F448450

General Info

Members Datasets Scaffolds Average Seq Length
459 181 918 136

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_712_c1|nmdc:mga06z11_712_c1_4279_4764
Length 161
Sequence MTAATLPPPAFLRKSINATSPKRSSAMPETEPWEYSLYIPNDTRAVTVCRRTVRVILTMHGLLQLADTAELLATELVSNAVRHTKGPAALRLRWRDGVLRIGAWDADPQPPEPLSKLGDLVDEEDGRGLALVRACADVWGWQPLTRNGNRGKCVWCEIVAA

Samples

Sample ID Description Type Environment
1 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
6 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
7 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
8 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
9 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
10 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
11 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
12 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
13 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
14 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
15 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
16 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
17 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
18 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
19 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
20 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
21 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
22 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
23 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
24 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
25 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
26 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
27 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
28 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
29 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
30 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
31 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
32 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
33 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
34 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
35 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
36 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
37 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
38 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
39 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
40 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
41 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
42 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
43 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
49 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
50 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
51 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
52 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
53 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
54 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
55 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
56 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
57 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
58 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
59 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
60 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
61 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
62 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
63 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
64 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
68 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
69 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
70 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
71 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
72 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
79 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
83 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
92 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
100 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
144 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
145 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
146 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
147 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
148 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
149 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
150 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
151 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
152 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
153 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
154 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
155 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
158 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
159 2643221647 Streptomyces sp. Root369 Isolate Unclassified
160 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
161 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
162 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
163 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
164 2808606448 Streptomyces sp. 193411 Isolate Unclassified
165 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
166 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
167 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
168 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
169 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
170 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
171 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
172 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
173 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
174 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
175 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
176 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
177 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
178 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
179 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
180 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
181 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.07
Metatranscriptomes 0.22
Isolates 8.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 0.22
Rhizoplane 0
Rhizosphere 76.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06z11_712_c1 3300050494 Bacteria 12110
2 rootH1_10081137 3300003316 Bacteria 3328
3 rootH1_10112761 3300003316 Bacteria 1236
4 rootL2_10006674 3300003322 Bacteria 1965
5 Ga0006562J51391_1037208 3300003578 Bacteria 9350
6 Ga0075363_100091234 3300006048 Bacteria 1677
7 Ga0075367_10008878 3300006178 Bacteria 5230
8 Ga0099826_10079261 3300006948 Bacteria 2053
9 Ga0105243_10359271 3300009148 Bacteria 1340
10 Ga0183367_1002 3300015688 Bacteria 1101531
11 Ga0207647_10129491 3300025904 Bacteria 1484
12 Ga0209371_1041354 3300027312 Bacteria 933
13 Ga0307517_10001760 3300028786 Bacteria 35644
14 Ga0307517_10005838 3300028786 Bacteria 18413
15 Ga0307515_10001228 3300028794 Bacteria 58620
16 Ga0307515_10003019 3300028794 Bacteria 35727
17 Ga0307515_10115936 3300028794 Bacteria 3080
18 Ga0268256_1042921 3300030500 Bacteria 1001
19 Ga0307511_10000550 3300030521 Bacteria 40250
20 Ga0307511_10079254 3300030521 Bacteria 2322
21 Ga0307511_10090117 3300030521 Bacteria 2085
22 Ga0307511_10337338 3300030521 Bacteria 656
23 Ga0307512_10003265 3300030522 Bacteria 19111
24 Ga0307512_10010923 3300030522 Bacteria 8635
25 Ga0307512_10160551 3300030522 Bacteria 1318
26 Ga0307513_10010981 3300031456 Bacteria 11300
27 Ga0307513_10017836 3300031456 Bacteria 8502
28 Ga0307513_10171842 3300031456 Bacteria 2044
29 Ga0307513_10221081 3300031456 Bacteria 1715
30 Ga0307509_10006140 3300031507 Bacteria 16294
31 Ga0307509_10006774 3300031507 Bacteria 15256
32 Ga0307509_10019860 3300031507 Bacteria 7644
33 Ga0307509_10021728 3300031507 Bacteria 7248
34 Ga0307509_10031857 3300031507 Bacteria 5815
35 Ga0307509_10044717 3300031507 Bacteria 4782
36 Ga0307509_10122495 3300031507 Bacteria 2575
37 Ga0307508_10014397 3300031616 Bacteria 7216
38 Ga0307508_10018530 3300031616 Bacteria 6327
39 Ga0307508_10043091 3300031616 Bacteria 4044
40 Ga0307508_10077901 3300031616 Bacteria 2894
41 Ga0307508_10099860 3300031616 Bacteria 2496
42 Ga0307508_10118979 3300031616 Bacteria 2244
43 Ga0307508_10184947 3300031616 Bacteria 1686
44 Ga0307508_10249446 3300031616 Bacteria 1371
45 Ga0307508_10610650 3300031616 Bacteria 693
46 Ga0307514_10001786 3300031649 Bacteria 24306
47 Ga0307514_10003890 3300031649 Bacteria 13993
48 Ga0307514_10005869 3300031649 Bacteria 10834
49 Ga0307514_10030605 3300031649 Bacteria 4319
50 Ga0307514_10043765 3300031649 Bacteria 3514
51 Ga0307514_10355260 3300031649 Bacteria 778
52 Ga0307516_10001020 3300031730 Bacteria 38830
53 Ga0307516_10002850 3300031730 Bacteria 22777
54 Ga0307516_10014668 3300031730 Bacteria 8280
55 Ga0307516_10028837 3300031730 Bacteria 5613
56 Ga0307516_10063174 3300031730 Bacteria 3586
57 Ga0307516_10121627 3300031730 Bacteria 2400
58 Ga0307516_10644564 3300031730 Bacteria 714
59 Ga0307518_10008121 3300031838 Bacteria 7502
60 Ga0307518_10117451 3300031838 Bacteria 1887
61 Ga0307518_10299716 3300031838 Bacteria 978
62 Ga0307518_10493072 3300031838 Bacteria 634
63 Ga0307416_103013195 3300032002 Bacteria 564
64 Ga0307507_10017575 3300033179 Bacteria 8204
65 Ga0307507_10017781 3300033179 Bacteria 8138
66 Ga0307507_10027294 3300033179 Bacteria 6124
67 Ga0307507_10029603 3300033179 Bacteria 5802
68 Ga0307507_10038798 3300033179 Bacteria 4819
69 Ga0307510_10009740 3300033180 Bacteria 11435
70 Ga0307510_10030183 3300033180 Bacteria 6149
71 Ga0307510_10039990 3300033180 Bacteria 5156
72 Ga0307510_10058738 3300033180 Bacteria 3979
73 Ga0307510_10075629 3300033180 Bacteria 3319
74 Ga0307510_10083132 3300033180 Bacteria 3093
75 Ga0307510_10085083 3300033180 Bacteria 3041
76 Ga0307510_10088904 3300033180 Bacteria 2945
77 Ga0307510_10101573 3300033180 Bacteria 2663
78 Ga0307510_10144436 3300033180 Bacteria 2015
79 Ga0307510_10154871 3300033180 Bacteria 1901
80 Ga0307510_10279472 3300033180 Bacteria 1141
81 Ga0395898_0234156 3300037466 Bacteria 1751
82 Ga0439436_0000843 3300041404 Bacteria 8375
83 Ga0439439_0026768 3300041406 Bacteria 1455
84 Ga0451849_0296537 3300041505 Bacteria 703
85 Ga0451853_1449384 3300041512 Bacteria 1079
86 Ga0451853_3092768 3300041512 Bacteria 1375
87 Ga0439448_0152317 3300042005 Bacteria 803
88 Ga0439457_000016 3300042014 Bacteria 35777
89 Ga0439457_103967 3300042014 Bacteria 663
90 Ga0439462_0068308 3300042015 Bacteria 964
91 Ga0450894_000695 3300042131 Bacteria 5595
92 Ga0450894_013338 3300042131 Bacteria 1078
93 Ga0450896_001154 3300042133 Bacteria 3148
94 Ga0450898_006678 3300042134 Bacteria 1779
95 Ga0450899_000437 3300042135 Bacteria 4643
96 Ga0450902_022619 3300042137 Bacteria 1042
97 Ga0450903_000324 3300042138 Bacteria 10567
98 Ga0450906_002809 3300042145 Bacteria 3794
99 Ga0439458_0005212 3300042157 Bacteria 2927
100 Ga0439458_0014022 3300042157 Bacteria 1807
101 Ga0450908_005359 3300042184 Bacteria 2462
102 Ga0466969_0107447 3300044656 Bacteria 1308
103 Ga0466972_0010162 3300044658 Bacteria 4728
104 Ga0466966_0008659 3300044684 Bacteria 6734
105 Ga0466961_0031348 3300044693 Bacteria 3417
106 Ga0466963_0588454 3300044694 Bacteria 786
107 Ga0466968_0007512 3300044735 Bacteria 4148
108 Ga0466970_0418539 3300044765 Bacteria 766
109 Ga0466957_0083691 3300044842 Bacteria 1991
110 Ga0495617_017806 3300046452 Bacteria 2401
111 Ga0495627_180617 3300046453 Bacteria 584
112 Ga0495592_0005583 3300046454 Bacteria 9302
113 Ga0495592_0017254 3300046454 Bacteria 5483
114 Ga0495592_0027093 3300046454 Bacteria 4345
115 Ga0495592_0032766 3300046454 Bacteria 3919
116 Ga0495603_0023648 3300046455 Bacteria 3716
117 Ga0495603_0034670 3300046455 Bacteria 3033
118 Ga0495590_0010848 3300046457 Bacteria 3414
119 Ga0495590_0275699 3300046457 Bacteria 629
120 Ga0495629_0004262 3300046459 Bacteria 10724
121 Ga0495629_0007239 3300046459 Bacteria 8172
122 Ga0495629_0009127 3300046459 Bacteria 7264
123 Ga0495629_0027429 3300046459 Bacteria 4042
124 Ga0495629_0044417 3300046459 Bacteria 3118
125 Ga0495629_0049649 3300046459 Bacteria 2940
126 Ga0495629_0078592 3300046459 Bacteria 2303
127 Ga0495629_0485267 3300046459 Bacteria 834
128 Ga0495638_0009980 3300046460 Bacteria 6622
129 Ga0495638_0021003 3300046460 Bacteria 4309
130 Ga0495638_0155922 3300046460 Bacteria 1321
131 Ga0495651_0001611 3300046462 Bacteria 17483
132 Ga0495651_0002102 3300046462 Bacteria 15373
133 Ga0495651_0036259 3300046462 Bacteria 3839
134 Ga0495651_0039564 3300046462 Bacteria 3670
135 Ga0495651_0054346 3300046462 Bacteria 3080
136 Ga0495580_0427886 3300046472 Bacteria 890
137 Ga0495605_0007016 3300046474 Bacteria 6428
138 Ga0495605_0112608 3300046474 Bacteria 1240
139 Ga0495639_0192298 3300046475 Bacteria 996
140 Ga0495662_0000210 3300046476 Bacteria 24373
141 Ga0495662_0009769 3300046476 Bacteria 4712
142 Ga0495662_0010563 3300046476 Bacteria 4515
143 Ga0495662_0017718 3300046476 Bacteria 3449
144 Ga0495662_0120694 3300046476 Bacteria 1287
145 Ga0495662_0257843 3300046476 Bacteria 858
146 Ga0495664_0000318 3300046477 Bacteria 23148
147 Ga0495664_0010515 3300046477 Bacteria 5193
148 Ga0495664_0038530 3300046477 Bacteria 2821
149 Ga0495664_0378751 3300046477 Bacteria 851
150 Ga0495584_0172505 3300046491 Bacteria 1099
151 Ga0495585_0038186 3300046492 Bacteria 2703
152 Ga0495585_0232253 3300046492 Bacteria 926
153 Ga0495594_0018551 3300046499 Bacteria 3687
154 Ga0495594_0042523 3300046499 Bacteria 2488
155 Ga0495594_0152251 3300046499 Bacteria 1313
156 Ga0495596_0123258 3300046500 Bacteria 1006
157 Ga0495596_0140573 3300046500 Bacteria 937
158 Ga0495607_0056296 3300046501 Bacteria 2258
159 Ga0495583_0039346 3300046506 Bacteria 2228
160 Ga0495583_0054261 3300046506 Bacteria 1815
161 Ga0495583_0054781 3300046506 Bacteria 1804
162 Ga0495583_0059515 3300046506 Bacteria 1711
163 Ga0495583_0100242 3300046506 Bacteria 1237
164 Ga0495583_0227069 3300046506 Bacteria 753
165 Ga0495606_0018045 3300046507 Bacteria 5307
166 Ga0495606_0084837 3300046507 Bacteria 1960
167 Ga0495606_0171488 3300046507 Bacteria 1258
168 Ga0495606_0373421 3300046507 Bacteria 750
169 Ga0495608_0287857 3300046511 Bacteria 1019
170 Ga0495608_0295768 3300046511 Bacteria 1003
171 Ga0495608_0771921 3300046511 Bacteria 569
172 Ga0495610_0023157 3300046512 Bacteria 3383
173 Ga0495610_0062038 3300046512 Bacteria 1774
174 Ga0495610_0382843 3300046512 Bacteria 523
175 Ga0495616_0013186 3300046513 Bacteria 4670
176 Ga0495616_0022345 3300046513 Bacteria 3416
177 Ga0495618_0028300 3300046514 Bacteria 3492
178 Ga0495618_0034703 3300046514 Bacteria 3165
179 Ga0495618_0061553 3300046514 Bacteria 2381
180 Ga0495618_0079525 3300046514 Bacteria 2091
181 Ga0495618_0089390 3300046514 Bacteria 1969
182 Ga0495618_0321604 3300046514 Bacteria 958
183 Ga0495618_0439312 3300046514 Bacteria 793
184 Ga0495618_0476788 3300046514 Bacteria 754
185 Ga0495620_0006848 3300046515 Bacteria 6231
186 Ga0495620_0013665 3300046515 Bacteria 4150
187 Ga0495620_0024507 3300046515 Bacteria 2868
188 Ga0495628_0030737 3300046516 Bacteria 4347
189 Ga0495628_0042619 3300046516 Bacteria 3619
190 Ga0495628_0047098 3300046516 Bacteria 3423
191 Ga0495628_0115639 3300046516 Bacteria 2060
192 Ga0495628_0188171 3300046516 Bacteria 1559
193 Ga0495628_0566413 3300046516 Bacteria 814
194 Ga0495630_0053279 3300046517 Bacteria 3029
195 Ga0495630_0143968 3300046517 Bacteria 1812
196 Ga0495630_0578292 3300046517 Bacteria 861
197 Ga0495630_0723125 3300046517 Bacteria 761
198 Ga0495631_0160109 3300046518 Bacteria 966
199 Ga0495632_0435533 3300046519 Bacteria 570
200 Ga0495643_0006902 3300046522 Bacteria 7392
201 Ga0495643_0013151 3300046522 Bacteria 4966
202 Ga0495643_0206568 3300046522 Bacteria 940
203 Ga0495648_0034548 3300046524 Bacteria 3289
204 Ga0495648_0034801 3300046524 Bacteria 3273
205 Ga0495666_0012192 3300046526 Bacteria 4290
206 Ga0495666_0017446 3300046526 Bacteria 3575
207 Ga0495666_0041982 3300046526 Bacteria 2213
208 Ga0495666_0235550 3300046526 Bacteria 836
209 Ga0495666_0307280 3300046526 Bacteria 717
210 Ga0495666_0469328 3300046526 Bacteria 563
211 Ga0495642_0216750 3300046528 Bacteria 835
212 Ga0495652_0011740 3300046529 Bacteria 7913
213 Ga0495652_0096694 3300046529 Bacteria 2404
214 Ga0495652_0120163 3300046529 Bacteria 2097
215 Ga0495640_0284615 3300046533 Bacteria 1029
216 Ga0495586_0110244 3300046535 Bacteria 1531
217 Ga0495586_0154234 3300046535 Bacteria 1293
218 Ga0495586_0180891 3300046535 Bacteria 1192
219 Ga0495587_0006478 3300046536 Bacteria 7625
220 Ga0495587_0032638 3300046536 Bacteria 3146
221 Ga0495587_0066344 3300046536 Bacteria 2105
222 Ga0495609_0040045 3300046538 Bacteria 2109
223 Ga0495597_0018221 3300046542 Bacteria 3297
224 Ga0495597_0019866 3300046542 Bacteria 3137
225 Ga0495597_0078976 3300046542 Bacteria 1409
226 Ga0495645_0170353 3300046543 Bacteria 1499
227 Ga0495622_0005560 3300046557 Bacteria 5843
228 Ga0495622_0050641 3300046557 Bacteria 1926
229 Ga0495622_0226211 3300046557 Bacteria 827
230 Ga0495633_0105605 3300046558 Bacteria 1306
231 Ga0495633_0113399 3300046558 Bacteria 1257
232 Ga0495667_0089829 3300046559 Bacteria 1991
233 Ga0495668_0015537 3300046616 Bacteria 4442
234 Ga0495668_0021859 3300046616 Bacteria 3661
235 Ga0495668_0030788 3300046616 Bacteria 3026
236 Ga0495634_0001699 3300046642 Bacteria 19154
237 Ga0495634_0038719 3300046642 Bacteria 3249
238 Ga0495634_0048831 3300046642 Bacteria 2847
239 Ga0495634_0065871 3300046642 Bacteria 2399
240 Ga0495634_0282270 3300046642 Bacteria 1008
241 Ga0495611_0011958 3300046648 Bacteria 3686
242 Ga0495611_0026060 3300046648 Bacteria 2551
243 Ga0495611_0050823 3300046648 Bacteria 1867
244 Ga0495625_0021039 3300046660 Bacteria 5028
245 Ga0495625_0030569 3300046660 Bacteria 4016
246 Ga0495625_0043064 3300046660 Bacteria 3276
247 Ga0495625_0092576 3300046660 Bacteria 2088
248 Ga0495625_0296700 3300046660 Bacteria 1035
249 Ga0495635_0000625 3300046663 Bacteria 22767
250 Ga0495635_0009608 3300046663 Bacteria 6762
251 Ga0495635_0010584 3300046663 Bacteria 6456
252 Ga0495635_0012145 3300046663 Bacteria 6038
253 Ga0495635_0106264 3300046663 Bacteria 1917
254 Ga0495661_0083836 3300046665 Bacteria 1831
255 Ga0495588_0007908 3300046674 Bacteria 4858
256 Ga0495588_0023216 3300046674 Bacteria 3070
257 Ga0495588_0071224 3300046674 Bacteria 1807
258 Ga0495588_0121853 3300046674 Bacteria 1374
259 Ga0495588_0260147 3300046674 Bacteria 914
260 Ga0495588_0762464 3300046674 Bacteria 506
261 Ga0495657_0025712 3300046675 Bacteria 4177
262 Ga0495657_0032686 3300046675 Bacteria 3629
263 Ga0495657_0035449 3300046675 Bacteria 3457
264 Ga0495657_0056351 3300046675 Bacteria 2617
265 Ga0495657_0258685 3300046675 Bacteria 1046
266 Ga0495599_0085591 3300046678 Bacteria 1969
267 Ga0495623_0033502 3300046679 Bacteria 3296
268 Ga0495623_0073302 3300046679 Bacteria 2128
269 Ga0495646_0002735 3300046680 Bacteria 10896
270 Ga0495646_0004053 3300046680 Bacteria 9190
271 Ga0495646_0007740 3300046680 Bacteria 6827
272 Ga0495646_0027207 3300046680 Bacteria 3588
273 Ga0495646_0155594 3300046680 Bacteria 1269
274 Ga0495646_0435774 3300046680 Bacteria 678
275 Ga0495658_0114155 3300046683 Bacteria 1627
276 Ga0495658_0361200 3300046683 Bacteria 923
277 Ga0495613_0001048 3300046689 Bacteria 21082
278 Ga0495613_0015689 3300046689 Bacteria 5637
279 Ga0495613_0022398 3300046689 Bacteria 4708
280 Ga0495613_0026363 3300046689 Bacteria 4330
281 Ga0495613_0028680 3300046689 Bacteria 4140
282 Ga0495613_0064823 3300046689 Bacteria 2670
283 Ga0495613_0069121 3300046689 Bacteria 2575
284 Ga0495613_0076063 3300046689 Bacteria 2443
285 Ga0495613_0301618 3300046689 Bacteria 1109
286 Ga0495613_0686882 3300046689 Bacteria 675
287 Ga0495624_0009143 3300046690 Bacteria 6870
288 Ga0495624_0042933 3300046690 Bacteria 2887
289 Ga0495624_0051965 3300046690 Bacteria 2591
290 Ga0495624_0215410 3300046690 Bacteria 1165
291 Ga0495624_0644285 3300046690 Bacteria 630
292 Ga0495670_0235275 3300046691 Bacteria 975
293 Ga0495671_0002301 3300046692 Bacteria 12139
294 Ga0495671_0044008 3300046692 Bacteria 2239
295 Ga0495671_0160604 3300046692 Bacteria 1093
296 Ga0495671_0336921 3300046692 Bacteria 724
297 Ga0495671_0488696 3300046692 Bacteria 587
298 Ga0495649_0037961 3300046694 Bacteria 2643
299 Ga0495649_0069814 3300046694 Bacteria 1884
300 Ga0495649_0122971 3300046694 Bacteria 1371
301 Ga0495649_0152507 3300046694 Bacteria 1213
302 Ga0495589_0013387 3300046794 Bacteria 4233
303 Ga0495589_0026980 3300046794 Bacteria 2907
304 Ga0495589_0027736 3300046794 Bacteria 2862
305 Ga0495589_0166080 3300046794 Bacteria 1050
306 Ga0495600_0029943 3300046809 Bacteria 3525
307 Ga0495600_0031590 3300046809 Bacteria 3431
308 Ga0495600_0877085 3300046809 Bacteria 530
309 Ga0495660_0026347 3300046810 Bacteria 3296
310 Ga0495660_0027325 3300046810 Bacteria 3230
311 Ga0495660_0048644 3300046810 Bacteria 2318
312 Ga0495660_0075493 3300046810 Bacteria 1778
313 Ga0495581_0022682 3300047315 Bacteria 3636
314 Ga0495581_0046290 3300047315 Bacteria 2513
315 Ga0495581_0076480 3300047315 Bacteria 1937
316 Ga0495581_0285165 3300047315 Bacteria 965
317 Ga0495581_0532644 3300047315 Bacteria 682
318 Ga0495604_0000902 3300047317 Bacteria 24693
319 Ga0495604_0001619 3300047317 Bacteria 18556
320 Ga0495604_0021937 3300047317 Bacteria 5097
321 Ga0495604_0043925 3300047317 Bacteria 3495
322 Ga0495604_0384679 3300047317 Bacteria 926
323 Ga0495636_0005527 3300047318 Bacteria 4961
324 Ga0495636_0041049 3300047318 Bacteria 1919
325 Ga0495636_0121262 3300047318 Bacteria 1157
326 Ga0495636_0143676 3300047318 Bacteria 1067
327 Ga0495636_0246522 3300047318 Bacteria 825
328 Ga0495636_0330999 3300047318 Bacteria 716
329 Ga0495674_0054002 3300047319 Bacteria 3530
330 Ga0495674_0470317 3300047319 Bacteria 1008
331 Ga0495676_0003144 3300047321 Bacteria 14936
332 Ga0495676_0029022 3300047321 Bacteria 4714
333 Ga0495676_0031707 3300047321 Bacteria 4466
334 Ga0495676_0056680 3300047321 Bacteria 3097
335 Ga0495676_0089212 3300047321 Bacteria 2310
336 Ga0495676_0116511 3300047321 Bacteria 1950
337 Ga0495676_0166825 3300047321 Bacteria 1552
338 Ga0495676_0176488 3300047321 Bacteria 1500
339 Ga0495676_0193023 3300047321 Bacteria 1419
340 Ga0495676_0694759 3300047321 Bacteria 658
341 Ga0495680_0030938 3300047322 Bacteria 4361
342 Ga0495680_0063088 3300047322 Bacteria 2846
343 Ga0495683_0042998 3300047323 Bacteria 2276
344 Ga0495683_0048804 3300047323 Bacteria 2121
345 Ga0495687_002003 3300047443 Bacteria 17257
346 Ga0495687_002011 3300047443 Bacteria 17238
347 Ga0495687_007169 3300047443 Bacteria 6640
348 Ga0495687_011940 3300047443 Bacteria 4633
349 Ga0495687_023458 3300047443 Bacteria 2946
350 Ga0495687_030222 3300047443 Bacteria 2496
351 Ga0495687_031164 3300047443 Bacteria 2448
352 Ga0495687_032145 3300047443 Bacteria 2399
353 Ga0495675_0037240 3300047444 Bacteria 3098
354 Ga0495675_0075375 3300047444 Bacteria 2126
355 Ga0495675_0854139 3300047444 Bacteria 501
356 Ga0495677_0031731 3300047445 Bacteria 1923
357 Ga0495685_006225 3300047447 Bacteria 3903
358 Ga0495685_012379 3300047447 Bacteria 2889
359 Ga0495685_012940 3300047447 Bacteria 2829
360 Ga0495685_012957 3300047447 Bacteria 2827
361 Ga0495685_047992 3300047447 Bacteria 1451
362 Ga0495685_110560 3300047447 Bacteria 904
363 Ga0495685_222188 3300047447 Bacteria 603
364 Ga0495681_0001587 3300047470 Bacteria 16893
365 Ga0495681_0071866 3300047470 Bacteria 1566
366 Ga0495684_0199217 3300047471 Bacteria 1477
367 Ga0495684_0257636 3300047471 Bacteria 1267
368 Ga0495686_0057355 3300047472 Bacteria 2431
369 Ga0495686_0180285 3300047472 Bacteria 1224
370 Ga0495593_0016788 3300047673 Bacteria 4123
371 Ga0495593_0032716 3300047673 Bacteria 2833
372 Ga0495593_0055636 3300047673 Bacteria 2081
373 Ga0495593_0132187 3300047673 Bacteria 1266
374 Ga0495593_0157452 3300047673 Bacteria 1147
375 Ga0495602_0004725 3300048088 Bacteria 14239
376 Ga0495614_0003916 3300048089 Bacteria 6686
377 Ga0495614_0004798 3300048089 Bacteria 6104
378 Ga0495614_0009601 3300048089 Bacteria 4275
379 Ga0495614_0013040 3300048089 Bacteria 3643
380 Ga0495614_0014343 3300048089 Bacteria 3469
381 Ga0495614_0032779 3300048089 Bacteria 2235
382 Ga0495614_0035520 3300048089 Bacteria 2141
383 Ga0495614_0041649 3300048089 Bacteria 1970
384 Ga0495614_0061556 3300048089 Bacteria 1613
385 Ga0495626_0037289 3300048091 Bacteria 2311
386 Ga0495626_0149081 3300048091 Bacteria 987
387 Ga0495678_035129 3300049459 Bacteria 2058
388 Ga0495678_071452 3300049459 Bacteria 1271
389 Ga0501033_0019425 3300049570 Bacteria 5139
390 Ga0501034_0017306 3300049571 Bacteria 7395
391 Ga0501036_0026330 3300049572 Bacteria 4908
392 Ga0501036_0381497 3300049572 Bacteria 1176
393 Ga0501036_0880420 3300049572 Bacteria 735
394 Ga0501038_0468772 3300049574 Bacteria 966
395 Ga0501039_0635165 3300049575 Bacteria 836
396 Ga0501047_0249016 3300049581 Bacteria 1625
397 Ga0501047_0359389 3300049581 Bacteria 1292
398 Ga0501035_0041961 3300049822 Bacteria 4128
399 Ga0501044_0001268 3300049823 Bacteria 29826
400 Ga0501044_0007527 3300049823 Bacteria 11977
401 nmdc:mga03n38_15672_c1 3300050490 Bacteria 2930
402 Ga0495619_0216887 3300053085 Bacteria 1325
403 Ga0500644_0024771 3300053088 Bacteria 1838
404 Ga0500644_0057445 3300053088 Bacteria 1358
405 Ga0500647_0116157 3300053091 Bacteria 1269
406 Ga0500583_0229658 3300053092 Bacteria 919
407 Ga0500651_0608517 3300053093 Bacteria 592
408 Ga0500640_060827 3300053095 Bacteria 1638
409 Ga0500650_0230292 3300053098 Bacteria 836
410 Ga0500553_068101 3300053101 Bacteria 1645
411 Ga0500558_069888 3300053106 Bacteria 1451
412 Ga0500560_001214 3300053107 Bacteria 4308
413 Ga0500560_066893 3300053107 Bacteria 1179
414 Ga0500572_005410 3300053111 Bacteria 2891
415 Ga0500572_039430 3300053111 Bacteria 1363
416 Ga0500608_101932 3300053122 Bacteria 1329
417 Ga0500573_0027617 3300053140 Bacteria 3265
418 Ga0500634_0398995 3300053161 Bacteria 509
419 Ga0466962_0056847 3300061719 Bacteria 1868
420 2585312669 2582581314 Bacteria 11452267
421 2616696741 2616644814 Bacteria 11555299
422 2644261545 2643221647 Bacteria 10741251
423 2644263575 2643221647 Bacteria 10741251
424 2644436959 2643221678 Bacteria 9540101
425 2644442922 2643221678 Bacteria 9540101
426 2785343548 2784746763 Bacteria 9783172
427 2785370320 2784746768 Bacteria 10036182
428 2808841853 2808606359 Bacteria 9866990
429 2808842657 2808606359 Bacteria 9866990
430 2809231679 2808606448 Bacteria 8656184
431 2809233281 2808606448 Bacteria 8656184
432 2862287366 2862281513 Bacteria 9621493
433 2862509368 2862507626 Bacteria 9425308
434 2862510135 2862507626 Bacteria 9425308
435 2863404920 2863404153 Bacteria 9672205
436 2877679568 2877676314 Bacteria 9512378
437 2877679756 2877676314 Bacteria 9512378
438 2912718396 2912715099 Bacteria 9460473
439 2954003008 2954002825 Bacteria 9173742
440 2954384469 2954380949 Bacteria 10050426
441 2954384684 2954380949 Bacteria 10050426
442 2954386232 2954380949 Bacteria 10050426
443 2954695527 2954691527 Bacteria 10720516
444 2954710521 2954701450 Bacteria 10834262
445 2954710721 2954701450 Bacteria 10834262
446 2954714767 2954711539 Bacteria 10867210
447 2954714954 2954711539 Bacteria 10867210
448 2954724712 2954721474 Bacteria 10456478
449 2954724897 2954721474 Bacteria 10456478
450 2954736921 2954731030 Bacteria 10243860
451 2954737105 2954731030 Bacteria 10243860
452 2954743636 2954740390 Bacteria 10229294
453 2954743823 2954740390 Bacteria 10229294
454 2954755770 2954749733 Bacteria 10366972
455 2954755958 2954749733 Bacteria 10366972
456 2954762588 2954759201 Bacteria 9358192
457 2954762776 2954759201 Bacteria 9358192
458 8008577506 8008574985 Bacteria 7815457
459 8023626395 8023623736 Bacteria 8593882
460 nmdc:mga06z11_712_c1
461 rootH1_10081137
462 rootH1_10112761
463 rootL2_10006674
464 Ga0006562J51391_1037208
465 Ga0075363_100091234
466 Ga0075367_10008878
467 Ga0099826_10079261
468 Ga0105243_10359271
469 Ga0183367_1002
470 Ga0207647_10129491
471 Ga0209371_1041354
472 Ga0307517_10001760
473 Ga0307517_10005838
474 Ga0307515_10001228
475 Ga0307515_10003019
476 Ga0307515_10115936
477 Ga0268256_1042921
478 Ga0307511_10000550
479 Ga0307511_10079254
480 Ga0307511_10090117
481 Ga0307511_10337338
482 Ga0307512_10003265
483 Ga0307512_10010923
484 Ga0307512_10160551
485 Ga0307513_10010981
486 Ga0307513_10017836
487 Ga0307513_10171842
488 Ga0307513_10221081
489 Ga0307509_10006140
490 Ga0307509_10006774
491 Ga0307509_10019860
492 Ga0307509_10021728
493 Ga0307509_10031857
494 Ga0307509_10044717
495 Ga0307509_10122495
496 Ga0307508_10014397
497 Ga0307508_10018530
498 Ga0307508_10043091
499 Ga0307508_10077901
500 Ga0307508_10099860
501 Ga0307508_10118979
502 Ga0307508_10184947
503 Ga0307508_10249446
504 Ga0307508_10610650
505 Ga0307514_10001786
506 Ga0307514_10003890
507 Ga0307514_10005869
508 Ga0307514_10030605
509 Ga0307514_10043765
510 Ga0307514_10355260
511 Ga0307516_10001020
512 Ga0307516_10002850
513 Ga0307516_10014668
514 Ga0307516_10028837
515 Ga0307516_10063174
516 Ga0307516_10121627
517 Ga0307516_10644564
518 Ga0307518_10008121
519 Ga0307518_10117451
520 Ga0307518_10299716
521 Ga0307518_10493072
522 Ga0307416_103013195
523 Ga0307507_10017575
524 Ga0307507_10017781
525 Ga0307507_10027294
526 Ga0307507_10029603
527 Ga0307507_10038798
528 Ga0307510_10009740
529 Ga0307510_10030183
530 Ga0307510_10039990
531 Ga0307510_10058738
532 Ga0307510_10075629
533 Ga0307510_10083132
534 Ga0307510_10085083
535 Ga0307510_10088904
536 Ga0307510_10101573
537 Ga0307510_10144436
538 Ga0307510_10154871
539 Ga0307510_10279472
540 Ga0395898_0234156
541 Ga0439436_0000843
542 Ga0439439_0026768
543 Ga0451849_0296537
544 Ga0451853_1449384
545 Ga0451853_3092768
546 Ga0439448_0152317
547 Ga0439457_000016
548 Ga0439457_103967
549 Ga0439462_0068308
550 Ga0450894_000695
551 Ga0450894_013338
552 Ga0450896_001154
553 Ga0450898_006678
554 Ga0450899_000437
555 Ga0450902_022619
556 Ga0450903_000324
557 Ga0450906_002809
558 Ga0439458_0005212
559 Ga0439458_0014022
560 Ga0450908_005359
561 Ga0466969_0107447
562 Ga0466972_0010162
563 Ga0466966_0008659
564 Ga0466961_0031348
565 Ga0466963_0588454
566 Ga0466968_0007512
567 Ga0466970_0418539
568 Ga0466957_0083691
569 Ga0495617_017806
570 Ga0495627_180617
571 Ga0495592_0005583
572 Ga0495592_0017254
573 Ga0495592_0027093
574 Ga0495592_0032766
575 Ga0495603_0023648
576 Ga0495603_0034670
577 Ga0495590_0010848
578 Ga0495590_0275699
579 Ga0495629_0004262
580 Ga0495629_0007239
581 Ga0495629_0009127
582 Ga0495629_0027429
583 Ga0495629_0044417
584 Ga0495629_0049649
585 Ga0495629_0078592
586 Ga0495629_0485267
587 Ga0495638_0009980
588 Ga0495638_0021003
589 Ga0495638_0155922
590 Ga0495651_0001611
591 Ga0495651_0002102
592 Ga0495651_0036259
593 Ga0495651_0039564
594 Ga0495651_0054346
595 Ga0495580_0427886
596 Ga0495605_0007016
597 Ga0495605_0112608
598 Ga0495639_0192298
599 Ga0495662_0000210
600 Ga0495662_0009769
601 Ga0495662_0010563
602 Ga0495662_0017718
603 Ga0495662_0120694
604 Ga0495662_0257843
605 Ga0495664_0000318
606 Ga0495664_0010515
607 Ga0495664_0038530
608 Ga0495664_0378751
609 Ga0495584_0172505
610 Ga0495585_0038186
611 Ga0495585_0232253
612 Ga0495594_0018551
613 Ga0495594_0042523
614 Ga0495594_0152251
615 Ga0495596_0123258
616 Ga0495596_0140573
617 Ga0495607_0056296
618 Ga0495583_0039346
619 Ga0495583_0054261
620 Ga0495583_0054781
621 Ga0495583_0059515
622 Ga0495583_0100242
623 Ga0495583_0227069
624 Ga0495606_0018045
625 Ga0495606_0084837
626 Ga0495606_0171488
627 Ga0495606_0373421
628 Ga0495608_0287857
629 Ga0495608_0295768
630 Ga0495608_0771921
631 Ga0495610_0023157
632 Ga0495610_0062038
633 Ga0495610_0382843
634 Ga0495616_0013186
635 Ga0495616_0022345
636 Ga0495618_0028300
637 Ga0495618_0034703
638 Ga0495618_0061553
639 Ga0495618_0079525
640 Ga0495618_0089390
641 Ga0495618_0321604
642 Ga0495618_0439312
643 Ga0495618_0476788
644 Ga0495620_0006848
645 Ga0495620_0013665
646 Ga0495620_0024507
647 Ga0495628_0030737
648 Ga0495628_0042619
649 Ga0495628_0047098
650 Ga0495628_0115639
651 Ga0495628_0188171
652 Ga0495628_0566413
653 Ga0495630_0053279
654 Ga0495630_0143968
655 Ga0495630_0578292
656 Ga0495630_0723125
657 Ga0495631_0160109
658 Ga0495632_0435533
659 Ga0495643_0006902
660 Ga0495643_0013151
661 Ga0495643_0206568
662 Ga0495648_0034548
663 Ga0495648_0034801
664 Ga0495666_0012192
665 Ga0495666_0017446
666 Ga0495666_0041982
667 Ga0495666_0235550
668 Ga0495666_0307280
669 Ga0495666_0469328
670 Ga0495642_0216750
671 Ga0495652_0011740
672 Ga0495652_0096694
673 Ga0495652_0120163
674 Ga0495640_0284615
675 Ga0495586_0110244
676 Ga0495586_0154234
677 Ga0495586_0180891
678 Ga0495587_0006478
679 Ga0495587_0032638
680 Ga0495587_0066344
681 Ga0495609_0040045
682 Ga0495597_0018221
683 Ga0495597_0019866
684 Ga0495597_0078976
685 Ga0495645_0170353
686 Ga0495622_0005560
687 Ga0495622_0050641
688 Ga0495622_0226211
689 Ga0495633_0105605
690 Ga0495633_0113399
691 Ga0495667_0089829
692 Ga0495668_0015537
693 Ga0495668_0021859
694 Ga0495668_0030788
695 Ga0495634_0001699
696 Ga0495634_0038719
697 Ga0495634_0048831
698 Ga0495634_0065871
699 Ga0495634_0282270
700 Ga0495611_0011958
701 Ga0495611_0026060
702 Ga0495611_0050823
703 Ga0495625_0021039
704 Ga0495625_0030569
705 Ga0495625_0043064
706 Ga0495625_0092576
707 Ga0495625_0296700
708 Ga0495635_0000625
709 Ga0495635_0009608
710 Ga0495635_0010584
711 Ga0495635_0012145
712 Ga0495635_0106264
713 Ga0495661_0083836
714 Ga0495588_0007908
715 Ga0495588_0023216
716 Ga0495588_0071224
717 Ga0495588_0121853
718 Ga0495588_0260147
719 Ga0495588_0762464
720 Ga0495657_0025712
721 Ga0495657_0032686
722 Ga0495657_0035449
723 Ga0495657_0056351
724 Ga0495657_0258685
725 Ga0495599_0085591
726 Ga0495623_0033502
727 Ga0495623_0073302
728 Ga0495646_0002735
729 Ga0495646_0004053
730 Ga0495646_0007740
731 Ga0495646_0027207
732 Ga0495646_0155594
733 Ga0495646_0435774
734 Ga0495658_0114155
735 Ga0495658_0361200
736 Ga0495613_0001048
737 Ga0495613_0015689
738 Ga0495613_0022398
739 Ga0495613_0026363
740 Ga0495613_0028680
741 Ga0495613_0064823
742 Ga0495613_0069121
743 Ga0495613_0076063
744 Ga0495613_0301618
745 Ga0495613_0686882
746 Ga0495624_0009143
747 Ga0495624_0042933
748 Ga0495624_0051965
749 Ga0495624_0215410
750 Ga0495624_0644285
751 Ga0495670_0235275
752 Ga0495671_0002301
753 Ga0495671_0044008
754 Ga0495671_0160604
755 Ga0495671_0336921
756 Ga0495671_0488696
757 Ga0495649_0037961
758 Ga0495649_0069814
759 Ga0495649_0122971
760 Ga0495649_0152507
761 Ga0495589_0013387
762 Ga0495589_0026980
763 Ga0495589_0027736
764 Ga0495589_0166080
765 Ga0495600_0029943
766 Ga0495600_0031590
767 Ga0495600_0877085
768 Ga0495660_0026347
769 Ga0495660_0027325
770 Ga0495660_0048644
771 Ga0495660_0075493
772 Ga0495581_0022682
773 Ga0495581_0046290
774 Ga0495581_0076480
775 Ga0495581_0285165
776 Ga0495581_0532644
777 Ga0495604_0000902
778 Ga0495604_0001619
779 Ga0495604_0021937
780 Ga0495604_0043925
781 Ga0495604_0384679
782 Ga0495636_0005527
783 Ga0495636_0041049
784 Ga0495636_0121262
785 Ga0495636_0143676
786 Ga0495636_0246522
787 Ga0495636_0330999
788 Ga0495674_0054002
789 Ga0495674_0470317
790 Ga0495676_0003144
791 Ga0495676_0029022
792 Ga0495676_0031707
793 Ga0495676_0056680
794 Ga0495676_0089212
795 Ga0495676_0116511
796 Ga0495676_0166825
797 Ga0495676_0176488
798 Ga0495676_0193023
799 Ga0495676_0694759
800 Ga0495680_0030938
801 Ga0495680_0063088
802 Ga0495683_0042998
803 Ga0495683_0048804
804 Ga0495687_002003
805 Ga0495687_002011
806 Ga0495687_007169
807 Ga0495687_011940
808 Ga0495687_023458
809 Ga0495687_030222
810 Ga0495687_031164
811 Ga0495687_032145
812 Ga0495675_0037240
813 Ga0495675_0075375
814 Ga0495675_0854139
815 Ga0495677_0031731
816 Ga0495685_006225
817 Ga0495685_012379
818 Ga0495685_012940
819 Ga0495685_012957
820 Ga0495685_047992
821 Ga0495685_110560
822 Ga0495685_222188
823 Ga0495681_0001587
824 Ga0495681_0071866
825 Ga0495684_0199217
826 Ga0495684_0257636
827 Ga0495686_0057355
828 Ga0495686_0180285
829 Ga0495593_0016788
830 Ga0495593_0032716
831 Ga0495593_0055636
832 Ga0495593_0132187
833 Ga0495593_0157452
834 Ga0495602_0004725
835 Ga0495614_0003916
836 Ga0495614_0004798
837 Ga0495614_0009601
838 Ga0495614_0013040
839 Ga0495614_0014343
840 Ga0495614_0032779
841 Ga0495614_0035520
842 Ga0495614_0041649
843 Ga0495614_0061556
844 Ga0495626_0037289
845 Ga0495626_0149081
846 Ga0495678_035129
847 Ga0495678_071452
848 Ga0501033_0019425
849 Ga0501034_0017306
850 Ga0501036_0026330
851 Ga0501036_0381497
852 Ga0501036_0880420
853 Ga0501038_0468772
854 Ga0501039_0635165
855 Ga0501047_0249016
856 Ga0501047_0359389
857 Ga0501035_0041961
858 Ga0501044_0001268
859 Ga0501044_0007527
860 nmdc:mga03n38_15672_c1
861 Ga0495619_0216887
862 Ga0500644_0024771
863 Ga0500644_0057445
864 Ga0500647_0116157
865 Ga0500583_0229658
866 Ga0500651_0608517
867 Ga0500640_060827
868 Ga0500650_0230292
869 Ga0500553_068101
870 Ga0500558_069888
871 Ga0500560_001214
872 Ga0500560_066893
873 Ga0500572_005410
874 Ga0500572_039430
875 Ga0500608_101932
876 Ga0500573_0027617
877 Ga0500634_0398995
878 Ga0466962_0056847
879 2585312669
880 2616696741
881 2644261545
882 2644263575
883 2644436959
884 2644442922
885 2785343548
886 2785370320
887 2808841853
888 2808842657
889 2809231679
890 2809233281
891 2862287366
892 2862509368
893 2862510135
894 2863404920
895 2877679568
896 2877679756
897 2912718396
898 2954003008
899 2954384469
900 2954384684
901 2954386232
902 2954695527
903 2954710521
904 2954710721
905 2954714767
906 2954714954
907 2954724712
908 2954724897
909 2954736921
910 2954737105
911 2954743636
912 2954743823
913 2954755770
914 2954755958
915 2954762588
916 2954762776
917 8008577506
918 8023626395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

39

157

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8393 7 123
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8348 7 121
6m36-assembly2.cif.gz_K the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8325 7 121
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.832 7 123
6m36-assembly2.cif.gz_M the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8157 7 121
ID Description Score Start End Superfamily
af_P71568_133_255_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8302 7 122 3.30.565.10
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.7944 9 123 3.90.1100.10
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7536 7 120 3.30.565.10
af_Q2FWJ3_5_155_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7514 7 121 3.30.565.10
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.7433 9 123 3.90.1100.10
ID Description Score Start End GO Terms
AF-A0A559V394-F1-model_v4 Anti-sigma regulatory factor (Ser/Thr protein kinase) 0.9795 5 75
AF-A0A6G4X7M8-F1-model_v4 ATP-binding protein 0.9678 2 79 GO:0005524
AF-A0A3R8Y6V2-F1-model_v4 ATP-binding protein 0.961 4 78 GO:0005524
AF-A0A4R9EHV9-F1-model_v4 ATP-binding protein 0.9535 1 79 GO:0005524
AF-A0A6B2E1K1-F1-model_v4 ATP-binding protein 0.9464 4 79 GO:0005524

Map