498
408 Ga0495626_0080715 3300048091 Bacteria 1445
409 Ga0496100_0024797 3300048903 Bacteria 3662
410 Ga0496101_0030435 3300048904 Bacteria 3784
411 Ga0496102_0114362 3300048905 Bacteria 2518
412 Ga0496103_0007292 3300048906 Bacteria 6590
413 Ga0496109_0001356 3300048912 Bacteria 20273
414 Ga0496110_0001482 3300048913 Bacteria 17008
415 Ga0496111_0065480 3300048914 Bacteria 2638
416 Ga0496112_0096831 3300048915 Bacteria 2921
417 Ga0496113_0002277 3300048916 Bacteria 11077
418 Ga0496115_0067380 3300048918 Bacteria 2895
419 Ga0496115_0077302 3300048918 Bacteria 2706
420 Ga0496115_0099845 3300048918 Bacteria 2379
421 Ga0496121_0021036 3300048924 Bacteria 6416
422 Ga0496122_0000731 3300048925 Bacteria 64230
423 Ga0496122_0026537 3300048925 Bacteria 4989
424 Ga0496123_0001518 3300048926 Bacteria 32147
425 Ga0496124_0040082 3300048927 Bacteria 4054
426 Ga0496124_0044805 3300048927 Bacteria 3794
427 Ga0496124_0082753 3300048927 Bacteria 2634
428 Ga0496124_0105478 3300048927 Bacteria 2277
429 Ga0496124_0319913 3300048927 Bacteria 1111
430 Ga0496125_0001489 3300048928 Bacteria 33623
431 Ga0496126_0118412 3300048929 Bacteria 2299
432 Ga0495678_000051 3300049459 Bacteria 159383
433 Ga0495678_000082 3300049459 Bacteria 118148
434 Ga0495678_000259 3300049459 Bacteria 59034
435 Ga0495678_000367 3300049459 Bacteria 46226
436 Ga0495678_000696 3300049459 Bacteria 30577
437 Ga0495678_001811 3300049459 Bacteria 15735
438 Ga0495678_004029 3300049459 Bacteria 8744
439 Ga0495678_004161 3300049459 Bacteria 8542
440 Ga0495678_053134 3300049459 Bacteria 1557
441 Ga0495682_0000458 3300049460 Bacteria 28126
442 Ga0495682_0019176 3300049460 Bacteria 2573
443 Ga0495682_0052411 3300049460 Bacteria 1482
444 Ga0495682_0060924 3300049460 Bacteria 1362
445 Ga0501249_010485 3300049679 Bacteria 1940
446 Ga0501269_000552 3300049766 Bacteria 7081
447 Ga0501279_011717 3300049775 Bacteria 1189
448 Ga0500618_000256 3300053125 Bacteria 41932
449 Ga0500586_000028 3300053145 Bacteria 25701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046500 Ga0495596_0039938 Ga0495596_0039938_19_915 270
2 3300046810 Ga0495660_0064122 Ga0495660_0064122_1050_1946 270
3 3300046492 Ga0495585_0153287 Ga0495585_0153287_313_1155 271
4 3300046558 Ga0495633_0166858 Ga0495633_0166858_146_988 271
5 3300047323 Ga0495683_0102946 Ga0495683_0102946_253_1230 271
6 3300046615 Ga0495656_0002311 Ga0495656_0002311_1196_2173 273
7 3300047445 Ga0495677_0005370 Ga0495677_0005370_1980_2957 273
8 3300046453 Ga0495627_001852 Ga0495627_001852_9153_10130 274
9 3300046491 Ga0495584_0003132 Ga0495584_0003132_6283_7260 274
10 3300046492 Ga0495585_0005799 Ga0495585_0005799_3434_4411 274
11 3300046507 Ga0495606_0002145 Ga0495606_0002145_10493_11470 274
12 3300046523 Ga0495644_0007833 Ga0495644_0007833_588_1565 274
13 3300046525 Ga0495663_0000743 Ga0495663_0000743_6507_7484 274
14 3300046616 Ga0495668_0003529 Ga0495668_0003529_2861_3838 274
15 3300047470 Ga0495681_0008628 Ga0495681_0008628_3619_4596 274
16 3300046522 Ga0495643_0125753 Ga0495643_0125753_33_860 275
17 3300046694 Ga0495649_0026996 Ga0495649_0026996_1883_2869 276
18 3300048927 Ga0496124_0319913 Ga0496124_0319913_51_1028 277
19 3300038443 Ga0395901_0561801 Ga0395901_0561801_11_850 279
20 3300046459 Ga0495629_0059080 Ga0495629_0059080_1352_2329 279
21 3300046535 Ga0495586_0010722 Ga0495586_0010722_3308_4285 279
22 3300046663 Ga0495635_0016912 Ga0495635_0016912_2751_3728 279
23 3300046689 Ga0495613_0005690 Ga0495613_0005690_7471_8448 279
24 3300047322 Ga0495680_0025592 Ga0495680_0025592_1039_2016 279
25 3300047673 Ga0495593_0000718 Ga0495593_0000718_7376_8353 279
26 3300048089 Ga0495614_0004733 Ga0495614_0004733_463_1440 279
27 3300046491 Ga0495584_0120689 Ga0495584_0120689_453_1298 281
28 3300046684 Ga0495669_0157666 Ga0495669_0157666_164_1009 281
29 3300046694 Ga0495649_0063510 Ga0495649_0063510_1064_1960 282
30 3300021361 Ga0213872_10000567 Ga0213872_1000056719 283
31 3300039447 Ga0436361_1200035 Ga0436361_1200035_11616_12587 283
32 3300046507 Ga0495606_0000046 Ga0495606_0000046_14681_15658 284
33 3300046512 Ga0495610_0005374 Ga0495610_0005374_78_1055 284
34 3300046616 Ga0495668_0000119 Ga0495668_0000119_33873_34850 284
35 3300047472 Ga0495686_0009175 Ga0495686_0009175_3107_4084 284
36 3300046474 Ga0495605_0000127 Ga0495605_0000127_82685_83662 285
37 3300025295 Ga0209564_1000978 Ga0209564_10009787 286
38 3300025728 Ga0207655_1002698 Ga0207655_10026987 286
39 3300046492 Ga0495585_0000822 Ga0495585_0000822_16436_17413 289
40 3300046518 Ga0495631_0000822 Ga0495631_0000822_3607_4584 289
41 3300046558 Ga0495633_0016224 Ga0495633_0016224_688_1665 289
42 3300046616 Ga0495668_0019432 Ga0495668_0019432_2546_3523 289
43 3300046648 Ga0495611_0024292 Ga0495611_0024292_1130_2107 289
44 3300046665 Ga0495661_0000721 Ga0495661_0000721_16200_17177 289
45 3300046691 Ga0495670_0000118 Ga0495670_0000118_16345_17322 289
46 3300047323 Ga0495683_0072763 Ga0495683_0072763_341_1318 289
47 3300047445 Ga0495677_0005416 Ga0495677_0005416_2774_3751 289
48 3300047470 Ga0495681_0000492 Ga0495681_0000492_16689_17666 289
49 3300048913 Ga0496110_0001482 Ga0496110_0001482_2839_3816 289
50 3300046457 Ga0495590_0018471 Ga0495590_0018471_1153_2124 291
51 3300046506 Ga0495583_0011568 Ga0495583_0011568_1500_2471 291
52 3300046513 Ga0495616_0108052 Ga0495616_0108052_202_1173 291
53 3300046518 Ga0495631_0000957 Ga0495631_0000957_16828_17799 291
54 3300046520 Ga0495637_0011596 Ga0495637_0011596_527_1498 291
55 3300046522 Ga0495643_0037213 Ga0495643_0037213_458_1429 291
56 3300046524 Ga0495648_0006052 Ga0495648_0006052_987_1958 291
57 3300046530 Ga0495654_0001583 Ga0495654_0001583_14448_15419 291
58 3300046538 Ga0495609_0007165 Ga0495609_0007165_3217_4188 291
59 3300046616 Ga0495668_0000420 Ga0495668_0000420_45518_46489 291
60 3300046660 Ga0495625_0004117 Ga0495625_0004117_567_1538 291
61 3300046665 Ga0495661_0066059 Ga0495661_0066059_1095_2066 291
62 3300047446 Ga0495679_000840 Ga0495679_000840_4033_5004 291
63 3300047447 Ga0495685_007726 Ga0495685_007726_967_1938 291
64 3300049459 Ga0495678_000367 Ga0495678_000367_17468_18439 291
65 3300003771 Ga0055526_1000030 Ga0055526_100003016 292
66 3300021361 Ga0213872_10003014 Ga0213872_100030149 292
67 3300025295 Ga0209564_1000010 Ga0209564_1000010121 292
68 3300039447 Ga0436361_0054112 Ga0436361_0054112_5978_6949 292
69 3300046457 Ga0495590_0058805 Ga0495590_0058805_132_1106 293
70 3300046507 Ga0495606_0017712 Ga0495606_0017712_2542_3519 293
71 3300047320 Ga0495672_0000656 Ga0495672_0000656_17192_18169 293
72 3300047320 Ga0495672_0105524 Ga0495672_0105524_451_1428 294
73 3300048905 Ga0496102_0114362 Ga0496102_0114362_1314_2291 296
74 3300046458 Ga0495591_009167 Ga0495591_009167_2374_3351 297
75 3300046474 Ga0495605_0021211 Ga0495605_0021211_1288_2265 297
76 3300046501 Ga0495607_0019594 Ga0495607_0019594_3196_4173 297
77 3300046513 Ga0495616_0014750 Ga0495616_0014750_1542_2519 297
78 3300046519 Ga0495632_0006414 Ga0495632_0006414_4946_5923 297
79 3300046520 Ga0495637_0007035 Ga0495637_0007035_1592_2569 297
80 3300046528 Ga0495642_0002171 Ga0495642_0002171_431_1408 297
81 3300046538 Ga0495609_0005914 Ga0495609_0005914_5066_6043 297
82 3300046542 Ga0495597_0000794 Ga0495597_0000794_8667_9641 297
83 3300046684 Ga0495669_0031013 Ga0495669_0031013_409_1386 297
84 3300046691 Ga0495670_0002787 Ga0495670_0002787_6284_7261 297
85 3300046794 Ga0495589_0000688 Ga0495589_0000688_7995_8969 297
86 3300047320 Ga0495672_0004884 Ga0495672_0004884_7680_8657 297
87 3300047445 Ga0495677_0011045 Ga0495677_0011045_1724_2701 297
88 3300047470 Ga0495681_0010785 Ga0495681_0010785_3156_4133 297
89 3300048091 Ga0495626_0016364 Ga0495626_0016364_410_1387 297
90 3300048924 Ga0496121_0021036 Ga0496121_0021036_26_1003 297
91 3300049460 Ga0495682_0060924 Ga0495682_0060924_97_1074 297
92 3300039447 Ga0436361_1123781 Ga0436361_1123781_6966_7937 298
93 3300046491 Ga0495584_0002480 Ga0495584_0002480_6861_7838 298
94 3300046507 Ga0495606_0035385 Ga0495606_0035385_2202_3179 298
95 3300046531 Ga0495665_0114067 Ga0495665_0114067_334_1311 298
96 3300046558 Ga0495633_0038811 Ga0495633_0038811_925_1902 298
97 3300047444 Ga0495675_0001177 Ga0495675_0001177_13472_14449 298
98 3300048929 Ga0496126_0118412 Ga0496126_0118412_1130_2107 298
99 3300046692 Ga0495671_0000064 Ga0495671_0000064_100959_101936 299
100 3300025245 Ga0207425_1000317 Ga0207425_10003173 300
101 3300025294 Ga0209025_1007506 Ga0209025_10075067 300
102 3300025297 Ga0209758_1003573 Ga0209758_100357312 300
103 3300046500 Ga0495596_0006694 Ga0495596_0006694_475_1452 300
104 3300046542 Ga0495597_0003224 Ga0495597_0003224_1027_2004 300
105 3300046692 Ga0495671_0059307 Ga0495671_0059307_380_1357 300
106 3300046463 Ga0495653_0000016 Ga0495653_0000016_195675_196652 301
107 3300046507 Ga0495606_0002280 Ga0495606_0002280_4590_5567 301
108 3300046460 Ga0495638_0028833 Ga0495638_0028833_2196_3167 302
109 3300046471 Ga0495650_0000201 Ga0495650_0000201_9224_10201 302
110 3300046538 Ga0495609_0007396 Ga0495609_0007396_1393_2364 302
111 3300046542 Ga0495597_0000617 Ga0495597_0000617_12727_13698 302
112 3300046616 Ga0495668_0013873 Ga0495668_0013873_3729_4706 302
113 3300046694 Ga0495649_0048842 Ga0495649_0048842_549_1520 302
114 3300047472 Ga0495686_0002374 Ga0495686_0002374_16251_17222 302
115 3300048088 Ga0495602_0096241 Ga0495602_0096241_412_1389 302
116 3300048927 Ga0496124_0040082 Ga0496124_0040082_1644_2621 302
117 3300046526 Ga0495666_0002158 Ga0495666_0002158_2950_3927 303
118 3300046533 Ga0495640_0043547 Ga0495640_0043547_1458_2435 303
119 3300047317 Ga0495604_0011005 Ga0495604_0011005_4878_5855 303
120 3300048914 Ga0496111_0065480 Ga0496111_0065480_1187_2158 303
121 3300047469 Ga0495673_0000012 Ga0495673_0000012_11705_12682 304
122 3300047472 Ga0495686_0000865 Ga0495686_0000865_17103_18083 304
123 3300046471 Ga0495650_0000489 Ga0495650_0000489_16287_17264 305
124 3300046471 Ga0495650_0002644 Ga0495650_0002644_9353_10330 306
125 3300046475 Ga0495639_0027618 Ga0495639_0027618_923_1900 306
126 3300046501 Ga0495607_0002303 Ga0495607_0002303_2252_3229 306
127 3300046506 Ga0495583_0001632 Ga0495583_0001632_3634_4611 306
128 3300046507 Ga0495606_0001871 Ga0495606_0001871_10812_11789 306
129 3300046524 Ga0495648_0000006 Ga0495648_0000006_262705_263682 306
130 3300046528 Ga0495642_0003830 Ga0495642_0003830_2196_3173 306
131 3300046538 Ga0495609_0009860 Ga0495609_0009860_1893_2870 306
132 3300046557 Ga0495622_0000013 Ga0495622_0000013_103362_104351 306
133 3300046557 Ga0495622_0000322 Ga0495622_0000322_17167_18144 306
134 3300046558 Ga0495633_0000158 Ga0495633_0000158_50475_51452 306
135 3300046660 Ga0495625_0001864 Ga0495625_0001864_9941_10918 306
136 3300048090 Ga0495615_0043625 Ga0495615_0043625_16_993 306
137 3300049459 Ga0495678_004029 Ga0495678_004029_5874_6851 306
138 3300046558 Ga0495633_0000442 Ga0495633_0000442_24043_25020 307
139 3300046520 Ga0495637_0000150 Ga0495637_0000150_35856_36833 308
140 3300046530 Ga0495654_0000022 Ga0495654_0000022_249787_250764 308
141 3300048091 Ga0495626_0076149 Ga0495626_0076149_168_1121 308
142 3300046660 Ga0495625_0028182 Ga0495625_0028182_961_1935 309
143 3300046674 Ga0495588_0095302 Ga0495588_0095302_92_1066 309
144 3300049679 Ga0501249_010485 Ga0501249_010485_535_1512 309
145 3300049766 Ga0501269_000552 Ga0501269_000552_579_1556 309
146 3300046674 Ga0495588_0006923 Ga0495588_0006923_3098_4075 310
147 3300021361 Ga0213872_10000041 Ga0213872_1000004114 312
148 3300039447 Ga0436361_0438991 Ga0436361_0438991_24743_25717 312
149 3300046500 Ga0495596_0002515 Ga0495596_0002515_4915_5892 312
150 3300046794 Ga0495589_0032555 Ga0495589_0032555_487_1464 312
151 3300047320 Ga0495672_0031995 Ga0495672_0031995_2047_3024 312
152 3300047445 Ga0495677_0011141 Ga0495677_0011141_474_1451 312
153 3300048091 Ga0495626_0005513 Ga0495626_0005513_4364_5341 312
154 3300046522 Ga0495643_0000912 Ga0495643_0000912_17533_18510 313
155 3300046542 Ga0495597_0000223 Ga0495597_0000223_43638_44612 314
156 3300048918 Ga0496115_0067380 Ga0496115_0067380_1436_2413 314
157 3300049459 Ga0495678_053134 Ga0495678_053134_232_1209 314
158 3300046501 Ga0495607_0001313 Ga0495607_0001313_12000_12977 315
159 3300046506 Ga0495583_0029917 Ga0495583_0029917_644_1618 315
160 3300046507 Ga0495606_0088762 Ga0495606_0088762_507_1481 315
161 3300046519 Ga0495632_0000666 Ga0495632_0000666_12938_13915 315
162 3300047443 Ga0495687_000488 Ga0495687_000488_40638_41609 315
163 3300047445 Ga0495677_0006623 Ga0495677_0006623_1013_1990 315
164 3300046492 Ga0495585_0056642 Ga0495585_0056642_322_1296 316
165 3300046512 Ga0495610_0000027 Ga0495610_0000027_157107_158084 316
166 3300046524 Ga0495648_0001885 Ga0495648_0001885_3916_4893 316
167 3300046528 Ga0495642_0015361 Ga0495642_0015361_722_1696 316
168 3300046557 Ga0495622_0021968 Ga0495622_0021968_136_1113 316
169 3300047321 Ga0495676_0000075 Ga0495676_0000075_17886_18863 316
170 3300047323 Ga0495683_0007227 Ga0495683_0007227_784_1761 316
171 3300047443 Ga0495687_007353 Ga0495687_007353_2237_3214 316
172 3300046452 Ga0495617_000025 Ga0495617_000025_4744_5721 317
173 3300046524 Ga0495648_0017678 Ga0495648_0017678_3510_4487 317
174 3300046530 Ga0495654_0017046 Ga0495654_0017046_1008_1985 317
175 3300046692 Ga0495671_0023629 Ga0495671_0023629_822_1799 317
176 3300046810 Ga0495660_0020608 Ga0495660_0020608_1622_2599 317
177 3300047446 Ga0495679_012692 Ga0495679_012692_1437_2414 317
178 3300048925 Ga0496122_0026537 Ga0496122_0026537_2699_3676 317
179 3300048927 Ga0496124_0105478 Ga0496124_0105478_893_1870 317
180 3300046557 Ga0495622_0038272 Ga0495622_0038272_537_1511 318
181 3300047315 Ga0495581_0098470 Ga0495581_0098470_347_1321 318
182 3300053125 Ga0500618_000256 Ga0500618_000256_24334_25311 319
183 3300046542 Ga0495597_0018688 Ga0495597_0018688_1528_2490 320
184 iso_pu_bacteria 2808606418 2809146073 320
185 iso_pu_bacteria 2738541297 2738826583 321
186 iso_pu_bacteria 2738541357 2739150380 321
187 iso_pu_bacteria 2738543003 2739192299 321
188 iso_pu_bacteria 2738543026 2739318776 321
189 iso_pu_bacteria 2738543029 2739337017 321
190 iso_pu_bacteria 2821131069 2821135297 321
191 iso_pu_bacteria 2842711865 2842717356 321
192 iso_pu_bacteria 2857558681 2857562211 321
193 iso_pu_bacteria 2857564685 2857567770 321
194 iso_pu_bacteria 2904424332 2904427976 321
195 3300005262 Ga0065165_1000578 Ga0065165_100057837 323
196 3300037471 Ga0395905_0121797 Ga0395905_0121797_409_1380 323
197 3300046453 Ga0495627_014150 Ga0495627_014150_86_1057 323
198 3300046458 Ga0495591_000034 Ga0495591_000034_157216_158187 323
199 3300046474 Ga0495605_0001346 Ga0495605_0001346_6197_7168 323
200 3300046491 Ga0495584_0000807 Ga0495584_0000807_12502_13473 323
201 3300046492 Ga0495585_0003075 Ga0495585_0003075_6429_7400 323
202 3300046492 Ga0495585_0008013 Ga0495585_0008013_1292_2263 323
203 3300046492 Ga0495585_0014162 Ga0495585_0014162_1293_2264 323
204 3300046499 Ga0495594_0011768 Ga0495594_0011768_1970_2941 323
205 3300046500 Ga0495596_0009912 Ga0495596_0009912_2860_3831 323
206 3300046501 Ga0495607_0001804 Ga0495607_0001804_16106_17077 323
207 3300046506 Ga0495583_0001103 Ga0495583_0001103_20914_21885 323
208 3300046506 Ga0495583_0008511 Ga0495583_0008511_4531_5502 323
209 3300046506 Ga0495583_0011384 Ga0495583_0011384_3769_4740 323
210 3300046512 Ga0495610_0000775 Ga0495610_0000775_27576_28547 323
211 3300046513 Ga0495616_0003772 Ga0495616_0003772_6394_7365 323
212 3300046513 Ga0495616_0036647 Ga0495616_0036647_878_1849 323
213 3300046513 Ga0495616_0050164 Ga0495616_0050164_732_1703 323
214 3300046513 Ga0495616_0082368 Ga0495616_0082368_95_1066 323
215 3300046518 Ga0495631_0000881 Ga0495631_0000881_14903_15874 323
216 3300046518 Ga0495631_0005417 Ga0495631_0005417_3068_4039 323
217 3300046518 Ga0495631_0010643 Ga0495631_0010643_3116_4087 323
218 3300046519 Ga0495632_0002285 Ga0495632_0002285_13041_14012 323
219 3300046520 Ga0495637_0000003 Ga0495637_0000003_525550_526521 323
220 3300046523 Ga0495644_0010248 Ga0495644_0010248_545_1516 323
221 3300046523 Ga0495644_0011796 Ga0495644_0011796_1655_2626 323
222 3300046524 Ga0495648_0010742 Ga0495648_0010742_1760_2731 323
223 3300046524 Ga0495648_0063652 Ga0495648_0063652_327_1298 323
224 3300046525 Ga0495663_0020170 Ga0495663_0020170_308_1279 323
225 3300046528 Ga0495642_0011747 Ga0495642_0011747_2262_3233 323
226 3300046528 Ga0495642_0017337 Ga0495642_0017337_1358_2329 323
227 3300046528 Ga0495642_0041127 Ga0495642_0041127_131_1102 323
228 3300046558 Ga0495633_0001067 Ga0495633_0001067_9135_10106 323
229 3300046558 Ga0495633_0043679 Ga0495633_0043679_572_1543 323
230 3300046615 Ga0495656_0012903 Ga0495656_0012903_704_1675 323
231 3300046616 Ga0495668_0033588 Ga0495668_0033588_1135_2106 323
232 3300046648 Ga0495611_0000388 Ga0495611_0000388_6679_7650 323
233 3300046648 Ga0495611_0000698 Ga0495611_0000698_13272_14243 323
234 3300046660 Ga0495625_0006702 Ga0495625_0006702_8583_9554 323
235 3300046665 Ga0495661_0007987 Ga0495661_0007987_2302_3273 323
236 3300046665 Ga0495661_0028232 Ga0495661_0028232_1922_2893 323
237 3300046665 Ga0495661_0032507 Ga0495661_0032507_672_1643 323
238 3300046665 Ga0495661_0034281 Ga0495661_0034281_1959_2930 323
239 3300046665 Ga0495661_0067244 Ga0495661_0067244_181_1152 323
240 3300046684 Ga0495669_0001478 Ga0495669_0001478_1092_2063 323
241 3300046684 Ga0495669_0026208 Ga0495669_0026208_1067_2038 323
242 3300046692 Ga0495671_0013275 Ga0495671_0013275_2179_3150 323
243 3300046694 Ga0495649_0001108 Ga0495649_0001108_12958_13929 323
244 3300046694 Ga0495649_0004390 Ga0495649_0004390_4614_5585 323
245 3300046794 Ga0495589_0016234 Ga0495589_0016234_2414_3385 323
246 3300046794 Ga0495589_0016317 Ga0495589_0016317_683_1654 323
247 3300046810 Ga0495660_0017458 Ga0495660_0017458_2510_3481 323
248 3300046810 Ga0495660_0084696 Ga0495660_0084696_651_1622 323
249 3300047320 Ga0495672_0000197 Ga0495672_0000197_66732_67703 323
250 3300047323 Ga0495683_0000052 Ga0495683_0000052_38863_39834 323
251 3300047443 Ga0495687_000115 Ga0495687_000115_106720_107691 323
252 3300047443 Ga0495687_001414 Ga0495687_001414_11233_12204 323
253 3300047445 Ga0495677_0000310 Ga0495677_0000310_7161_8132 323
254 3300047445 Ga0495677_0022770 Ga0495677_0022770_362_1333 323
255 3300047446 Ga0495679_003178 Ga0495679_003178_651_1622 323
256 3300047470 Ga0495681_0001563 Ga0495681_0001563_11626_12597 323
257 3300047470 Ga0495681_0004121 Ga0495681_0004121_2446_3417 323
258 3300047470 Ga0495681_0014654 Ga0495681_0014654_843_1814 323
259 3300047470 Ga0495681_0040570 Ga0495681_0040570_1218_2189 323
260 3300047472 Ga0495686_0073985 Ga0495686_0073985_465_1436 323
261 3300048091 Ga0495626_0002619 Ga0495626_0002619_2176_3147 323
262 3300048091 Ga0495626_0003084 Ga0495626_0003084_9428_10399 323
263 3300048091 Ga0495626_0032298 Ga0495626_0032298_787_1758 323
264 3300048091 Ga0495626_0062420 Ga0495626_0062420_28_999 323
265 3300048927 Ga0496124_0044805 Ga0496124_0044805_2378_3349 323
266 3300049459 Ga0495678_000051 Ga0495678_000051_146954_147925 323
267 3300049459 Ga0495678_000082 Ga0495678_000082_105219_106190 323
268 3300049460 Ga0495682_0000458 Ga0495682_0000458_17588_18559 323
269 3300049460 Ga0495682_0019176 Ga0495682_0019176_1138_2109 323
270 3300046492 Ga0495585_0000809 Ga0495585_0000809_7204_8178 324
271 3300046500 Ga0495596_0000806 Ga0495596_0000806_4823_5797 324
272 3300046513 Ga0495616_0029102 Ga0495616_0029102_491_1465 324
273 3300046558 Ga0495633_0025357 Ga0495633_0025357_866_1840 324
274 3300046665 Ga0495661_0099236 Ga0495661_0099236_268_1242 324
275 3300046684 Ga0495669_0022671 Ga0495669_0022671_1189_2163 324
276 3300046691 Ga0495670_0014301 Ga0495670_0014301_2421_3395 324
277 3300046809 Ga0495600_0010542 Ga0495600_0010542_1158_2132 324
278 3300046810 Ga0495660_0031010 Ga0495660_0031010_782_1756 324
279 3300047319 Ga0495674_0016383 Ga0495674_0016383_3432_4406 324
280 3300047321 Ga0495676_0010369 Ga0495676_0010369_532_1506 324
281 3300047322 Ga0495680_0089748 Ga0495680_0089748_303_1277 324
282 3300047443 Ga0495687_039315 Ga0495687_039315_677_1651 324
283 3300047444 Ga0495675_0146815 Ga0495675_0146815_119_1093 324
284 3300003322 rootL2_10016202 rootL2_100162026 325
285 3300003322 rootL2_10029269 rootL2_1002926924 325
286 3300003763 Ga0055529_1000097 Ga0055529_100009738 325
287 3300005564 Ga0070664_100170969 Ga0070664_1001709692 325
288 3300009036 Ga0105244_10001062 Ga0105244_100010627 325
289 3300025233 Ga0209437_113372 Ga0209437_1133722 325
290 3300025246 Ga0209646_1000272 Ga0209646_100027240 325
291 3300025272 Ga0209455_1000031 Ga0209455_1000031402 325
292 3300025728 Ga0207655_1002753 Ga0207655_10027537 325
293 3300030744 Ga0316181_1095903 Ga0316181_10959033 325
294 3300031711 Ga0265314_10024957 Ga0265314_100249572 325
295 3300037471 Ga0395905_0396315 Ga0395905_0396315_187_1164 325
296 3300046452 Ga0495617_003744 Ga0495617_003744_3011_3988 325
297 3300046455 Ga0495603_0035118 Ga0495603_0035118_759_1736 325
298 3300046457 Ga0495590_0000014 Ga0495590_0000014_157399_158376 325
299 3300046457 Ga0495590_0003328 Ga0495590_0003328_4322_5299 325
300 3300046460 Ga0495638_0025898 Ga0495638_0025898_2748_3725 325
301 3300046463 Ga0495653_0076873 Ga0495653_0076873_1168_2145 325
302 3300046471 Ga0495650_0000136 Ga0495650_0000136_163050_164027 325
303 3300046471 Ga0495650_0001615 Ga0495650_0001615_16827_17804 325
304 3300046471 Ga0495650_0026444 Ga0495650_0026444_494_1471 325
305 3300046472 Ga0495580_0024491 Ga0495580_0024491_1578_2555 325
306 3300046473 Ga0495582_0001809 Ga0495582_0001809_5822_6799 325
307 3300046473 Ga0495582_0050524 Ga0495582_0050524_662_1639 325
308 3300046474 Ga0495605_0007903 Ga0495605_0007903_4960_5937 325
309 3300046475 Ga0495639_0085985 Ga0495639_0085985_149_1126 325
310 3300046491 Ga0495584_0004324 Ga0495584_0004324_3435_4412 325
311 3300046492 Ga0495585_0000043 Ga0495585_0000043_51226_52203 325
312 3300046492 Ga0495585_0001697 Ga0495585_0001697_5142_6119 325
313 3300046492 Ga0495585_0023878 Ga0495585_0023878_463_1440 325
314 3300046492 Ga0495585_0025643 Ga0495585_0025643_1767_2744 325
315 3300046492 Ga0495585_0039087 Ga0495585_0039087_920_1897 325
316 3300046499 Ga0495594_0002718 Ga0495594_0002718_4737_5714 325
317 3300046499 Ga0495594_0006482 Ga0495594_0006482_673_1650 325
318 3300046499 Ga0495594_0008266 Ga0495594_0008266_2496_3473 325
319 3300046500 Ga0495596_0035355 Ga0495596_0035355_505_1482 325
320 3300046501 Ga0495607_0015393 Ga0495607_0015393_3337_4314 325
321 3300046501 Ga0495607_0057216 Ga0495607_0057216_1215_2192 325
322 3300046506 Ga0495583_0000137 Ga0495583_0000137_27530_28507 325
323 3300046506 Ga0495583_0001202 Ga0495583_0001202_14562_15539 325
324 3300046507 Ga0495606_0000807 Ga0495606_0000807_28771_29748 325
325 3300046507 Ga0495606_0003294 Ga0495606_0003294_15121_16098 325
326 3300046507 Ga0495606_0005105 Ga0495606_0005105_10647_11624 325
327 3300046507 Ga0495606_0011202 Ga0495606_0011202_5292_6269 325
328 3300046507 Ga0495606_0143106 Ga0495606_0143106_274_1251 325
329 3300046507 Ga0495606_0146652 Ga0495606_0146652_239_1216 325
330 3300046507 Ga0495606_0154374 Ga0495606_0154374_320_1297 325
331 3300046512 Ga0495610_0000837 Ga0495610_0000837_15126_16103 325
332 3300046512 Ga0495610_0004320 Ga0495610_0004320_7844_8821 325
333 3300046512 Ga0495610_0005908 Ga0495610_0005908_2875_3852 325
334 3300046513 Ga0495616_0000257 Ga0495616_0000257_12294_13271 325
335 3300046513 Ga0495616_0000370 Ga0495616_0000370_17875_18852 325
336 3300046517 Ga0495630_0004827 Ga0495630_0004827_2368_3345 325
337 3300046518 Ga0495631_0001162 Ga0495631_0001162_3613_4590 325
338 3300046518 Ga0495631_0003893 Ga0495631_0003893_4188_5165 325
339 3300046518 Ga0495631_0011431 Ga0495631_0011431_391_1368 325
340 3300046518 Ga0495631_0065342 Ga0495631_0065342_408_1385 325
341 3300046519 Ga0495632_0000297 Ga0495632_0000297_36110_37087 325
342 3300046519 Ga0495632_0000510 Ga0495632_0000510_13526_14503 325
343 3300046519 Ga0495632_0011523 Ga0495632_0011523_1191_2168 325
344 3300046519 Ga0495632_0019504 Ga0495632_0019504_2075_3052 325
345 3300046522 Ga0495643_0000108 Ga0495643_0000108_122020_122997 325
346 3300046522 Ga0495643_0026223 Ga0495643_0026223_234_1211 325
347 3300046522 Ga0495643_0111053 Ga0495643_0111053_70_1047 325
348 3300046523 Ga0495644_0037548 Ga0495644_0037548_181_1158 325
349 3300046524 Ga0495648_0000073 Ga0495648_0000073_51054_52031 325
350 3300046524 Ga0495648_0003445 Ga0495648_0003445_1435_2412 325
351 3300046524 Ga0495648_0007673 Ga0495648_0007673_4746_5723 325
352 3300046526 Ga0495666_0025401 Ga0495666_0025401_1416_2393 325
353 3300046526 Ga0495666_0031083 Ga0495666_0031083_241_1218 325
354 3300046528 Ga0495642_0000405 Ga0495642_0000405_9155_10132 325
355 3300046528 Ga0495642_0000939 Ga0495642_0000939_12311_13288 325
356 3300046528 Ga0495642_0003981 Ga0495642_0003981_382_1359 325
357 3300046528 Ga0495642_0005558 Ga0495642_0005558_779_1756 325
358 3300046528 Ga0495642_0015276 Ga0495642_0015276_1728_2705 325
359 3300046529 Ga0495652_0001082 Ga0495652_0001082_17299_18276 325
360 3300046530 Ga0495654_0001792 Ga0495654_0001792_10740_11717 325
361 3300046531 Ga0495665_0002185 Ga0495665_0002185_3440_4417 325
362 3300046535 Ga0495586_0031915 Ga0495586_0031915_1823_2800 325
363 3300046536 Ga0495587_0009906 Ga0495587_0009906_3833_4810 325
364 3300046538 Ga0495609_0001000 Ga0495609_0001000_18601_19578 325
365 3300046538 Ga0495609_0005317 Ga0495609_0005317_3902_4879 325
366 3300046538 Ga0495609_0014410 Ga0495609_0014410_1535_2512 325
367 3300046538 Ga0495609_0019565 Ga0495609_0019565_108_1085 325
368 3300046542 Ga0495597_0000091 Ga0495597_0000091_26213_27190 325
369 3300046542 Ga0495597_0000475 Ga0495597_0000475_17626_18603 325
370 3300046542 Ga0495597_0000592 Ga0495597_0000592_17254_18231 325
371 3300046558 Ga0495633_0004993 Ga0495633_0004993_2227_3204 325
372 3300046558 Ga0495633_0015338 Ga0495633_0015338_455_1432 325
373 3300046558 Ga0495633_0025179 Ga0495633_0025179_1395_2372 325
374 3300046558 Ga0495633_0032275 Ga0495633_0032275_724_1701 325
375 3300046615 Ga0495656_0035900 Ga0495656_0035900_776_1753 325
376 3300046616 Ga0495668_0001552 Ga0495668_0001552_12562_13539 325
377 3300046616 Ga0495668_0002053 Ga0495668_0002053_7690_8667 325
378 3300046616 Ga0495668_0004404 Ga0495668_0004404_7485_8462 325
379 3300046616 Ga0495668_0011276 Ga0495668_0011276_2963_3940 325
380 3300046616 Ga0495668_0015634 Ga0495668_0015634_650_1627 325
381 3300046616 Ga0495668_0053072 Ga0495668_0053072_1071_2048 325
382 3300046642 Ga0495634_0022041 Ga0495634_0022041_23_1000 325
383 3300046648 Ga0495611_0002276 Ga0495611_0002276_5147_6124 325
384 3300046648 Ga0495611_0005126 Ga0495611_0005126_1468_2445 325
385 3300046648 Ga0495611_0008783 Ga0495611_0008783_2775_3752 325
386 3300046648 Ga0495611_0029432 Ga0495611_0029432_237_1214 325
387 3300046660 Ga0495625_0002373 Ga0495625_0002373_16721_17698 325
388 3300046660 Ga0495625_0010822 Ga0495625_0010822_2819_3796 325
389 3300046660 Ga0495625_0074250 Ga0495625_0074250_714_1691 325
390 3300046665 Ga0495661_0001149 Ga0495661_0001149_6760_7737 325
391 3300046665 Ga0495661_0010199 Ga0495661_0010199_4092_5069 325
392 3300046665 Ga0495661_0016636 Ga0495661_0016636_2387_3364 325
393 3300046665 Ga0495661_0021099 Ga0495661_0021099_1871_2848 325
394 3300046665 Ga0495661_0037378 Ga0495661_0037378_262_1239 325
395 3300046665 Ga0495661_0055414 Ga0495661_0055414_919_1896 325
396 3300046674 Ga0495588_0002889 Ga0495588_0002889_4104_5081 325
397 3300046679 Ga0495623_0006214 Ga0495623_0006214_4290_5267 325
398 3300046679 Ga0495623_0046011 Ga0495623_0046011_463_1440 325
399 3300046684 Ga0495669_0005010 Ga0495669_0005010_152_1129 325
400 3300046684 Ga0495669_0006985 Ga0495669_0006985_725_1702 325
401 3300046691 Ga0495670_0003156 Ga0495670_0003156_1899_2876 325
402 3300046691 Ga0495670_0005643 Ga0495670_0005643_3449_4426 325
403 3300046691 Ga0495670_0007165 Ga0495670_0007165_999_1976 325
404 3300046691 Ga0495670_0019687 Ga0495670_0019687_1155_2132 325
405 3300046691 Ga0495670_0045563 Ga0495670_0045563_412_1389 325
406 3300046691 Ga0495670_0069359 Ga0495670_0069359_743_1720 325
407 3300046692 Ga0495671_0002870 Ga0495671_0002870_1253_2230 325
408 3300046694 Ga0495649_0001691 Ga0495649_0001691_12556_13533 325
409 3300046694 Ga0495649_0002571 Ga0495649_0002571_3051_4028 325
410 3300046694 Ga0495649_0002828 Ga0495649_0002828_8665_9642 325
411 3300046694 Ga0495649_0121968 Ga0495649_0121968_312_1289 325
412 3300046794 Ga0495589_0005007 Ga0495589_0005007_2652_3629 325
413 3300046794 Ga0495589_0065010 Ga0495589_0065010_27_1004 325
414 3300046809 Ga0495600_0004932 Ga0495600_0004932_3382_4359 325
415 3300046810 Ga0495660_0001936 Ga0495660_0001936_4206_5183 325
416 3300046810 Ga0495660_0004305 Ga0495660_0004305_5773_6750 325
417 3300047317 Ga0495604_0007623 Ga0495604_0007623_367_1344 325
418 3300047317 Ga0495604_0019145 Ga0495604_0019145_2928_3905 325
419 3300047320 Ga0495672_0000412 Ga0495672_0000412_33548_34525 325
420 3300047320 Ga0495672_0013029 Ga0495672_0013029_285_1262 325
421 3300047322 Ga0495680_0224543 Ga0495680_0224543_264_1241 325
422 3300047323 Ga0495683_0002274 Ga0495683_0002274_5762_6739 325
423 3300047323 Ga0495683_0005616 Ga0495683_0005616_1822_2799 325
424 3300047323 Ga0495683_0052075 Ga0495683_0052075_705_1682 325
425 3300047444 Ga0495675_0000427 Ga0495675_0000427_5258_6235 325
426 3300047445 Ga0495677_0000551 Ga0495677_0000551_905_1882 325
427 3300047445 Ga0495677_0018348 Ga0495677_0018348_160_1137 325
428 3300047469 Ga0495673_0000008 Ga0495673_0000008_141099_142085 325
429 3300047469 Ga0495673_0000009 Ga0495673_0000009_106164_107141 325
430 3300047470 Ga0495681_0002948 Ga0495681_0002948_3827_4804 325
431 3300047470 Ga0495681_0009509 Ga0495681_0009509_4719_5696 325
432 3300048088 Ga0495602_0002359 Ga0495602_0002359_1235_2212 325
433 3300048091 Ga0495626_0000043 Ga0495626_0000043_38033_39010 325
434 3300048091 Ga0495626_0001323 Ga0495626_0001323_4751_5728 325
435 3300048091 Ga0495626_0002016 Ga0495626_0002016_11112_12089 325
436 3300048091 Ga0495626_0011970 Ga0495626_0011970_1195_2172 325
437 3300048091 Ga0495626_0025043 Ga0495626_0025043_1780_2757 325
438 3300048091 Ga0495626_0029685 Ga0495626_0029685_854_1831 325
439 3300048091 Ga0495626_0041160 Ga0495626_0041160_962_1939 325
440 3300048091 Ga0495626_0055394 Ga0495626_0055394_81_1058 325
441 3300048091 Ga0495626_0080715 Ga0495626_0080715_345_1322 325
442 3300048903 Ga0496100_0024797 Ga0496100_0024797_707_1684 325
443 3300048904 Ga0496101_0030435 Ga0496101_0030435_505_1482 325
444 3300048906 Ga0496103_0007292 Ga0496103_0007292_482_1459 325
445 3300048912 Ga0496109_0001356 Ga0496109_0001356_7338_8315 325
446 3300048915 Ga0496112_0096831 Ga0496112_0096831_1304_2281 325
447 3300048916 Ga0496113_0002277 Ga0496113_0002277_3130_4107 325
448 3300048918 Ga0496115_0077302 Ga0496115_0077302_1202_2179 325
449 3300048918 Ga0496115_0099845 Ga0496115_0099845_688_1665 325
450 3300048925 Ga0496122_0000731 Ga0496122_0000731_45544_46521 325
451 3300048926 Ga0496123_0001518 Ga0496123_0001518_16382_17359 325
452 3300048927 Ga0496124_0082753 Ga0496124_0082753_782_1759 325
453 3300048928 Ga0496125_0001489 Ga0496125_0001489_17314_18291 325
454 3300049459 Ga0495678_000259 Ga0495678_000259_34235_35212 325
455 3300049459 Ga0495678_000696 Ga0495678_000696_18261_19238 325
456 3300049459 Ga0495678_001811 Ga0495678_001811_12546_13523 325
457 3300049459 Ga0495678_004161 Ga0495678_004161_1706_2683 325
458 3300049460 Ga0495682_0052411 Ga0495682_0052411_40_1017 325
459 3300049775 Ga0501279_011717 Ga0501279_011717_34_1011 325
460 3300053145 Ga0500586_000028 Ga0500586_000028_8415_9392 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

160

287

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.8371 151 253
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8002 151 263
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7978 151 256
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7953 151 263
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.7907 151 258
ID Description Score Start End Superfamily
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8112 151 260 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8075 158 281 1.20.81.30
3c1qB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7877 151 263 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7851 158 281 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.776 145 254 1.20.81.30
ID Description Score Start End GO Terms
AF-X0VRT7-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.948 153 321 GO:0005886
AF-A0A4V1ZIP5-F1-model_v4 deleted 0.9418 169 325
AF-A0A4V1ZIP5-F1-model_v4 deleted 0.9361 169 325
AF-A0A6B1BA69-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9317 134 321 GO:0005886
AF-A0A2V6ZGS9-F1-model_v4 Pilus assembly protein TadB 0.9316 80 287 GO:0005886

Feature Viewer

pLDDT pTM Quality
81.77 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map