F448558

General Info

Members Datasets Scaffolds Average Seq Length
460 280 920 251

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10211472|Ga0207690_102114721
Length 283
Sequence MGKLQGKTAIVTGGAHGLGRQFAAALVREGATVAVLDISETDMAAAEIAGREGNGCFGIATDVSDERQVQAAVAAILERTGRIDILINNAAVFSSLPPVGFADIDVALWDKVMAVNLRGPFLMAKHAVPAMIARKSGKIVNIASGTAYKGMPLMLHYVTSKGGVVAFTRALSRELGTHNICVNTLAPGLTLSDSILANKDHIAFARDRVVASRAIQRDGHPQDLIGALIFLCSPDSASQSRMLSLLADRLISPSRRKDWSVRLVWTAVRPVQSAICSCVSGKS

Samples

Sample ID Description Type Environment
1 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
191 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
264 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
265 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
266 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
267 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
271 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
272 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
273 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
274 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
275 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
276 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
277 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
278 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
279 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
280 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 0.43
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.13
Nodule 0.65
Rhizoplane 5.87
Rhizosphere 86.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207690_10211472 3300025932 Bacteria 1479
2 LJQas_1000985 3300000549 Bacteria 4388
3 JGI25406J46586_10035596 3300003203 Bacteria 1816
4 JGI25405J52794_10034148 3300003911 Bacteria 1063
5 Ga0065714_10003354 3300005288 Bacteria 13202
6 Ga0070658_10697308 3300005327 Bacteria 881
7 Ga0070676_10011457 3300005328 Bacteria 4821
8 Ga0070676_10083631 3300005328 Bacteria 1941
9 Ga0070683_100150150 3300005329 Bacteria 2209
10 Ga0070683_100371242 3300005329 Bacteria 1363
11 Ga0070683_100478489 3300005329 Bacteria 1189
12 Ga0070670_100010377 3300005331 Bacteria 7950
13 Ga0070677_10053930 3300005333 Bacteria 1636
14 Ga0068869_100002675 3300005334 Bacteria 10774
15 Ga0068869_100044794 3300005334 Bacteria 3182
16 Ga0068869_100178674 3300005334 Bacteria 1663
17 Ga0070666_10041595 3300005335 Bacteria 3072
18 Ga0070680_100178986 3300005336 Bacteria 1786
19 Ga0070680_100323862 3300005336 Bacteria 1308
20 Ga0068868_100010955 3300005338 Bacteria 6585
21 Ga0070689_100138533 3300005340 Bacteria 1955
22 Ga0070689_100308320 3300005340 Bacteria 1319
23 Ga0070691_10013446 3300005341 Bacteria 3748
24 Ga0070661_100017041 3300005344 Bacteria 5148
25 Ga0070661_100576496 3300005344 Bacteria 908
26 Ga0070692_10059874 3300005345 Bacteria 2003
27 Ga0070692_10060716 3300005345 Bacteria 1991
28 Ga0070668_100224054 3300005347 Bacteria 1552
29 Ga0070669_100012719 3300005353 Bacteria 5975
30 Ga0070669_100015162 3300005353 Bacteria 5489
31 Ga0070675_100001935 3300005354 Bacteria 15318
32 Ga0070675_100119333 3300005354 Bacteria 2240
33 Ga0070671_100261692 3300005355 Bacteria 1470
34 Ga0070674_100255629 3300005356 Bacteria 1378
35 Ga0070674_100353116 3300005356 Bacteria 1188
36 Ga0070688_100326444 3300005365 Bacteria 1117
37 Ga0070659_100481644 3300005366 Bacteria 1056
38 Ga0070667_100060935 3300005367 Bacteria 3194
39 Ga0070667_100702974 3300005367 Bacteria 935
40 Ga0070703_10015726 3300005406 Bacteria 2167
41 Ga0070714_100000802 3300005435 Bacteria 22244
42 Ga0070713_100000646 3300005436 Bacteria 22257
43 Ga0070710_10000815 3300005437 Bacteria 15004
44 Ga0070701_10107544 3300005438 Bacteria 1554
45 Ga0070711_100004948 3300005439 Bacteria 7910
46 Ga0070705_100000045 3300005440 Bacteria 62815
47 Ga0070700_100000273 3300005441 Bacteria 27454
48 Ga0070708_100040768 3300005445 Bacteria 4068
49 Ga0070663_100001631 3300005455 Bacteria 12382
50 Ga0070678_100034562 3300005456 Bacteria 3522
51 Ga0070678_100153920 3300005456 Bacteria 1855
52 Ga0070662_100034726 3300005457 Bacteria 3557
53 Ga0070681_10003152 3300005458 Bacteria 15334
54 Ga0070681_10038597 3300005458 Bacteria 4788
55 Ga0070681_10100530 3300005458 Bacteria 2838
56 Ga0070681_10123845 3300005458 Bacteria 2518
57 Ga0070706_100157518 3300005467 Bacteria 2120
58 Ga0070698_100883183 3300005471 Bacteria 839
59 Ga0070699_100000473 3300005518 Bacteria 38374
60 Ga0070679_100003174 3300005530 Bacteria 15016
61 Ga0070679_100059878 3300005530 Bacteria 3795
62 Ga0070679_100196766 3300005530 Bacteria 1983
63 Ga0070684_100070111 3300005535 Bacteria 3084
64 Ga0070684_100317242 3300005535 Bacteria 1431
65 Ga0070697_100002951 3300005536 Bacteria 13094
66 Ga0068853_100075869 3300005539 Bacteria 2935
67 Ga0068853_100484075 3300005539 Bacteria 1167
68 Ga0070672_100156625 3300005543 Bacteria 1887
69 Ga0070672_100310318 3300005543 Bacteria 1339
70 Ga0070695_100001948 3300005545 Bacteria 11706
71 Ga0070696_100011640 3300005546 Bacteria 5893
72 Ga0070693_100155977 3300005547 Bacteria 1450
73 Ga0070665_100000904 3300005548 Bacteria 38089
74 Ga0070704_100003334 3300005549 Bacteria 9193
75 Ga0068855_100178033 3300005563 Bacteria 2405
76 Ga0070664_100001171 3300005564 Bacteria 20835
77 Ga0068857_100043458 3300005577 Bacteria 3986
78 Ga0068857_100216159 3300005577 Bacteria 1750
79 Ga0070702_100024205 3300005615 Bacteria 3236
80 Ga0068852_100059809 3300005616 Bacteria 3306
81 Ga0068859_100075655 3300005617 Bacteria 3407
82 Ga0068864_100062551 3300005618 Bacteria 3225
83 Ga0068864_100069946 3300005618 Bacteria 3053
84 Ga0068864_100126548 3300005618 Bacteria 2290
85 Ga0068861_100209832 3300005719 Bacteria 1640
86 Ga0068870_10182013 3300005840 Bacteria 1262
87 Ga0068863_100078589 3300005841 Bacteria 3124
88 Ga0068858_100052463 3300005842 Bacteria 3773
89 Ga0068858_100311177 3300005842 Bacteria 1504
90 Ga0068860_100035008 3300005843 Bacteria 4818
91 Ga0068860_100672933 3300005843 Bacteria 1044
92 Ga0068862_100001335 3300005844 Bacteria 22912
93 Ga0081455_10002100 3300005937 Bacteria 23752
94 Ga0081455_10033242 3300005937 Bacteria 4638
95 Ga0081455_10064435 3300005937 Bacteria 3068
96 Ga0081538_10064305 3300005981 Bacteria 2076
97 Ga0081539_10002654 3300005985 Bacteria 24397
98 Ga0070717_10001662 3300006028 Bacteria 15458
99 Ga0075365_10005797 3300006038 Bacteria 6709
100 Ga0075368_10013665 3300006042 Bacteria 2985
101 Ga0075432_10002867 3300006058 Bacteria 5793
102 Ga0070716_100131059 3300006173 Bacteria 1585
103 Ga0070712_100146257 3300006175 Bacteria 1809
104 Ga0075362_10008292 3300006177 Bacteria 3968
105 Ga0075362_10141254 3300006177 Bacteria 1151
106 Ga0075366_10002248 3300006195 Bacteria 9870
107 Ga0075428_100114630 3300006844 Bacteria 2936
108 Ga0075428_100176099 3300006844 Bacteria 2316
109 Ga0075428_100516337 3300006844 Bacteria 1278
110 Ga0075428_100675212 3300006844 Bacteria 1101
111 Ga0075430_100035725 3300006846 Bacteria 4215
112 Ga0075430_100334999 3300006846 Bacteria 1250
113 Ga0075431_100006278 3300006847 Bacteria 11808
114 Ga0075431_100024642 3300006847 Bacteria 6168
115 Ga0075431_100026498 3300006847 Bacteria 5947
116 Ga0075431_100235394 3300006847 Bacteria 1865
117 Ga0075433_10024438 3300006852 Bacteria 5100
118 Ga0075433_10728368 3300006852 Bacteria 868
119 Ga0075434_100000203 3300006871 Bacteria 40085
120 Ga0075429_100101173 3300006880 Bacteria 2516
121 Ga0075429_100517319 3300006880 Bacteria 1046
122 Ga0097620_100075653 3300006931 Bacteria 3407
123 Ga0075435_100008338 3300007076 Bacteria 7427
124 Ga0075435_100206913 3300007076 Bacteria 1663
125 Ga0105251_10025121 3300009011 Bacteria 3051
126 Ga0105244_10002366 3300009036 Bacteria 14317
127 Ga0111539_10156027 3300009094 Bacteria 2671
128 Ga0111539_10242243 3300009094 Bacteria 2099
129 Ga0111539_10785344 3300009094 Bacteria 1108
130 Ga0105245_10003264 3300009098 Bacteria 14552
131 Ga0105245_10300166 3300009098 Bacteria 1576
132 Ga0114129_10281051 3300009147 Bacteria 2224
133 Ga0114129_10299571 3300009147 Bacteria 2143
134 Ga0114129_10596968 3300009147 Bacteria 1431
135 Ga0105243_10085828 3300009148 Bacteria 2580
136 Ga0105243_10904423 3300009148 Bacteria 878
137 Ga0105241_10267673 3300009174 Bacteria 1455
138 Ga0105248_10460443 3300009177 Bacteria 1434
139 Ga0105237_10270503 3300009545 Bacteria 1702
140 Ga0105238_10202612 3300009551 Bacteria 1960
141 Ga0105238_10270204 3300009551 Bacteria 1681
142 Ga0105249_10004430 3300009553 Bacteria 12147
143 Ga0105249_10085591 3300009553 Bacteria 2938
144 Ga0105249_10747891 3300009553 Bacteria 1040
145 Ga0105246_10211259 3300011119 Bacteria 1515
146 Ga0157369_10271294 3300013105 Bacteria 1768
147 Ga0163162_10046925 3300013306 Bacteria 4330
148 Ga0163162_10290337 3300013306 Bacteria 1767
149 Ga0157372_10118000 3300013307 Bacteria 3044
150 Ga0157375_10093231 3300013308 Bacteria 3077
151 Ga0157375_10266195 3300013308 Bacteria 1876
152 Ga0157375_10789407 3300013308 Bacteria 1099
153 Ga0163163_10145624 3300014325 Bacteria 2412
154 Ga0157380_10159267 3300014326 Bacteria 1960
155 Ga0157377_10007950 3300014745 Bacteria 5148
156 Ga0157377_10226532 3300014745 Bacteria 1200
157 Ga0182005_1057740 3300015265 Bacteria 1058
158 Ga0206354_11296149 3300020081 Bacteria 2899
159 Ga0206353_10459553 3300020082 Bacteria 4841
160 Ga0213874_10029571 3300021377 Bacteria 1573
161 Ga0207697_10027907 3300025315 Bacteria 2308
162 Ga0207655_1005523 3300025728 Bacteria 8573
163 Ga0207653_10003024 3300025885 Bacteria 5341
164 Ga0207682_10091221 3300025893 Bacteria 1321
165 Ga0207692_10000340 3300025898 Bacteria 16225
166 Ga0207688_10038975 3300025901 Bacteria 2639
167 Ga0207688_10100849 3300025901 Bacteria 1667
168 Ga0207680_10117970 3300025903 Bacteria 1732
169 Ga0207647_10153176 3300025904 Bacteria 1347
170 Ga0207685_10001362 3300025905 Bacteria 5057
171 Ga0207645_10036204 3300025907 Bacteria 3169
172 Ga0207645_10085353 3300025907 Bacteria 2027
173 Ga0207645_10306965 3300025907 Bacteria 1057
174 Ga0207643_10171895 3300025908 Bacteria 1308
175 Ga0207684_10150976 3300025910 Bacteria 1999
176 Ga0207707_10001132 3300025912 Bacteria 25271
177 Ga0207707_10029267 3300025912 Bacteria 4816
178 Ga0207707_10142656 3300025912 Bacteria 2094
179 Ga0207707_10242954 3300025912 Bacteria 1565
180 Ga0207671_10126780 3300025914 Bacteria 1956
181 Ga0207693_10001674 3300025915 Bacteria 19537
182 Ga0207663_10000328 3300025916 Bacteria 20830
183 Ga0207660_10026453 3300025917 Bacteria 3952
184 Ga0207660_10090452 3300025917 Bacteria 2268
185 Ga0207662_10107539 3300025918 Bacteria 1735
186 Ga0207662_10176990 3300025918 Bacteria 1371
187 Ga0207649_10125532 3300025920 Bacteria 1736
188 Ga0207649_10490488 3300025920 Bacteria 933
189 Ga0207652_10025377 3300025921 Bacteria 4927
190 Ga0207646_10149334 3300025922 Bacteria 2107
191 Ga0207681_10154369 3300025923 Bacteria 1724
192 Ga0207694_10031881 3300025924 Bacteria 4029
193 Ga0207694_10144494 3300025924 Bacteria 1914
194 Ga0207694_10245282 3300025924 Bacteria 1465
195 Ga0207650_10026164 3300025925 Bacteria 4160
196 Ga0207650_10299119 3300025925 Bacteria 1314
197 Ga0207650_10312349 3300025925 Bacteria 1286
198 Ga0207650_10384717 3300025925 Bacteria 1159
199 Ga0207659_10022050 3300025926 Bacteria 4237
200 Ga0207659_10033898 3300025926 Bacteria 3517
201 Ga0207659_10079687 3300025926 Bacteria 2417
202 Ga0207659_10380823 3300025926 Bacteria 1176
203 Ga0207659_10483353 3300025926 Bacteria 1046
204 Ga0207687_10020848 3300025927 Bacteria 4349
205 Ga0207700_10000582 3300025928 Bacteria 21324
206 Ga0207664_10362982 3300025929 Bacteria 1283
207 Ga0207644_10263092 3300025931 Bacteria 1380
208 Ga0207690_10535674 3300025932 Bacteria 950
209 Ga0207706_10050810 3300025933 Bacteria 3663
210 Ga0207706_10269043 3300025933 Bacteria 1487
211 Ga0207670_10137504 3300025936 Bacteria 1798
212 Ga0207669_10008072 3300025937 Bacteria 4924
213 Ga0207669_10091107 3300025937 Bacteria 1985
214 Ga0207669_10602770 3300025937 Bacteria 893
215 Ga0207704_10340258 3300025938 Bacteria 1164
216 Ga0207665_10008258 3300025939 Bacteria 6873
217 Ga0207665_10342606 3300025939 Bacteria 1127
218 Ga0207665_10600780 3300025939 Bacteria 859
219 Ga0207691_10002388 3300025940 Bacteria 18369
220 Ga0207691_10016660 3300025940 Bacteria 6979
221 Ga0207689_10055822 3300025942 Bacteria 3250
222 Ga0207661_10265050 3300025944 Bacteria 1531
223 Ga0207679_10465772 3300025945 Bacteria 1123
224 Ga0207667_10149308 3300025949 Bacteria 2406
225 Ga0207668_10198648 3300025972 Bacteria 1595
226 Ga0207658_10579586 3300025986 Bacteria 1006
227 Ga0207677_10008545 3300026023 Bacteria 5729
228 Ga0207703_10037682 3300026035 Bacteria 3853
229 Ga0207703_10123842 3300026035 Bacteria 2223
230 Ga0207678_10001350 3300026067 Bacteria 22602
231 Ga0207708_10004342 3300026075 Bacteria 10439
232 Ga0207648_10283450 3300026089 Bacteria 1482
233 Ga0207676_10035390 3300026095 Bacteria 3789
234 Ga0207676_10049282 3300026095 Bacteria 3275
235 Ga0207674_10000240 3300026116 Bacteria 68544
236 Ga0207674_10007132 3300026116 Bacteria 13058
237 Ga0207674_10389606 3300026116 Bacteria 1347
238 Ga0207675_100347019 3300026118 Bacteria 1454
239 Ga0207683_10001982 3300026121 Bacteria 18116
240 Ga0207683_10038793 3300026121 Bacteria 4154
241 Ga0207698_10043962 3300026142 Bacteria 3352
242 Ga0209813_10055090 3300027866 Bacteria 1255
243 Ga0207428_10011357 3300027907 Bacteria 7876
244 Ga0268266_10000320 3300028379 Bacteria 75616
245 Ga0268266_10161947 3300028379 Bacteria 2025
246 Ga0268265_10001328 3300028380 Bacteria 21171
247 Ga0268265_10100640 3300028380 Bacteria 2333
248 Ga0268265_10719445 3300028380 Bacteria 966
249 Ga0265318_10016767 3300028577 Bacteria 3018
250 Ga0265330_10041338 3300031235 Bacteria 2044
251 Ga0265332_10008639 3300031238 Bacteria 4571
252 Ga0265320_10006675 3300031240 Bacteria 7250
253 Ga0265331_10016387 3300031250 Bacteria 3892
254 Ga0307408_100024918 3300031548 Bacteria 4091
255 Ga0307408_100043308 3300031548 Bacteria 3203
256 Ga0307408_100151495 3300031548 Bacteria 1831
257 Ga0265313_10113597 3300031595 Bacteria 1188
258 Ga0265314_10004170 3300031711 Bacteria 13583
259 Ga0265314_10246412 3300031711 Bacteria 1028
260 Ga0265342_10070762 3300031712 Bacteria 2034
261 Ga0307410_10023864 3300031852 Bacteria 3812
262 Ga0307410_10074425 3300031852 Bacteria 2365
263 Ga0307410_10117949 3300031852 Bacteria 1931
264 Ga0307406_10034828 3300031901 Bacteria 3092
265 Ga0307407_10050530 3300031903 Bacteria 2379
266 Ga0307412_10004710 3300031911 Bacteria 7612
267 Ga0307412_10436575 3300031911 Bacteria 1075
268 Ga0307409_100085916 3300031995 Bacteria 2559
269 Ga0307409_100137635 3300031995 Bacteria 2098
270 Ga0307416_100011925 3300032002 Bacteria 5830
271 Ga0307416_100356281 3300032002 Bacteria 1483
272 Ga0307416_100372928 3300032002 Bacteria 1454
273 Ga0307416_100526218 3300032002 Bacteria 1251
274 Ga0307411_10126918 3300032005 Bacteria 1857
275 Ga0307415_100025475 3300032126 Bacteria 3713
276 Ga0307507_10023706 3300033179 Bacteria 6721
277 Ga0373925_0483966 3300037068 Bacteria 1015
278 Ga0395899_0003241 3300037312 Bacteria 12903
279 Ga0395900_0088798 3300037418 Bacteria 3178
280 Ga0395900_0160449 3300037418 Bacteria 2293
281 Ga0395900_0240347 3300037418 Bacteria 1817
282 Ga0395900_0393976 3300037418 Bacteria 1350
283 Ga0395898_0001261 3300037466 Bacteria 37591
284 Ga0395898_0046943 3300037466 Bacteria 4240
285 Ga0395898_0058720 3300037466 Bacteria 3744
286 Ga0395898_0094149 3300037466 Bacteria 2879
287 Ga0395898_0105722 3300037466 Bacteria 2699
288 Ga0395898_0114115 3300037466 Bacteria 2589
289 Ga0395905_0269031 3300037471 Bacteria 1590
290 Ga0395901_0001197 3300038443 Bacteria 27609
291 Ga0395901_0092520 3300038443 Bacteria 3165
292 Ga0395901_0116548 3300038443 Bacteria 2806
293 Ga0395901_0144354 3300038443 Bacteria 2502
294 Ga0395901_0619767 3300038443 Bacteria 1089
295 Ga0400483_229947 3300039062 Bacteria 4821
296 Ga0436365_1326270 3300039437 Bacteria 1537
297 Ga0436363_0824617 3300039450 Bacteria 1531
298 Ga0439453_0003404 3300041408 Bacteria 2287
299 Ga0451847_0306812 3300041503 Bacteria 1018
300 Ga0439435_0003838 3300042436 Bacteria 3175
301 Ga0439460_0048570 3300042461 Bacteria 1266
302 Ga0466965_0002516 3300044683 Bacteria 7813
303 Ga0495580_0166901 3300046472 Bacteria 1522
304 Ga0495582_0064902 3300046473 Bacteria 2017
305 Ga0495605_0057024 3300046474 Bacteria 1882
306 Ga0495639_0001511 3300046475 Bacteria 10375
307 Ga0495664_0091533 3300046477 Bacteria 1828
308 Ga0495665_0113753 3300046531 Bacteria 1418
309 Ga0495586_0030819 3300046535 Bacteria 2870
310 Ga0495645_0021665 3300046543 Bacteria 4645
311 Ga0495633_0039558 3300046558 Bacteria 2251
312 Ga0495668_0027761 3300046616 Bacteria 3207
313 Ga0495588_0070100 3300046674 Bacteria 1822
314 Ga0495581_0093163 3300047315 Bacteria 1748
315 Ga0495615_0012428 3300048090 Bacteria 1755
316 Ga0496100_0068049 3300048903 Bacteria 2367
317 Ga0496100_0181937 3300048903 Bacteria 1520
318 Ga0496101_0025162 3300048904 Bacteria 4127
319 Ga0496101_0110603 3300048904 Bacteria 2067
320 Ga0496102_0022429 3300048905 Bacteria 5593
321 Ga0496102_0025493 3300048905 Bacteria 5264
322 Ga0496102_0349588 3300048905 Bacteria 1392
323 Ga0496103_0041253 3300048906 Bacteria 2837
324 Ga0496104_0001479 3300048907 Bacteria 20271
325 Ga0496104_0038521 3300048907 Bacteria 4473
326 Ga0496105_0036957 3300048908 Bacteria 4023
327 Ga0496106_0002221 3300048909 Bacteria 14476
328 Ga0496106_0438499 3300048909 Bacteria 1049
329 Ga0496107_0007754 3300048910 Bacteria 7416
330 Ga0496107_0203830 3300048910 Bacteria 1470
331 Ga0496109_0126846 3300048912 Bacteria 2379
332 Ga0496110_0124145 3300048913 Bacteria 2328
333 Ga0496110_0125484 3300048913 Bacteria 2316
334 Ga0496111_0014812 3300048914 Bacteria 5337
335 Ga0496111_0240127 3300048914 Bacteria 1346
336 Ga0496112_0110910 3300048915 Bacteria 2713
337 Ga0496112_0304827 3300048915 Bacteria 1538
338 Ga0496113_0331665 3300048916 Bacteria 1220
339 Ga0496113_0371670 3300048916 Bacteria 1147
340 Ga0496114_0012247 3300048917 Bacteria 6862
341 Ga0496115_0027658 3300048918 Bacteria 4438
342 Ga0496115_0511927 3300048918 Bacteria 963
343 Ga0496121_0466587 3300048924 Bacteria 810
344 Ga0496124_0025454 3300048927 Bacteria 5359
345 Ga0501033_0029660 3300049570 Bacteria 4111
346 Ga0501033_0200920 3300049570 Bacteria 1424
347 Ga0501036_0114459 3300049572 Bacteria 2279
348 Ga0501036_0316775 3300049572 Bacteria 1304
349 Ga0501038_0006142 3300049574 Bacteria 11121
350 Ga0501038_0117463 3300049574 Bacteria 2197
351 Ga0501039_0014049 3300049575 Bacteria 6128
352 Ga0501039_0023047 3300049575 Bacteria 4776
353 Ga0501039_0064561 3300049575 Bacteria 2838
354 Ga0501039_0073517 3300049575 Bacteria 2656
355 Ga0501040_0036412 3300049576 Bacteria 3340
356 Ga0501040_0306113 3300049576 Bacteria 1136
357 Ga0501040_0436529 3300049576 Bacteria 942
358 Ga0501041_0012091 3300049577 Bacteria 5110
359 Ga0501041_0018426 3300049577 Bacteria 4160
360 Ga0501042_0010069 3300049578 Bacteria 6320
361 Ga0501042_0059296 3300049578 Bacteria 2733
362 Ga0501042_0128389 3300049578 Bacteria 1826
363 Ga0501042_0417361 3300049578 Bacteria 972
364 Ga0501043_0056778 3300049579 Bacteria 3075
365 Ga0501043_0207749 3300049579 Bacteria 1518
366 Ga0501046_0002464 3300049580 Bacteria 17356
367 Ga0501046_0051568 3300049580 Bacteria 3246
368 Ga0501046_0079661 3300049580 Bacteria 2532
369 Ga0501048_0017524 3300049582 Bacteria 5274
370 Ga0501048_0032954 3300049582 Bacteria 3744
371 Ga0501068_0138613 3300049584 Bacteria 1524
372 Ga0501070_0178532 3300049586 Bacteria 1748
373 Ga0501071_0011685 3300049587 Bacteria 5926
374 Ga0501072_0022898 3300049588 Bacteria 4848
375 Ga0501072_0069711 3300049588 Bacteria 2776
376 Ga0501072_0108665 3300049588 Bacteria 2207
377 Ga0501072_0203872 3300049588 Bacteria 1577
378 Ga0501074_0010612 3300049590 Bacteria 6688
379 Ga0501074_0108199 3300049590 Bacteria 1990
380 Ga0501074_0401669 3300049590 Bacteria 972
381 Ga0501075_0000083 3300049591 Bacteria 43108
382 Ga0501075_0023755 3300049591 Bacteria 4490
383 Ga0501075_0024985 3300049591 Bacteria 4386
384 Ga0501075_0107004 3300049591 Bacteria 2126
385 Ga0501075_0462830 3300049591 Bacteria 967
386 Ga0501076_0000591 3300049592 Bacteria 23194
387 Ga0501076_0031037 3300049592 Bacteria 4164
388 Ga0501076_0167640 3300049592 Bacteria 1790
389 Ga0501077_0001763 3300049593 Bacteria 13053
390 Ga0501077_0057212 3300049593 Bacteria 2476
391 Ga0501079_0033731 3300049741 Bacteria 3938
392 Ga0501079_0037933 3300049741 Bacteria 3716
393 Ga0501079_0071172 3300049741 Bacteria 2686
394 Ga0501079_0163428 3300049741 Bacteria 1736
395 Ga0501079_0171844 3300049741 Bacteria 1690
396 Ga0501079_0223460 3300049741 Bacteria 1471
397 Ga0501080_0084689 3300049742 Bacteria 2945
398 Ga0501080_0098394 3300049742 Bacteria 2715
399 Ga0501081_0011792 3300049743 Bacteria 5725
400 Ga0501081_0056279 3300049743 Bacteria 2718
401 Ga0501081_0094779 3300049743 Bacteria 2103
402 Ga0501081_0103640 3300049743 Bacteria 2013
403 Ga0501081_0135528 3300049743 Bacteria 1762
404 Ga0501083_0034730 3300049744 Bacteria 3447
405 Ga0501083_0043420 3300049744 Bacteria 3046
406 Ga0501035_0079950 3300049822 Bacteria 2887
407 Ga0501035_0096851 3300049822 Bacteria 2592
408 nmdc:mga03683_8536_c1 3300050489 Bacteria 3606
409 nmdc:mga03n38_247280_c1 3300050490 Bacteria 941
410 nmdc:mga00v17_1217_c1 3300050491 Bacteria 13509
411 nmdc:mga0yw44_184632_c1 3300050492 Bacteria 1374
412 nmdc:mga0k408_3067_c1 3300050493 Bacteria 8856
413 nmdc:mga0k408_735_c1 3300050493 Bacteria 17956
414 nmdc:mga06z11_172474_c1 3300050494 Bacteria 1243
415 nmdc:mga06z11_311213_c1 3300050494 Bacteria 938
416 nmdc:mga05p37_244386_c1 3300050507 Bacteria 2156
417 nmdc:mga05p37_645789_c1 3300050507 Bacteria 1186
418 nmdc:mga05p37_910011_c1 3300050507 Bacteria 947
419 nmdc:mga09592_228245_c1 3300050508 Bacteria 1613
420 nmdc:mga09592_769593_c1 3300050508 Bacteria 816
421 nmdc:mga0qj67_28541_c1 3300050509 Bacteria 4331
422 nmdc:mga06r32_10052_c1 3300050510 Bacteria 8539
423 nmdc:mga06r32_31198_c1 3300050510 Bacteria 5004
424 nmdc:mga06r32_411932_c1 3300050510 Bacteria 1333
425 nmdc:mga08y16_137881_c1 3300050511 Bacteria 2536
426 nmdc:mga08y16_343354_c1 3300050511 Bacteria 1535
427 nmdc:mga08y16_942208_c1 3300050511 Bacteria 847
428 nmdc:mga0n895_14511_c1 3300050512 Bacteria 7159
429 nmdc:mga0n895_50743_c1 3300050512 Bacteria 4068
430 nmdc:mga0rr50_257751_c1 3300050513 Bacteria 1450
431 nmdc:mga0rr50_289636_c1 3300050513 Bacteria 1368
432 nmdc:mga0rr50_93777_c1 3300050513 Bacteria 2343
433 nmdc:mga0a205_450_c1 3300050515 Bacteria 30909
434 Ga0495612_0034696 3300053078 Bacteria 2043
435 Ga0500650_0163557 3300053098 Bacteria 1026
436 Ga0500654_048358 3300053099 Bacteria 2323
437 Ga0500604_0007516 3300053151 Bacteria 2886
438 Ga0500616_0001669 3300053153 Bacteria 20475
439 Ga0500645_073111 3300053730 Bacteria 983
440 Ga0501084_0003901 3300054114 Bacteria 12141
441 Ga0501084_0037185 3300054114 Bacteria 4068
442 Ga0501084_0041913 3300054114 Bacteria 3828
443 Ga0501084_0099232 3300054114 Bacteria 2445
444 Ga0501084_0582845 3300054114 Bacteria 945
445 Ga0501082_0027414 3300060353 Bacteria 4904
446 Ga0501082_0049478 3300060353 Bacteria 3625
447 Ga0501082_0159607 3300060353 Bacteria 1959
448 Ga0501082_0382303 3300060353 Bacteria 1228
449 Ga0530510_0003396 3300061734 Bacteria 10950
450 Ga0530510_0014365 3300061734 Bacteria 5584
451 2523384127 2523231044 Bacteria 6434991
452 2524536553 2524023228 Bacteria 10118060
453 2676205432 2675902999 Bacteria 9438463
454 2774850007 2773857921 Bacteria 9435764
455 2808829269 2808606357 Bacteria 4466944
456 2812332073 2811994874 Bacteria 5367947
457 2862516265 2862507626 Bacteria 9425308
458 2919051925 2919051321 Bacteria 4210889
459 2939601602 2939598168 Bacteria 4687164
460 8004021937 8004021418 Bacteria 4313954
461 Ga0207690_10211472
462 LJQas_1000985
463 JGI25406J46586_10035596
464 JGI25405J52794_10034148
465 Ga0065714_10003354
466 Ga0070658_10697308
467 Ga0070676_10011457
468 Ga0070676_10083631
469 Ga0070683_100150150
470 Ga0070683_100371242
471 Ga0070683_100478489
472 Ga0070670_100010377
473 Ga0070677_10053930
474 Ga0068869_100002675
475 Ga0068869_100044794
476 Ga0068869_100178674
477 Ga0070666_10041595
478 Ga0070680_100178986
479 Ga0070680_100323862
480 Ga0068868_100010955
481 Ga0070689_100138533
482 Ga0070689_100308320
483 Ga0070691_10013446
484 Ga0070661_100017041
485 Ga0070661_100576496
486 Ga0070692_10059874
487 Ga0070692_10060716
488 Ga0070668_100224054
489 Ga0070669_100012719
490 Ga0070669_100015162
491 Ga0070675_100001935
492 Ga0070675_100119333
493 Ga0070671_100261692
494 Ga0070674_100255629
495 Ga0070674_100353116
496 Ga0070688_100326444
497 Ga0070659_100481644
498 Ga0070667_100060935
499 Ga0070667_100702974
500 Ga0070703_10015726
501 Ga0070714_100000802
502 Ga0070713_100000646
503 Ga0070710_10000815
504 Ga0070701_10107544
505 Ga0070711_100004948
506 Ga0070705_100000045
507 Ga0070700_100000273
508 Ga0070708_100040768
509 Ga0070663_100001631
510 Ga0070678_100034562
511 Ga0070678_100153920
512 Ga0070662_100034726
513 Ga0070681_10003152
514 Ga0070681_10038597
515 Ga0070681_10100530
516 Ga0070681_10123845
517 Ga0070706_100157518
518 Ga0070698_100883183
519 Ga0070699_100000473
520 Ga0070679_100003174
521 Ga0070679_100059878
522 Ga0070679_100196766
523 Ga0070684_100070111
524 Ga0070684_100317242
525 Ga0070697_100002951
526 Ga0068853_100075869
527 Ga0068853_100484075
528 Ga0070672_100156625
529 Ga0070672_100310318
530 Ga0070695_100001948
531 Ga0070696_100011640
532 Ga0070693_100155977
533 Ga0070665_100000904
534 Ga0070704_100003334
535 Ga0068855_100178033
536 Ga0070664_100001171
537 Ga0068857_100043458
538 Ga0068857_100216159
539 Ga0070702_100024205
540 Ga0068852_100059809
541 Ga0068859_100075655
542 Ga0068864_100062551
543 Ga0068864_100069946
544 Ga0068864_100126548
545 Ga0068861_100209832
546 Ga0068870_10182013
547 Ga0068863_100078589
548 Ga0068858_100052463
549 Ga0068858_100311177
550 Ga0068860_100035008
551 Ga0068860_100672933
552 Ga0068862_100001335
553 Ga0081455_10002100
554 Ga0081455_10033242
555 Ga0081455_10064435
556 Ga0081538_10064305
557 Ga0081539_10002654
558 Ga0070717_10001662
559 Ga0075365_10005797
560 Ga0075368_10013665
561 Ga0075432_10002867
562 Ga0070716_100131059
563 Ga0070712_100146257
564 Ga0075362_10008292
565 Ga0075362_10141254
566 Ga0075366_10002248
567 Ga0075428_100114630
568 Ga0075428_100176099
569 Ga0075428_100516337
570 Ga0075428_100675212
571 Ga0075430_100035725
572 Ga0075430_100334999
573 Ga0075431_100006278
574 Ga0075431_100024642
575 Ga0075431_100026498
576 Ga0075431_100235394
577 Ga0075433_10024438
578 Ga0075433_10728368
579 Ga0075434_100000203
580 Ga0075429_100101173
581 Ga0075429_100517319
582 Ga0097620_100075653
583 Ga0075435_100008338
584 Ga0075435_100206913
585 Ga0105251_10025121
586 Ga0105244_10002366
587 Ga0111539_10156027
588 Ga0111539_10242243
589 Ga0111539_10785344
590 Ga0105245_10003264
591 Ga0105245_10300166
592 Ga0114129_10281051
593 Ga0114129_10299571
594 Ga0114129_10596968
595 Ga0105243_10085828
596 Ga0105243_10904423
597 Ga0105241_10267673
598 Ga0105248_10460443
599 Ga0105237_10270503
600 Ga0105238_10202612
601 Ga0105238_10270204
602 Ga0105249_10004430
603 Ga0105249_10085591
604 Ga0105249_10747891
605 Ga0105246_10211259
606 Ga0157369_10271294
607 Ga0163162_10046925
608 Ga0163162_10290337
609 Ga0157372_10118000
610 Ga0157375_10093231
611 Ga0157375_10266195
612 Ga0157375_10789407
613 Ga0163163_10145624
614 Ga0157380_10159267
615 Ga0157377_10007950
616 Ga0157377_10226532
617 Ga0182005_1057740
618 Ga0206354_11296149
619 Ga0206353_10459553
620 Ga0213874_10029571
621 Ga0207697_10027907
622 Ga0207655_1005523
623 Ga0207653_10003024
624 Ga0207682_10091221
625 Ga0207692_10000340
626 Ga0207688_10038975
627 Ga0207688_10100849
628 Ga0207680_10117970
629 Ga0207647_10153176
630 Ga0207685_10001362
631 Ga0207645_10036204
632 Ga0207645_10085353
633 Ga0207645_10306965
634 Ga0207643_10171895
635 Ga0207684_10150976
636 Ga0207707_10001132
637 Ga0207707_10029267
638 Ga0207707_10142656
639 Ga0207707_10242954
640 Ga0207671_10126780
641 Ga0207693_10001674
642 Ga0207663_10000328
643 Ga0207660_10026453
644 Ga0207660_10090452
645 Ga0207662_10107539
646 Ga0207662_10176990
647 Ga0207649_10125532
648 Ga0207649_10490488
649 Ga0207652_10025377
650 Ga0207646_10149334
651 Ga0207681_10154369
652 Ga0207694_10031881
653 Ga0207694_10144494
654 Ga0207694_10245282
655 Ga0207650_10026164
656 Ga0207650_10299119
657 Ga0207650_10312349
658 Ga0207650_10384717
659 Ga0207659_10022050
660 Ga0207659_10033898
661 Ga0207659_10079687
662 Ga0207659_10380823
663 Ga0207659_10483353
664 Ga0207687_10020848
665 Ga0207700_10000582
666 Ga0207664_10362982
667 Ga0207644_10263092
668 Ga0207690_10535674
669 Ga0207706_10050810
670 Ga0207706_10269043
671 Ga0207670_10137504
672 Ga0207669_10008072
673 Ga0207669_10091107
674 Ga0207669_10602770
675 Ga0207704_10340258
676 Ga0207665_10008258
677 Ga0207665_10342606
678 Ga0207665_10600780
679 Ga0207691_10002388
680 Ga0207691_10016660
681 Ga0207689_10055822
682 Ga0207661_10265050
683 Ga0207679_10465772
684 Ga0207667_10149308
685 Ga0207668_10198648
686 Ga0207658_10579586
687 Ga0207677_10008545
688 Ga0207703_10037682
689 Ga0207703_10123842
690 Ga0207678_10001350
691 Ga0207708_10004342
692 Ga0207648_10283450
693 Ga0207676_10035390
694 Ga0207676_10049282
695 Ga0207674_10000240
696 Ga0207674_10007132
697 Ga0207674_10389606
698 Ga0207675_100347019
699 Ga0207683_10001982
700 Ga0207683_10038793
701 Ga0207698_10043962
702 Ga0209813_10055090
703 Ga0207428_10011357
704 Ga0268266_10000320
705 Ga0268266_10161947
706 Ga0268265_10001328
707 Ga0268265_10100640
708 Ga0268265_10719445
709 Ga0265318_10016767
710 Ga0265330_10041338
711 Ga0265332_10008639
712 Ga0265320_10006675
713 Ga0265331_10016387
714 Ga0307408_100024918
715 Ga0307408_100043308
716 Ga0307408_100151495
717 Ga0265313_10113597
718 Ga0265314_10004170
719 Ga0265314_10246412
720 Ga0265342_10070762
721 Ga0307410_10023864
722 Ga0307410_10074425
723 Ga0307410_10117949
724 Ga0307406_10034828
725 Ga0307407_10050530
726 Ga0307412_10004710
727 Ga0307412_10436575
728 Ga0307409_100085916
729 Ga0307409_100137635
730 Ga0307416_100011925
731 Ga0307416_100356281
732 Ga0307416_100372928
733 Ga0307416_100526218
734 Ga0307411_10126918
735 Ga0307415_100025475
736 Ga0307507_10023706
737 Ga0373925_0483966
738 Ga0395899_0003241
739 Ga0395900_0088798
740 Ga0395900_0160449
741 Ga0395900_0240347
742 Ga0395900_0393976
743 Ga0395898_0001261
744 Ga0395898_0046943
745 Ga0395898_0058720
746 Ga0395898_0094149
747 Ga0395898_0105722
748 Ga0395898_0114115
749 Ga0395905_0269031
750 Ga0395901_0001197
751 Ga0395901_0092520
752 Ga0395901_0116548
753 Ga0395901_0144354
754 Ga0395901_0619767
755 Ga0400483_229947
756 Ga0436365_1326270
757 Ga0436363_0824617
758 Ga0439453_0003404
759 Ga0451847_0306812
760 Ga0439435_0003838
761 Ga0439460_0048570
762 Ga0466965_0002516
763 Ga0495580_0166901
764 Ga0495582_0064902
765 Ga0495605_0057024
766 Ga0495639_0001511
767 Ga0495664_0091533
768 Ga0495665_0113753
769 Ga0495586_0030819
770 Ga0495645_0021665
771 Ga0495633_0039558
772 Ga0495668_0027761
773 Ga0495588_0070100
774 Ga0495581_0093163
775 Ga0495615_0012428
776 Ga0496100_0068049
777 Ga0496100_0181937
778 Ga0496101_0025162
779 Ga0496101_0110603
780 Ga0496102_0022429
781 Ga0496102_0025493
782 Ga0496102_0349588
783 Ga0496103_0041253
784 Ga0496104_0001479
785 Ga0496104_0038521
786 Ga0496105_0036957
787 Ga0496106_0002221
788 Ga0496106_0438499
789 Ga0496107_0007754
790 Ga0496107_0203830
791 Ga0496109_0126846
792 Ga0496110_0124145
793 Ga0496110_0125484
794 Ga0496111_0014812
795 Ga0496111_0240127
796 Ga0496112_0110910
797 Ga0496112_0304827
798 Ga0496113_0331665
799 Ga0496113_0371670
800 Ga0496114_0012247
801 Ga0496115_0027658
802 Ga0496115_0511927
803 Ga0496121_0466587
804 Ga0496124_0025454
805 Ga0501033_0029660
806 Ga0501033_0200920
807 Ga0501036_0114459
808 Ga0501036_0316775
809 Ga0501038_0006142
810 Ga0501038_0117463
811 Ga0501039_0014049
812 Ga0501039_0023047
813 Ga0501039_0064561
814 Ga0501039_0073517
815 Ga0501040_0036412
816 Ga0501040_0306113
817 Ga0501040_0436529
818 Ga0501041_0012091
819 Ga0501041_0018426
820 Ga0501042_0010069
821 Ga0501042_0059296
822 Ga0501042_0128389
823 Ga0501042_0417361
824 Ga0501043_0056778
825 Ga0501043_0207749
826 Ga0501046_0002464
827 Ga0501046_0051568
828 Ga0501046_0079661
829 Ga0501048_0017524
830 Ga0501048_0032954
831 Ga0501068_0138613
832 Ga0501070_0178532
833 Ga0501071_0011685
834 Ga0501072_0022898
835 Ga0501072_0069711
836 Ga0501072_0108665
837 Ga0501072_0203872
838 Ga0501074_0010612
839 Ga0501074_0108199
840 Ga0501074_0401669
841 Ga0501075_0000083
842 Ga0501075_0023755
843 Ga0501075_0024985
844 Ga0501075_0107004
845 Ga0501075_0462830
846 Ga0501076_0000591
847 Ga0501076_0031037
848 Ga0501076_0167640
849 Ga0501077_0001763
850 Ga0501077_0057212
851 Ga0501079_0033731
852 Ga0501079_0037933
853 Ga0501079_0071172
854 Ga0501079_0163428
855 Ga0501079_0171844
856 Ga0501079_0223460
857 Ga0501080_0084689
858 Ga0501080_0098394
859 Ga0501081_0011792
860 Ga0501081_0056279
861 Ga0501081_0094779
862 Ga0501081_0103640
863 Ga0501081_0135528
864 Ga0501083_0034730
865 Ga0501083_0043420
866 Ga0501035_0079950
867 Ga0501035_0096851
868 nmdc:mga03683_8536_c1
869 nmdc:mga03n38_247280_c1
870 nmdc:mga00v17_1217_c1
871 nmdc:mga0yw44_184632_c1
872 nmdc:mga0k408_3067_c1
873 nmdc:mga0k408_735_c1
874 nmdc:mga06z11_172474_c1
875 nmdc:mga06z11_311213_c1
876 nmdc:mga05p37_244386_c1
877 nmdc:mga05p37_645789_c1
878 nmdc:mga05p37_910011_c1
879 nmdc:mga09592_228245_c1
880 nmdc:mga09592_769593_c1
881 nmdc:mga0qj67_28541_c1
882 nmdc:mga06r32_10052_c1
883 nmdc:mga06r32_31198_c1
884 nmdc:mga06r32_411932_c1
885 nmdc:mga08y16_137881_c1
886 nmdc:mga08y16_343354_c1
887 nmdc:mga08y16_942208_c1
888 nmdc:mga0n895_14511_c1
889 nmdc:mga0n895_50743_c1
890 nmdc:mga0rr50_257751_c1
891 nmdc:mga0rr50_289636_c1
892 nmdc:mga0rr50_93777_c1
893 nmdc:mga0a205_450_c1
894 Ga0495612_0034696
895 Ga0500650_0163557
896 Ga0500654_048358
897 Ga0500604_0007516
898 Ga0500616_0001669
899 Ga0500645_073111
900 Ga0501084_0003901
901 Ga0501084_0037185
902 Ga0501084_0041913
903 Ga0501084_0099232
904 Ga0501084_0582845
905 Ga0501082_0027414
906 Ga0501082_0049478
907 Ga0501082_0159607
908 Ga0501082_0382303
909 Ga0530510_0003396
910 Ga0530510_0014365
911 2523384127
912 2524536553
913 2676205432
914 2774850007
915 2808829269
916 2812332073
917 2862516265
918 2919051925
919 2939601602
920 8004021937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

201

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

240

0.91

PF23441

1

239

0.83

PF08659

KR

KR domain

7

186

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.961 9 253
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9587 9 253
6ihi-assembly1.cif.gz_D crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9569 9 253
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.9554 9 253
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9521 9 253
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 10 191 3.40.50.720
af_P9WGQ9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9466 10 250 3.40.50.720
3svtA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9458 10 252 3.40.50.720
3u5tC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9455 11 250 3.40.50.720
af_G5EGA6_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9442 10 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4P9JDP6-F1-model_v4 SDR family oxidoreductase 0.9976 13 253 GO:0006633
GO:0016616
GO:0048038
AF-A0A6N1ECZ9-F1-model_v4 deleted 0.9959 10 253
AF-N1UT04-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9932 40 253 GO:0006633
GO:0016616
GO:0048038
AF-A0A7X9CXD9-F1-model_v4 deleted 0.992 94 253
AF-A0A4P9JDP6-F1-model_v4 SDR family oxidoreductase 0.9894 13 253 GO:0006633
GO:0016616
GO:0048038

Map