F448318

General Info

Members Datasets Scaffolds Average Seq Length
459 228 918 192

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100176598|Ga0070663_1001765982
Length 216
Sequence MKGTRSRAPGDLPVSVNRTAVVSEDIMANAITVSNPAQERALARAKQIAIVIGASLFVALCARVTIPLPFTPVPLTLQNFAVLLVGLVLGSRRGFAAMALYLAEGALGLPVFNPHGLGGVAQLLGPTGGYLMAYPLVAALAGYVFEGGRRTFARAAFGGFLAEVLLFACGLAWLAIYTGSIVQAFRFGLYWFLFAEIIKVFLAAGAAARWKRIVKA

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
112 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 1.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.32
Rhizosphere 93.46
Stem 0
Stem Tuber 0
Unclassified 28.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100176598 3300005455 Bacteria 1654
2 JGI24752J21851_1002260 3300001976 Bacteria 2571
3 JGI24747J21853_1001261 3300001978 Bacteria 1864
4 JGI24737J22298_10028580 3300001990 Bacteria 1752
5 JGI24743J22301_10007594 3300001991 Bacteria 1886
6 JGI24748J21848_1004440 3300002074 Bacteria 1612
7 JGI24751J29686_10000500 3300002459 Bacteria 11483
8 Ga0065707_10449513 3300005295 Bacteria 802
9 Ga0070676_10111106 3300005328 Bacteria 1707
10 Ga0070683_100031745 3300005329 Unclassified 4806
11 Ga0070683_100054326 3300005329 Unclassified 3714
12 Ga0070690_100016762 3300005330 Unclassified 4396
13 Ga0070670_100057791 3300005331 Unclassified 3329
14 Ga0070677_10061299 3300005333 Bacteria 1552
15 Ga0068869_100033738 3300005334 Unclassified 3615
16 Ga0070666_10010605 3300005335 Bacteria 5766
17 Ga0070666_10043025 3300005335 Unclassified 3023
18 Ga0070680_100161537 3300005336 Unclassified 1883
19 Ga0070680_100594255 3300005336 Unclassified 950
20 Ga0070682_100033637 3300005337 Bacteria 3116
21 Ga0070682_100109511 3300005337 Bacteria 1838
22 Ga0068868_100004656 3300005338 Bacteria 9628
23 Ga0068868_100045396 3300005338 Bacteria 3437
24 Ga0070660_100003640 3300005339 Bacteria 10643
25 Ga0070660_100018529 3300005339 Bacteria 5088
26 Ga0070660_100244056 3300005339 Bacteria 1463
27 Ga0070689_100058620 3300005340 Unclassified 2990
28 Ga0070687_100000681 3300005343 Bacteria 11344
29 Ga0070661_100015951 3300005344 Bacteria 5302
30 Ga0070661_100052278 3300005344 Unclassified 2990
31 Ga0070661_100292668 3300005344 Bacteria 1266
32 Ga0070692_10091915 3300005345 Bacteria 1651
33 Ga0070668_100118721 3300005347 Bacteria 2111
34 Ga0070668_100154119 3300005347 Unclassified 1860
35 Ga0070675_100027589 3300005354 Unclassified 4563
36 Ga0070675_100512876 3300005354 Unclassified 1081
37 Ga0070673_100100138 3300005364 Unclassified 2385
38 Ga0070688_100001181 3300005365 Bacteria 13000
39 Ga0070659_100009712 3300005366 Bacteria 7069
40 Ga0070659_100021277 3300005366 Bacteria 4936
41 Ga0070659_100089680 3300005366 Bacteria 2463
42 Ga0070667_100027858 3300005367 Bacteria 4702
43 Ga0070709_10000885 3300005434 Bacteria 16785
44 Ga0070709_10011105 3300005434 Bacteria 5008
45 Ga0070709_10100850 3300005434 Bacteria 1923
46 Ga0070709_10296424 3300005434 Bacteria 1180
47 Ga0070714_100112883 3300005435 Bacteria 2409
48 Ga0070714_100146488 3300005435 Unclassified 2125
49 Ga0070714_100228947 3300005435 Bacteria 1712
50 Ga0070713_100000496 3300005436 Bacteria 25189
51 Ga0070713_100000703 3300005436 Bacteria 21478
52 Ga0070713_100013067 3300005436 Bacteria 6117
53 Ga0070713_100098079 3300005436 Bacteria 2533
54 Ga0070713_100274504 3300005436 Bacteria 1545
55 Ga0070713_100410760 3300005436 Bacteria 1266
56 Ga0070710_10021435 3300005437 Bacteria 3368
57 Ga0070710_10061544 3300005437 Bacteria 2138
58 Ga0070710_10064731 3300005437 Bacteria 2092
59 Ga0070711_100000530 3300005439 Bacteria 19825
60 Ga0070711_100005399 3300005439 Bacteria 7646
61 Ga0070711_100075209 3300005439 Unclassified 2391
62 Ga0070711_100091012 3300005439 Bacteria 2198
63 Ga0070711_100320772 3300005439 Bacteria 1238
64 Ga0070711_100500039 3300005439 Bacteria 1002
65 Ga0070711_100990350 3300005439 Bacteria 721
66 Ga0070705_100110195 3300005440 Unclassified 1757
67 Ga0070700_100482909 3300005441 Unclassified 949
68 Ga0070708_100003735 3300005445 Bacteria 11943
69 Ga0070708_100005746 3300005445 Bacteria 9841
70 Ga0070708_100009434 3300005445 Bacteria 7866
71 Ga0070708_100054400 3300005445 Bacteria 3554
72 Ga0070708_100094013 3300005445 Bacteria 2734
73 Ga0070708_100436412 3300005445 Viruses 1235
74 Ga0070708_100454439 3300005445 Bacteria 1208
75 Ga0070663_100009421 3300005455 Bacteria 6046
76 Ga0070663_100021300 3300005455 Unclassified 4309
77 Ga0070678_100021241 3300005456 Unclassified 4277
78 Ga0070678_100054561 3300005456 Bacteria 2913
79 Ga0070678_100925595 3300005456 Bacteria 798
80 Ga0070662_100005537 3300005457 Bacteria 8071
81 Ga0070681_10034561 3300005458 Bacteria 5075
82 Ga0070681_10132123 3300005458 Bacteria 2428
83 Ga0068867_100007753 3300005459 Bacteria 7590
84 Ga0068867_100189441 3300005459 Bacteria 1640
85 Ga0070685_10089836 3300005466 Unclassified 1857
86 Ga0070706_100001890 3300005467 Bacteria 21616
87 Ga0070707_100004782 3300005468 Bacteria 12675
88 Ga0070707_100120124 3300005468 Unclassified 2551
89 Ga0070707_100789177 3300005468 Unclassified 913
90 Ga0070698_100000148 3300005471 Bacteria 63449
91 Ga0070698_100081507 3300005471 Bacteria 3229
92 Ga0070698_100467424 3300005471 Bacteria 1197
93 Ga0070699_100008856 3300005518 Bacteria 8714
94 Ga0070699_100024485 3300005518 Bacteria 5203
95 Ga0070699_100096615 3300005518 Bacteria 2587
96 Ga0070699_100103558 3300005518 Unclassified 2496
97 Ga0070699_101356222 3300005518 Unclassified 652
98 Ga0070679_100029067 3300005530 Bacteria 5452
99 Ga0070679_100074184 3300005530 Bacteria 3393
100 Ga0070679_101225190 3300005530 Bacteria 696
101 Ga0070684_100000989 3300005535 Bacteria 20302
102 Ga0070684_100021642 3300005535 Bacteria 5356
103 Ga0070697_100000428 3300005536 Bacteria 32306
104 Ga0070697_100001125 3300005536 Bacteria 20218
105 Ga0070697_100010283 3300005536 Bacteria 7291
106 Ga0070697_100038407 3300005536 Bacteria 3868
107 Ga0070697_100059207 3300005536 Bacteria 3118
108 Ga0070697_100070423 3300005536 Bacteria 2867
109 Ga0070697_100201868 3300005536 Bacteria 1690
110 Ga0068853_100054148 3300005539 Bacteria 3457
111 Ga0068853_100159153 3300005539 Unclassified 2037
112 Ga0070672_100002236 3300005543 Bacteria 12198
113 Ga0070686_100024442 3300005544 Unclassified 3621
114 Ga0070695_100605824 3300005545 Unclassified 860
115 Ga0070693_100171124 3300005547 Unclassified 1391
116 Ga0070693_100474550 3300005547 Bacteria 882
117 Ga0070665_101234990 3300005548 Bacteria 758
118 Ga0070704_100785643 3300005549 Unclassified 850
119 Ga0068855_100095542 3300005563 Bacteria 3425
120 Ga0068855_100119170 3300005563 Bacteria 3022
121 Ga0068855_100669165 3300005563 Unclassified 1113
122 Ga0070664_100012385 3300005564 Bacteria 6931
123 Ga0070664_100047818 3300005564 Unclassified 3615
124 Ga0070664_100281982 3300005564 Bacteria 1498
125 Ga0068857_100051413 3300005577 Unclassified 3656
126 Ga0068857_100286148 3300005577 Unclassified 1517
127 Ga0068854_100030847 3300005578 Bacteria 3721
128 Ga0068854_100155367 3300005578 Bacteria 1767
129 Ga0068856_100694873 3300005614 Bacteria 1038
130 Ga0070702_100005058 3300005615 Bacteria 6094
131 Ga0068852_100030677 3300005616 Unclassified 4429
132 Ga0068852_100140171 3300005616 Bacteria 2237
133 Ga0068859_100009103 3300005617 Bacteria 10027
134 Ga0068859_100022079 3300005617 Bacteria 6381
135 Ga0068866_10001758 3300005718 Bacteria 9114
136 Ga0068866_10025943 3300005718 Unclassified 2761
137 Ga0068861_100163244 3300005719 Unclassified 1839
138 Ga0068861_100611204 3300005719 Bacteria 1002
139 Ga0068851_10010583 3300005834 Unclassified 4307
140 Ga0068851_10036600 3300005834 Bacteria 2458
141 Ga0068851_10043666 3300005834 Bacteria 2260
142 Ga0068870_10009228 3300005840 Unclassified 4476
143 Ga0068858_100028667 3300005842 Bacteria 5170
144 Ga0068860_100046651 3300005843 Unclassified 4131
145 Ga0068862_100008705 3300005844 Bacteria 8397
146 Ga0068862_100351901 3300005844 Unclassified 1367
147 Ga0070717_10014250 3300006028 Bacteria 6113
148 Ga0070717_10072981 3300006028 Bacteria 2867
149 Ga0070717_10223420 3300006028 Bacteria 1656
150 Ga0070717_10345620 3300006028 Bacteria 1329
151 Ga0070715_10000697 3300006163 Bacteria 9015
152 Ga0070715_10037551 3300006163 Bacteria 2005
153 Ga0070716_100002295 3300006173 Bacteria 8802
154 Ga0070716_100002698 3300006173 Bacteria 8219
155 Ga0070716_100036837 3300006173 Unclassified 2699
156 Ga0070716_100119809 3300006173 Bacteria 1645
157 Ga0070716_100227363 3300006173 Bacteria 1257
158 Ga0070716_100412211 3300006173 Unclassified 975
159 Ga0070712_100000250 3300006175 Bacteria 30272
160 Ga0070712_100000765 3300006175 Bacteria 18932
161 Ga0070712_100006483 3300006175 Bacteria 7259
162 Ga0070712_100094919 3300006175 Bacteria 2193
163 Ga0097621_100001597 3300006237 Bacteria 15500
164 Ga0068871_100305506 3300006358 Unclassified 1397
165 Ga0068865_100006787 3300006881 Bacteria 7007
166 Ga0068865_100138981 3300006881 Bacteria 1829
167 Ga0075436_100000256 3300006914 Bacteria 33232
168 Ga0075436_100388024 3300006914 Unclassified 1010
169 Ga0075436_100487495 3300006914 Unclassified 901
170 Ga0075436_100593886 3300006914 Unclassified 815
171 Ga0097620_100009103 3300006931 Bacteria 10027
172 Ga0097620_100022079 3300006931 Bacteria 6381
173 Ga0075435_100814183 3300007076 Unclassified 813
174 Ga0105251_10150865 3300009011 Bacteria 1050
175 Ga0105240_10048505 3300009093 Bacteria 5367
176 Ga0105240_10249437 3300009093 Bacteria 2054
177 Ga0111539_10311432 3300009094 Bacteria 1832
178 Ga0105245_10002571 3300009098 Bacteria 16334
179 Ga0105245_10364688 3300009098 Bacteria 1435
180 Ga0105247_10004127 3300009101 Bacteria 9323
181 Ga0105247_10241134 3300009101 Unclassified 1232
182 Ga0105243_10061098 3300009148 Bacteria 3012
183 Ga0105243_10473600 3300009148 Bacteria 1180
184 Ga0105241_10001910 3300009174 Bacteria 15776
185 Ga0105241_10006430 3300009174 Bacteria 8658
186 Ga0105241_10090737 3300009174 Bacteria 2410
187 Ga0105242_10022137 3300009176 Bacteria 4994
188 Ga0105242_10040673 3300009176 Unclassified 3746
189 Ga0105242_10337908 3300009176 Unclassified 1387
190 Ga0105248_11048284 3300009177 Unclassified 921
191 Ga0105237_10038943 3300009545 Bacteria 4800
192 Ga0105237_10090665 3300009545 Unclassified 3046
193 Ga0105237_10125364 3300009545 Bacteria 2563
194 Ga0105237_10190421 3300009545 Bacteria 2051
195 Ga0105237_10694882 3300009545 Bacteria 1024
196 Ga0105238_10063023 3300009551 Bacteria 3708
197 Ga0105238_10244333 3300009551 Unclassified 1773
198 Ga0105238_10391952 3300009551 Bacteria 1381
199 Ga0105238_10724530 3300009551 Unclassified 1007
200 Ga0105249_10004057 3300009553 Bacteria 12626
201 Ga0105249_10019647 3300009553 Bacteria 6029
202 Ga0105249_10125720 3300009553 Bacteria 2441
203 Ga0105239_10006426 3300010375 Bacteria 13635
204 Ga0105239_10050908 3300010375 Bacteria 4541
205 Ga0105239_10078439 3300010375 Bacteria 3634
206 Ga0105239_10293352 3300010375 Bacteria 1831
207 Ga0105246_10001478 3300011119 Bacteria 13948
208 Ga0105246_10294152 3300011119 Bacteria 1308
209 Ga0157373_10007593 3300013100 Bacteria 8059
210 Ga0157373_10103758 3300013100 Bacteria 2000
211 Ga0157371_10005077 3300013102 Bacteria 11239
212 Ga0157369_10000942 3300013105 Bacteria 36964
213 Ga0157369_10065119 3300013105 Bacteria 3924
214 Ga0157369_10067365 3300013105 Unclassified 3849
215 Ga0157369_11266138 3300013105 Unclassified 752
216 Ga0157374_10018437 3300013296 Bacteria 6158
217 Ga0157374_10073321 3300013296 Unclassified 3232
218 Ga0157374_10151639 3300013296 Bacteria 2254
219 Ga0157374_10231153 3300013296 Bacteria 1816
220 Ga0157378_10004891 3300013297 Bacteria 11746
221 Ga0157378_10043667 3300013297 Bacteria 3980
222 Ga0157378_10075814 3300013297 Unclassified 3029
223 Ga0157378_10134595 3300013297 Unclassified 2290
224 Ga0157378_10346471 3300013297 Unclassified 1450
225 Ga0163162_10003582 3300013306 Bacteria 14860
226 Ga0163162_10005402 3300013306 Bacteria 12344
227 Ga0163162_10103851 3300013306 Bacteria 2936
228 Ga0163162_10115826 3300013306 Bacteria 2780
229 Ga0157372_10002361 3300013307 Bacteria 20416
230 Ga0157372_10027810 3300013307 Bacteria 6163
231 Ga0157375_10405514 3300013308 Bacteria 1530
232 Ga0163163_10001394 3300014325 Bacteria 20410
233 Ga0163163_10341253 3300014325 Unclassified 1553
234 Ga0163163_10454968 3300014325 Bacteria 1340
235 Ga0157380_10302697 3300014326 Bacteria 1473
236 Ga0182008_10003080 3300014497 Bacteria 10240
237 Ga0157377_10000957 3300014745 Bacteria 12092
238 Ga0157379_10025720 3300014968 Bacteria 5232
239 Ga0157379_10065464 3300014968 Unclassified 3249
240 Ga0157379_10218707 3300014968 Bacteria 1726
241 Ga0157376_10065978 3300014969 Unclassified 3059
242 Ga0157376_10074552 3300014969 Unclassified 2893
243 Ga0182007_10004011 3300015262 Bacteria 6794
244 Ga0224571_100594 3300022734 Bacteria 2062
245 Ga0224572_1018621 3300024225 Bacteria 1334
246 Ga0228598_1000294 3300024227 Bacteria 9696
247 Ga0228598_1006764 3300024227 Bacteria 2362
248 Ga0207697_10004341 3300025315 Bacteria 6786
249 Ga0207656_10014971 3300025321 Bacteria 2998
250 Ga0207656_10017983 3300025321 Unclassified 2776
251 Ga0207682_10073832 3300025893 Bacteria 1449
252 Ga0207692_10010038 3300025898 Bacteria 3974
253 Ga0207692_10199177 3300025898 Bacteria 1176
254 Ga0207642_10006498 3300025899 Unclassified 3892
255 Ga0207710_10061679 3300025900 Unclassified 1702
256 Ga0207680_10073251 3300025903 Unclassified 2129
257 Ga0207647_10013460 3300025904 Bacteria 5668
258 Ga0207685_10004353 3300025905 Bacteria 3589
259 Ga0207685_10082886 3300025905 Bacteria 1332
260 Ga0207685_10089718 3300025905 Unclassified 1291
261 Ga0207699_10001854 3300025906 Bacteria 9953
262 Ga0207699_10034442 3300025906 Unclassified 2873
263 Ga0207699_10140359 3300025906 Bacteria 1587
264 Ga0207645_10000697 3300025907 Bacteria 27932
265 Ga0207645_10037412 3300025907 Bacteria 3114
266 Ga0207643_10000098 3300025908 Bacteria 59302
267 Ga0207684_10004797 3300025910 Bacteria 12667
268 Ga0207684_10008058 3300025910 Bacteria 9403
269 Ga0207654_10001384 3300025911 Bacteria 12856
270 Ga0207654_10105393 3300025911 Bacteria 1745
271 Ga0207707_10059509 3300025912 Bacteria 3324
272 Ga0207707_10082796 3300025912 Bacteria 2801
273 Ga0207695_10026634 3300025913 Bacteria 6451
274 Ga0207671_10148155 3300025914 Unclassified 1812
275 Ga0207671_10520257 3300025914 Bacteria 949
276 Ga0207693_10000015 3300025915 Bacteria 147464
277 Ga0207693_10000250 3300025915 Bacteria 49773
278 Ga0207693_10000517 3300025915 Bacteria 34803
279 Ga0207663_10001791 3300025916 Bacteria 10131
280 Ga0207663_10016734 3300025916 Bacteria 4073
281 Ga0207663_10049305 3300025916 Unclassified 2611
282 Ga0207663_10082239 3300025916 Bacteria 2112
283 Ga0207663_10438109 3300025916 Bacteria 1006
284 Ga0207660_10321681 3300025917 Bacteria 1235
285 Ga0207660_10594334 3300025917 Bacteria 901
286 Ga0207662_10002301 3300025918 Bacteria 9563
287 Ga0207657_10002563 3300025919 Bacteria 19662
288 Ga0207657_10005452 3300025919 Bacteria 13281
289 Ga0207657_10005749 3300025919 Bacteria 12941
290 Ga0207649_10002454 3300025920 Bacteria 10379
291 Ga0207649_10149894 3300025920 Bacteria 1605
292 Ga0207652_10130350 3300025921 Bacteria 2242
293 Ga0207652_10311034 3300025921 Bacteria 1422
294 Ga0207646_10000901 3300025922 Bacteria 38302
295 Ga0207646_10110699 3300025922 Unclassified 2464
296 Ga0207646_10218812 3300025922 Bacteria 1720
297 Ga0207646_10589592 3300025922 Unclassified 998
298 Ga0207681_10022341 3300025923 Unclassified 4034
299 Ga0207694_10256560 3300025924 Bacteria 1432
300 Ga0207694_10261425 3300025924 Bacteria 1418
301 Ga0207650_10000098 3300025925 Bacteria 115403
302 Ga0207659_10004270 3300025926 Bacteria 8641
303 Ga0207687_10047637 3300025927 Unclassified 2972
304 Ga0207687_10061231 3300025927 Bacteria 2657
305 Ga0207687_10082812 3300025927 Bacteria 2322
306 Ga0207700_10000373 3300025928 Bacteria 26215
307 Ga0207700_10022997 3300025928 Bacteria 4287
308 Ga0207700_10078895 3300025928 Bacteria 2563
309 Ga0207700_10326741 3300025928 Bacteria 1330
310 Ga0207664_10001999 3300025929 Bacteria 13429
311 Ga0207664_10011389 3300025929 Bacteria 6319
312 Ga0207664_10128915 3300025929 Bacteria 2127
313 Ga0207664_10134175 3300025929 Unclassified 2087
314 Ga0207664_10393216 3300025929 Unclassified 1232
315 Ga0207644_10002822 3300025931 Bacteria 11200
316 Ga0207644_10296003 3300025931 Unclassified 1303
317 Ga0207690_10483063 3300025932 Unclassified 1000
318 Ga0207706_10000676 3300025933 Bacteria 35793
319 Ga0207706_10005188 3300025933 Bacteria 12161
320 Ga0207686_10038709 3300025934 Unclassified 2888
321 Ga0207686_10286390 3300025934 Bacteria 1218
322 Ga0207670_10027927 3300025936 Unclassified 3575
323 Ga0207670_10591410 3300025936 Unclassified 910
324 Ga0207704_10083088 3300025938 Unclassified 2077
325 Ga0207704_10167680 3300025938 Bacteria 1571
326 Ga0207665_10004472 3300025939 Bacteria 9285
327 Ga0207665_10010422 3300025939 Bacteria 6106
328 Ga0207665_10021679 3300025939 Bacteria 4226
329 Ga0207665_10037227 3300025939 Bacteria 3238
330 Ga0207665_10071133 3300025939 Unclassified 2374
331 Ga0207665_10766410 3300025939 Unclassified 761
332 Ga0207691_10000769 3300025940 Bacteria 31722
333 Ga0207711_10121372 3300025941 Unclassified 2333
334 Ga0207689_10001502 3300025942 Bacteria 22288
335 Ga0207689_10096464 3300025942 Bacteria 2428
336 Ga0207661_10001104 3300025944 Bacteria 17949
337 Ga0207661_10158322 3300025944 Bacteria 1963
338 Ga0207661_10219202 3300025944 Bacteria 1681
339 Ga0207679_10000156 3300025945 Bacteria 56370
340 Ga0207667_10053754 3300025949 Unclassified 4237
341 Ga0207667_10390135 3300025949 Bacteria 1418
342 Ga0207651_10155558 3300025960 Unclassified 1785
343 Ga0207712_10041360 3300025961 Unclassified 3167
344 Ga0207668_10057253 3300025972 Unclassified 2718
345 Ga0207640_10008093 3300025981 Bacteria 5818
346 Ga0207640_10251392 3300025981 Bacteria 1372
347 Ga0207658_10135223 3300025986 Unclassified 1986
348 Ga0207658_10811073 3300025986 Unclassified 850
349 Ga0207677_10020225 3300026023 Unclassified 4037
350 Ga0207677_10042065 3300026023 Unclassified 3026
351 Ga0207677_10252597 3300026023 Unclassified 1433
352 Ga0207703_10012088 3300026035 Bacteria 6726
353 Ga0207703_10077909 3300026035 Unclassified 2752
354 Ga0207639_10276114 3300026041 Unclassified 1476
355 Ga0207639_10402659 3300026041 Bacteria 1233
356 Ga0207678_10000290 3300026067 Bacteria 45619
357 Ga0207678_10000666 3300026067 Bacteria 31531
358 Ga0207708_10136175 3300026075 Bacteria 1923
359 Ga0207702_10453315 3300026078 Bacteria 1245
360 Ga0207641_10000021 3300026088 Bacteria 279851
361 Ga0207641_10053314 3300026088 Bacteria 3428
362 Ga0207648_10000197 3300026089 Bacteria 63675
363 Ga0207648_10217138 3300026089 Bacteria 1699
364 Ga0207676_10000910 3300026095 Bacteria 22914
365 Ga0207676_10092109 3300026095 Bacteria 2492
366 Ga0207676_10306045 3300026095 Bacteria 1453
367 Ga0207674_10000483 3300026116 Bacteria 52543
368 Ga0207674_10013393 3300026116 Bacteria 9103
369 Ga0207674_10294759 3300026116 Unclassified 1571
370 Ga0207675_100195770 3300026118 Unclassified 1940
371 Ga0207683_10003906 3300026121 Bacteria 12919
372 Ga0207683_10067467 3300026121 Unclassified 3156
373 Ga0207683_10099140 3300026121 Bacteria 2600
374 Ga0207698_10133087 3300026142 Unclassified 2128
375 Ga0268266_10002154 3300028379 Bacteria 21604
376 Ga0268266_10054614 3300028379 Bacteria 3433
377 Ga0268266_10109709 3300028379 Bacteria 2444
378 Ga0268265_10035958 3300028380 Unclassified 3623
379 Ga0268264_10025294 3300028381 Unclassified 4850
380 Ga0268264_10156904 3300028381 Bacteria 2046
381 Ga0265338_10023532 3300028800 Bacteria 6329
382 Ga0265338_10085438 3300028800 Bacteria 2630
383 Ga0265762_1048186 3300030760 Unclassified 849
384 Ga0265770_1017594 3300030878 Unclassified 1106
385 Ga0265760_10008216 3300031090 Bacteria 2982
386 Ga0265760_10022804 3300031090 Bacteria 1816
387 Ga0265339_10009338 3300031249 Bacteria 6169
388 Ga0265316_10195966 3300031344 Bacteria 1499
389 Ga0247548_102258 3300031814 Bacteria 827
390 Ga0373958_0045531 3300034819 Bacteria 912
391 Ga0373929_0135433 3300035085 Bacteria 649
392 Ga0373934_0016886 3300035086 Bacteria 2779
393 Ga0373945_0007191 3300035116 Bacteria 3603
394 Ga0373960_0067117 3300035121 Unclassified 1101
395 Ga0373924_0029386 3300035410 Unclassified 2197
396 Ga0373931_0183572 3300035691 Bacteria 1240
397 Ga0373935_0012814 3300035692 Bacteria 5050
398 Ga0373937_0210372 3300036401 Bacteria 1830
399 Ga0373937_0378816 3300036401 Unclassified 1342
400 Ga0373925_0048514 3300037068 Unclassified 3164
401 Ga0373925_0071311 3300037068 Bacteria 2627
402 Ga0436363_1397929 3300039450 Unclassified 4305
403 Ga0451577_0000277 3300042876 Bacteria 99434
404 Ga0451577_0168902 3300042876 Bacteria 1971
405 Ga0451577_0865546 3300042876 Bacteria 815
406 Ga0453683_0179454 3300044673 Unclassified 1343
407 Ga0453683_0193395 3300044673 Unclassified 1291
408 Ga0466963_0069295 3300044694 Bacteria 2370
409 Ga0453684_0000480 3300044712 Bacteria 158630
410 Ga0466959_0350408 3300045049 Unclassified 1007
411 Ga0451576_0003612 3300045051 Bacteria 21016
412 Ga0451576_0211308 3300045051 Bacteria 2026
413 Ga0466967_0037106 3300045976 Unclassified 4167
414 Ga0466967_0692406 3300045976 Bacteria 1009
415 Ga0495629_0701564 3300046459 Unclassified 672
416 Ga0495580_0003792 3300046472 Bacteria 12807
417 Ga0495580_0008887 3300046472 Bacteria 7947
418 Ga0495580_0015482 3300046472 Bacteria 5750
419 Ga0495580_0149136 3300046472 Bacteria 1620
420 Ga0495679_110049 3300047446 Unclassified 759
421 Ga0495684_0361118 3300047471 Bacteria 1029
422 Ga0496100_0171099 3300048903 Unclassified 1564
423 Ga0496100_0374252 3300048903 Unclassified 1081
424 Ga0496101_0001799 3300048904 Bacteria 12904
425 Ga0496101_0173093 3300048904 Unclassified 1660
426 Ga0496102_0006916 3300048905 Bacteria 9677
427 Ga0496102_0072827 3300048905 Unclassified 3158
428 Ga0496102_0090289 3300048905 Unclassified 2835
429 Ga0496102_0115311 3300048905 Bacteria 2507
430 Ga0496102_0245672 3300048905 Bacteria 1687
431 Ga0496104_0053478 3300048907 Bacteria 3815
432 Ga0496107_0111692 3300048910 Bacteria 2009
433 Ga0496108_0000151 3300048911 Bacteria 66479
434 Ga0496108_0101529 3300048911 Bacteria 2454
435 Ga0496109_0000271 3300048912 Bacteria 49802
436 Ga0496109_0189344 3300048912 Bacteria 1933
437 Ga0496110_0049479 3300048913 Unclassified 3687
438 Ga0496110_0480124 3300048913 Bacteria 1132
439 Ga0496111_0043027 3300048914 Bacteria 3245
440 Ga0496111_0154174 3300048914 Bacteria 1704
441 Ga0496112_0000345 3300048915 Bacteria 30238
442 Ga0496112_0459596 3300048915 Unclassified 1210
443 Ga0496113_0000134 3300048916 Bacteria 31716
444 Ga0496113_0123851 3300048916 Bacteria 2023
445 Ga0496113_0125433 3300048916 Bacteria 2010
446 Ga0496113_0480744 3300048916 Bacteria 998
447 Ga0496114_0002979 3300048917 Bacteria 12983
448 Ga0496115_0001260 3300048918 Bacteria 18171
449 Ga0496115_0069703 3300048918 Bacteria 2849
450 Ga0496115_0666681 3300048918 Unclassified 821
451 Ga0501083_0114158 3300049744 Bacteria 1774
452 Ga0501083_0221871 3300049744 Unclassified 1231
453 nmdc:mga08y16_344583_c1 3300050511 Bacteria 1531
454 nmdc:mga0rr50_733464_c1 3300050513 Unclassified 843
455 nmdc:mga08x19_30037_c1 3300050514 Bacteria 3412
456 nmdc:mga08x19_55038_c1 3300050514 Unclassified 2563
457 Ga0495601_0070521 3300053077 Bacteria 2231
458 Ga0495619_0032221 3300053085 Bacteria 3400
459 Ga0587071_030100 3300060344 Bacteria 1041
460 Ga0070663_100176598
461 JGI24752J21851_1002260
462 JGI24747J21853_1001261
463 JGI24737J22298_10028580
464 JGI24743J22301_10007594
465 JGI24748J21848_1004440
466 JGI24751J29686_10000500
467 Ga0065707_10449513
468 Ga0070676_10111106
469 Ga0070683_100031745
470 Ga0070683_100054326
471 Ga0070690_100016762
472 Ga0070670_100057791
473 Ga0070677_10061299
474 Ga0068869_100033738
475 Ga0070666_10010605
476 Ga0070666_10043025
477 Ga0070680_100161537
478 Ga0070680_100594255
479 Ga0070682_100033637
480 Ga0070682_100109511
481 Ga0068868_100004656
482 Ga0068868_100045396
483 Ga0070660_100003640
484 Ga0070660_100018529
485 Ga0070660_100244056
486 Ga0070689_100058620
487 Ga0070687_100000681
488 Ga0070661_100015951
489 Ga0070661_100052278
490 Ga0070661_100292668
491 Ga0070692_10091915
492 Ga0070668_100118721
493 Ga0070668_100154119
494 Ga0070675_100027589
495 Ga0070675_100512876
496 Ga0070673_100100138
497 Ga0070688_100001181
498 Ga0070659_100009712
499 Ga0070659_100021277
500 Ga0070659_100089680
501 Ga0070667_100027858
502 Ga0070709_10000885
503 Ga0070709_10011105
504 Ga0070709_10100850
505 Ga0070709_10296424
506 Ga0070714_100112883
507 Ga0070714_100146488
508 Ga0070714_100228947
509 Ga0070713_100000496
510 Ga0070713_100000703
511 Ga0070713_100013067
512 Ga0070713_100098079
513 Ga0070713_100274504
514 Ga0070713_100410760
515 Ga0070710_10021435
516 Ga0070710_10061544
517 Ga0070710_10064731
518 Ga0070711_100000530
519 Ga0070711_100005399
520 Ga0070711_100075209
521 Ga0070711_100091012
522 Ga0070711_100320772
523 Ga0070711_100500039
524 Ga0070711_100990350
525 Ga0070705_100110195
526 Ga0070700_100482909
527 Ga0070708_100003735
528 Ga0070708_100005746
529 Ga0070708_100009434
530 Ga0070708_100054400
531 Ga0070708_100094013
532 Ga0070708_100436412
533 Ga0070708_100454439
534 Ga0070663_100009421
535 Ga0070663_100021300
536 Ga0070678_100021241
537 Ga0070678_100054561
538 Ga0070678_100925595
539 Ga0070662_100005537
540 Ga0070681_10034561
541 Ga0070681_10132123
542 Ga0068867_100007753
543 Ga0068867_100189441
544 Ga0070685_10089836
545 Ga0070706_100001890
546 Ga0070707_100004782
547 Ga0070707_100120124
548 Ga0070707_100789177
549 Ga0070698_100000148
550 Ga0070698_100081507
551 Ga0070698_100467424
552 Ga0070699_100008856
553 Ga0070699_100024485
554 Ga0070699_100096615
555 Ga0070699_100103558
556 Ga0070699_101356222
557 Ga0070679_100029067
558 Ga0070679_100074184
559 Ga0070679_101225190
560 Ga0070684_100000989
561 Ga0070684_100021642
562 Ga0070697_100000428
563 Ga0070697_100001125
564 Ga0070697_100010283
565 Ga0070697_100038407
566 Ga0070697_100059207
567 Ga0070697_100070423
568 Ga0070697_100201868
569 Ga0068853_100054148
570 Ga0068853_100159153
571 Ga0070672_100002236
572 Ga0070686_100024442
573 Ga0070695_100605824
574 Ga0070693_100171124
575 Ga0070693_100474550
576 Ga0070665_101234990
577 Ga0070704_100785643
578 Ga0068855_100095542
579 Ga0068855_100119170
580 Ga0068855_100669165
581 Ga0070664_100012385
582 Ga0070664_100047818
583 Ga0070664_100281982
584 Ga0068857_100051413
585 Ga0068857_100286148
586 Ga0068854_100030847
587 Ga0068854_100155367
588 Ga0068856_100694873
589 Ga0070702_100005058
590 Ga0068852_100030677
591 Ga0068852_100140171
592 Ga0068859_100009103
593 Ga0068859_100022079
594 Ga0068866_10001758
595 Ga0068866_10025943
596 Ga0068861_100163244
597 Ga0068861_100611204
598 Ga0068851_10010583
599 Ga0068851_10036600
600 Ga0068851_10043666
601 Ga0068870_10009228
602 Ga0068858_100028667
603 Ga0068860_100046651
604 Ga0068862_100008705
605 Ga0068862_100351901
606 Ga0070717_10014250
607 Ga0070717_10072981
608 Ga0070717_10223420
609 Ga0070717_10345620
610 Ga0070715_10000697
611 Ga0070715_10037551
612 Ga0070716_100002295
613 Ga0070716_100002698
614 Ga0070716_100036837
615 Ga0070716_100119809
616 Ga0070716_100227363
617 Ga0070716_100412211
618 Ga0070712_100000250
619 Ga0070712_100000765
620 Ga0070712_100006483
621 Ga0070712_100094919
622 Ga0097621_100001597
623 Ga0068871_100305506
624 Ga0068865_100006787
625 Ga0068865_100138981
626 Ga0075436_100000256
627 Ga0075436_100388024
628 Ga0075436_100487495
629 Ga0075436_100593886
630 Ga0097620_100009103
631 Ga0097620_100022079
632 Ga0075435_100814183
633 Ga0105251_10150865
634 Ga0105240_10048505
635 Ga0105240_10249437
636 Ga0111539_10311432
637 Ga0105245_10002571
638 Ga0105245_10364688
639 Ga0105247_10004127
640 Ga0105247_10241134
641 Ga0105243_10061098
642 Ga0105243_10473600
643 Ga0105241_10001910
644 Ga0105241_10006430
645 Ga0105241_10090737
646 Ga0105242_10022137
647 Ga0105242_10040673
648 Ga0105242_10337908
649 Ga0105248_11048284
650 Ga0105237_10038943
651 Ga0105237_10090665
652 Ga0105237_10125364
653 Ga0105237_10190421
654 Ga0105237_10694882
655 Ga0105238_10063023
656 Ga0105238_10244333
657 Ga0105238_10391952
658 Ga0105238_10724530
659 Ga0105249_10004057
660 Ga0105249_10019647
661 Ga0105249_10125720
662 Ga0105239_10006426
663 Ga0105239_10050908
664 Ga0105239_10078439
665 Ga0105239_10293352
666 Ga0105246_10001478
667 Ga0105246_10294152
668 Ga0157373_10007593
669 Ga0157373_10103758
670 Ga0157371_10005077
671 Ga0157369_10000942
672 Ga0157369_10065119
673 Ga0157369_10067365
674 Ga0157369_11266138
675 Ga0157374_10018437
676 Ga0157374_10073321
677 Ga0157374_10151639
678 Ga0157374_10231153
679 Ga0157378_10004891
680 Ga0157378_10043667
681 Ga0157378_10075814
682 Ga0157378_10134595
683 Ga0157378_10346471
684 Ga0163162_10003582
685 Ga0163162_10005402
686 Ga0163162_10103851
687 Ga0163162_10115826
688 Ga0157372_10002361
689 Ga0157372_10027810
690 Ga0157375_10405514
691 Ga0163163_10001394
692 Ga0163163_10341253
693 Ga0163163_10454968
694 Ga0157380_10302697
695 Ga0182008_10003080
696 Ga0157377_10000957
697 Ga0157379_10025720
698 Ga0157379_10065464
699 Ga0157379_10218707
700 Ga0157376_10065978
701 Ga0157376_10074552
702 Ga0182007_10004011
703 Ga0224571_100594
704 Ga0224572_1018621
705 Ga0228598_1000294
706 Ga0228598_1006764
707 Ga0207697_10004341
708 Ga0207656_10014971
709 Ga0207656_10017983
710 Ga0207682_10073832
711 Ga0207692_10010038
712 Ga0207692_10199177
713 Ga0207642_10006498
714 Ga0207710_10061679
715 Ga0207680_10073251
716 Ga0207647_10013460
717 Ga0207685_10004353
718 Ga0207685_10082886
719 Ga0207685_10089718
720 Ga0207699_10001854
721 Ga0207699_10034442
722 Ga0207699_10140359
723 Ga0207645_10000697
724 Ga0207645_10037412
725 Ga0207643_10000098
726 Ga0207684_10004797
727 Ga0207684_10008058
728 Ga0207654_10001384
729 Ga0207654_10105393
730 Ga0207707_10059509
731 Ga0207707_10082796
732 Ga0207695_10026634
733 Ga0207671_10148155
734 Ga0207671_10520257
735 Ga0207693_10000015
736 Ga0207693_10000250
737 Ga0207693_10000517
738 Ga0207663_10001791
739 Ga0207663_10016734
740 Ga0207663_10049305
741 Ga0207663_10082239
742 Ga0207663_10438109
743 Ga0207660_10321681
744 Ga0207660_10594334
745 Ga0207662_10002301
746 Ga0207657_10002563
747 Ga0207657_10005452
748 Ga0207657_10005749
749 Ga0207649_10002454
750 Ga0207649_10149894
751 Ga0207652_10130350
752 Ga0207652_10311034
753 Ga0207646_10000901
754 Ga0207646_10110699
755 Ga0207646_10218812
756 Ga0207646_10589592
757 Ga0207681_10022341
758 Ga0207694_10256560
759 Ga0207694_10261425
760 Ga0207650_10000098
761 Ga0207659_10004270
762 Ga0207687_10047637
763 Ga0207687_10061231
764 Ga0207687_10082812
765 Ga0207700_10000373
766 Ga0207700_10022997
767 Ga0207700_10078895
768 Ga0207700_10326741
769 Ga0207664_10001999
770 Ga0207664_10011389
771 Ga0207664_10128915
772 Ga0207664_10134175
773 Ga0207664_10393216
774 Ga0207644_10002822
775 Ga0207644_10296003
776 Ga0207690_10483063
777 Ga0207706_10000676
778 Ga0207706_10005188
779 Ga0207686_10038709
780 Ga0207686_10286390
781 Ga0207670_10027927
782 Ga0207670_10591410
783 Ga0207704_10083088
784 Ga0207704_10167680
785 Ga0207665_10004472
786 Ga0207665_10010422
787 Ga0207665_10021679
788 Ga0207665_10037227
789 Ga0207665_10071133
790 Ga0207665_10766410
791 Ga0207691_10000769
792 Ga0207711_10121372
793 Ga0207689_10001502
794 Ga0207689_10096464
795 Ga0207661_10001104
796 Ga0207661_10158322
797 Ga0207661_10219202
798 Ga0207679_10000156
799 Ga0207667_10053754
800 Ga0207667_10390135
801 Ga0207651_10155558
802 Ga0207712_10041360
803 Ga0207668_10057253
804 Ga0207640_10008093
805 Ga0207640_10251392
806 Ga0207658_10135223
807 Ga0207658_10811073
808 Ga0207677_10020225
809 Ga0207677_10042065
810 Ga0207677_10252597
811 Ga0207703_10012088
812 Ga0207703_10077909
813 Ga0207639_10276114
814 Ga0207639_10402659
815 Ga0207678_10000290
816 Ga0207678_10000666
817 Ga0207708_10136175
818 Ga0207702_10453315
819 Ga0207641_10000021
820 Ga0207641_10053314
821 Ga0207648_10000197
822 Ga0207648_10217138
823 Ga0207676_10000910
824 Ga0207676_10092109
825 Ga0207676_10306045
826 Ga0207674_10000483
827 Ga0207674_10013393
828 Ga0207674_10294759
829 Ga0207675_100195770
830 Ga0207683_10003906
831 Ga0207683_10067467
832 Ga0207683_10099140
833 Ga0207698_10133087
834 Ga0268266_10002154
835 Ga0268266_10054614
836 Ga0268266_10109709
837 Ga0268265_10035958
838 Ga0268264_10025294
839 Ga0268264_10156904
840 Ga0265338_10023532
841 Ga0265338_10085438
842 Ga0265762_1048186
843 Ga0265770_1017594
844 Ga0265760_10008216
845 Ga0265760_10022804
846 Ga0265339_10009338
847 Ga0265316_10195966
848 Ga0247548_102258
849 Ga0373958_0045531
850 Ga0373929_0135433
851 Ga0373934_0016886
852 Ga0373945_0007191
853 Ga0373960_0067117
854 Ga0373924_0029386
855 Ga0373931_0183572
856 Ga0373935_0012814
857 Ga0373937_0210372
858 Ga0373937_0378816
859 Ga0373925_0048514
860 Ga0373925_0071311
861 Ga0436363_1397929
862 Ga0451577_0000277
863 Ga0451577_0168902
864 Ga0451577_0865546
865 Ga0453683_0179454
866 Ga0453683_0193395
867 Ga0466963_0069295
868 Ga0453684_0000480
869 Ga0466959_0350408
870 Ga0451576_0003612
871 Ga0451576_0211308
872 Ga0466967_0037106
873 Ga0466967_0692406
874 Ga0495629_0701564
875 Ga0495580_0003792
876 Ga0495580_0008887
877 Ga0495580_0015482
878 Ga0495580_0149136
879 Ga0495679_110049
880 Ga0495684_0361118
881 Ga0496100_0171099
882 Ga0496100_0374252
883 Ga0496101_0001799
884 Ga0496101_0173093
885 Ga0496102_0006916
886 Ga0496102_0072827
887 Ga0496102_0090289
888 Ga0496102_0115311
889 Ga0496102_0245672
890 Ga0496104_0053478
891 Ga0496107_0111692
892 Ga0496108_0000151
893 Ga0496108_0101529
894 Ga0496109_0000271
895 Ga0496109_0189344
896 Ga0496110_0049479
897 Ga0496110_0480124
898 Ga0496111_0043027
899 Ga0496111_0154174
900 Ga0496112_0000345
901 Ga0496112_0459596
902 Ga0496113_0000134
903 Ga0496113_0123851
904 Ga0496113_0125433
905 Ga0496113_0480744
906 Ga0496114_0002979
907 Ga0496115_0001260
908 Ga0496115_0069703
909 Ga0496115_0666681
910 Ga0501083_0114158
911 Ga0501083_0221871
912 nmdc:mga08y16_344583_c1
913 nmdc:mga0rr50_733464_c1
914 nmdc:mga08x19_30037_c1
915 nmdc:mga08x19_55038_c1
916 Ga0495601_0070521
917 Ga0495619_0032221
918 Ga0587071_030100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02632

BioY

BioY family

70

212

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dve-assembly1.cif.gz_A crystal structure at 2.1 a of the s-component for biotin from an ecf-type abc transporter 0.859 16 186
7nnt-assembly1.cif.gz_C cryo-em structure of the folate-specific ecf transporter complex in ddm micelles 0.7016 20 188
5d0y-assembly2.cif.gz_B substrate bound s-component of folate ecf transporter 0.6923 20 189
5d0y-assembly2.cif.gz_B substrate bound s-component of folate ecf transporter 0.685 20 189
7nnt-assembly1.cif.gz_C cryo-em structure of the folate-specific ecf transporter complex in ddm micelles 0.6472 20 188
ID Description Score Start End Superfamily
af_Q54D94_113_302_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9123 18 188 1.10.1760.20
af_Q2FVX1_1_181_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9054 20 183 1.10.1760.20
af_Q54D94_113_302_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.825 18 188 1.10.1760.20
af_Q2FVX1_1_181_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8206 20 183 1.10.1760.20
4dveA00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8166 16 186 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A2V9ND61-F1-model_v4 Biotin transporter BioY 0.9762 12 109 GO:0005886
GO:0015225
AF-A0A2V7M3F3-F1-model_v4 Biotin transporter BioY 0.971 12 109 GO:0005886
GO:0015225
AF-A0A1Q6W056-F1-model_v4 Biotin transporter BioY 0.9591 13 160 GO:0005886
GO:0015225
AF-A0A2V9UJN0-F1-model_v4 Biotin transporter 0.956 6 188 GO:0005886
GO:0015225
AF-A0A4R6ZTJ4-F1-model_v4 Biotin transporter 0.9542 15 188 GO:0005886
GO:0015225

Map