F448170

General Info

Members Datasets Scaffolds Average Seq Length
458 193 415 238

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10005578|Ga0105244_100055786
Length 252
Sequence MHCVARQNRGPTRSKVPDVRGEKGQQLNQQTLSMRLERVAAHVPAGARLADIGSDHGYLPVALMRRGAIVAAVAGEVALTPFRSAERTVRENDLDQWITVRLADGLTAIEPGISICGMGGETIRDILDSGKARLSGQERLILQPNGGEQPLRQWLMENGYCILCEEVLRENRFDYEIIVAERTGPVMYTAEELYFGPLQMQARSSAFLIKWQRLLREKQRTLSSFAKARQAVPEEKVQDVARQARWIADLLS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231010 Pseudomonas sp. GM25 Isolate Nodule
5 2511231012 Pseudomonas sp. GM33 Isolate Nodule
6 2511231014 Pseudomonas sp. GM48 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2511231021 Pseudomonas sp. GM78 Isolate Nodule
10 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
11 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
12 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
13 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
14 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
15 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
16 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
17 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
18 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
19 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
20 2773857670 Pseudomonas sp. 478 Isolate Unclassified
21 2784132072 Pseudomonas sp. 460 Isolate Unclassified
22 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
23 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
24 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
25 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
26 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
27 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
28 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
29 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
30 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
31 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
32 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
33 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
34 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
35 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
36 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
37 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
38 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
39 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
40 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
41 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
69 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
82 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
83 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
84 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
85 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
86 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
87 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
88 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
89 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
90 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
91 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
92 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
93 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
94 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
95 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
96 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
97 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
98 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
99 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
104 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
187 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
191 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
192 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
193 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.61
Metatranscriptomes 0
Isolates 9.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 2.84
Rhizoplane 1.75
Rhizosphere 84.5
Stem 0
Stem Tuber 0
Unclassified 9.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_721 2124908027 Bacteria 19610
2 MRS1b_contig_2161490 2162886011 Bacteria 1054
3 Ga0065714_10000150 3300005288 Bacteria 8851
4 Ga0065714_10003714 3300005288 Bacteria 11382
5 Ga0065714_10114457 3300005288 Bacteria 1428
6 Ga0065712_10001759 3300005290 Bacteria 5601
7 Ga0065712_10068163 3300005290 Bacteria 13627
8 Ga0075432_10001985 3300006058 Bacteria 6800
9 Ga0075432_10058625 3300006058 Bacteria 1367
10 Ga0075362_10087371 3300006177 Bacteria 1444
11 Ga0075436_100059121 3300006914 Bacteria 2648
12 Ga0079104_1000085 3300006946 Bacteria 136289
13 Ga0079104_1000245 3300006946 Bacteria 72407
14 Ga0099826_10046937 3300006948 Bacteria 2938
15 Ga0105251_10001281 3300009011 Bacteria 21723
16 Ga0105251_10003271 3300009011 Bacteria 11881
17 Ga0105251_10005580 3300009011 Bacteria 8185
18 Ga0105251_10007455 3300009011 Bacteria 6739
19 Ga0105251_10033752 3300009011 Bacteria 2537
20 Ga0105251_10052809 3300009011 Bacteria 1934
21 Ga0105251_10084135 3300009011 Bacteria 1468
22 Ga0105244_10000211 3300009036 Bacteria 60009
23 Ga0105244_10002114 3300009036 Bacteria 15267
24 Ga0105244_10005578 3300009036 Bacteria 8326
25 Ga0105243_10000060 3300009148 Bacteria 128124
26 Ga0105246_10000723 3300011119 Bacteria 18714
27 Ga0105246_10003519 3300011119 Bacteria 9484
28 Ga0157373_10005907 3300013100 Bacteria 9160
29 Ga0157373_10243691 3300013100 Bacteria 1271
30 Ga0157370_10006414 3300013104 Bacteria 12976
31 Ga0157370_10052444 3300013104 Bacteria 3894
32 Ga0157369_10169598 3300013105 Bacteria 2300
33 Ga0182008_10026348 3300014497 Bacteria 2949
34 Ga0182008_10109843 3300014497 Bacteria 1366
35 Ga0182006_1001849 3300015261 Bacteria 12144
36 Ga0182006_1005129 3300015261 Bacteria 6294
37 Ga0182007_10001264 3300015262 Bacteria 13731
38 Ga0182005_1000844 3300015265 Bacteria 13714
39 Ga0163161_10003907 3300017792 Bacteria 10452
40 Ga0163161_10008081 3300017792 Bacteria 7275
41 Ga0163161_10214436 3300017792 Bacteria 1488
42 Ga0209676_1003838 3300025292 Bacteria 8823
43 Ga0209050_1000782 3300025298 Bacteria 45306
44 Ga0209051_1013616 3300025303 Bacteria 3856
45 Ga0207696_1001477 3300025711 Bacteria 12721
46 Ga0207655_1000076 3300025728 Bacteria 226359
47 Ga0207655_1001113 3300025728 Bacteria 26259
48 Ga0207713_1001910 3300025735 Bacteria 15777
49 Ga0207713_1004432 3300025735 Bacteria 9102
50 Ga0207713_1005809 3300025735 Bacteria 7636
51 Ga0207713_1009432 3300025735 Bacteria 5500
52 Ga0207713_1015604 3300025735 Bacteria 3890
53 Ga0207713_1015622 3300025735 Bacteria 3888
54 Ga0207713_1020221 3300025735 Bacteria 3232
55 Ga0207713_1030951 3300025735 Bacteria 2375
56 Ga0207709_10000004 3300025935 Bacteria 825156
57 Ga0209281_1000009 3300027111 Bacteria 771717
58 Ga0209281_1000046 3300027111 Bacteria 327042
59 Ga0209282_1093736 3300027666 Bacteria 1565
60 Ga0207428_10010472 3300027907 Bacteria 8278
61 Ga0207428_10016121 3300027907 Bacteria 6437
62 Ga0207428_10041518 3300027907 Bacteria 3724
63 Ga0207428_10120407 3300027907 Bacteria 2013
64 Ga0314311_1236442 3300030733 Bacteria 2935
65 Ga0307408_100000066 3300031548 Bacteria 121679
66 Ga0307408_100002922 3300031548 Bacteria 11844
67 Ga0307408_100045669 3300031548 Bacteria 3129
68 Ga0307405_10015857 3300031731 Bacteria 4092
69 Ga0307405_10157499 3300031731 Bacteria 1604
70 Ga0307413_10024628 3300031824 Bacteria 3284
71 Ga0307413_10174198 3300031824 Bacteria 1526
72 Ga0307413_10453629 3300031824 Bacteria 1018
73 Ga0307406_10039114 3300031901 Bacteria 2940
74 Ga0307407_10111426 3300031903 Bacteria 1718
75 Ga0307412_10009216 3300031911 Bacteria 5657
76 Ga0307416_100119421 3300032002 Bacteria 2345
77 Ga0307414_10042171 3300032004 Bacteria 3098
78 Ga0307414_10193301 3300032004 Bacteria 1648
79 Ga0307411_10007411 3300032005 Bacteria 5588
80 Ga0237819_00249 3300038705 Bacteria 19634
81 Ga0439438_000126 3300041405 Bacteria 34403
82 Ga0439447_000290 3300041407 Bacteria 17857
83 Ga0439447_001296 3300041407 Bacteria 9099
84 Ga0439447_002894 3300041407 Bacteria 6149
85 Ga0439447_020727 3300041407 Bacteria 1738
86 Ga0439447_023417 3300041407 Bacteria 1609
87 Ga0439447_030604 3300041407 Bacteria 1355
88 Ga0439466_0008585 3300041411 Bacteria 3849
89 Ga0439431_0000049 3300041997 Bacteria 17790
90 Ga0439445_0005906 3300042004 Bacteria 2803
91 Ga0439432_000163 3300042006 Bacteria 23007
92 Ga0439451_009932 3300042009 Bacteria 1920
93 Ga0439451_035611 3300042009 Bacteria 1000
94 Ga0439452_000046 3300042010 Bacteria 130842
95 Ga0439452_000777 3300042010 Bacteria 15131
96 Ga0439452_001287 3300042010 Bacteria 10632
97 Ga0439452_010919 3300042010 Bacteria 2625
98 Ga0439452_038010 3300042010 Bacteria 1144
99 Ga0439463_006255 3300042016 Bacteria 2951
100 Ga0450920_002733 3300042122 Bacteria 3026
101 Ga0450902_009592 3300042137 Bacteria 1525
102 Ga0450902_017556 3300042137 Bacteria 1170
103 Ga0450903_003905 3300042138 Bacteria 2562
104 Ga0450903_011052 3300042138 Bacteria 1456
105 Ga0450907_000390 3300042146 Bacteria 13314
106 Ga0450910_001978 3300042147 Bacteria 2658
107 Ga0450909_000934 3300042185 Bacteria 3995
108 Ga0439460_0006939 3300042461 Bacteria 2821
109 Ga0450901_004567 3300042533 Bacteria 1433
110 Ga0495617_003672 3300046452 Bacteria 5719
111 Ga0495617_004252 3300046452 Bacteria 5229
112 Ga0495627_000133 3300046453 Bacteria 89977
113 Ga0495627_011575 3300046453 Bacteria 3161
114 Ga0495592_0001154 3300046454 Bacteria 18329
115 Ga0495603_0008651 3300046455 Bacteria 6152
116 Ga0495603_0013219 3300046455 Bacteria 4989
117 Ga0495603_0042875 3300046455 Bacteria 2703
118 Ga0495603_0199271 3300046455 Bacteria 1157
119 Ga0495590_0000339 3300046457 Bacteria 24297
120 Ga0495590_0008292 3300046457 Bacteria 3969
121 Ga0495590_0008569 3300046457 Bacteria 3902
122 Ga0495591_000330 3300046458 Bacteria 42741
123 Ga0495591_000437 3300046458 Bacteria 33994
124 Ga0495591_002856 3300046458 Bacteria 9285
125 Ga0495591_009392 3300046458 Bacteria 3894
126 Ga0495591_011500 3300046458 Bacteria 3350
127 Ga0495629_0017687 3300046459 Bacteria 5109
128 Ga0495638_0000088 3300046460 Bacteria 152517
129 Ga0495638_0000352 3300046460 Bacteria 57480
130 Ga0495638_0001330 3300046460 Bacteria 22719
131 Ga0495638_0016047 3300046460 Bacteria 5020
132 Ga0495638_0018375 3300046460 Bacteria 4643
133 Ga0495638_0021397 3300046460 Bacteria 4264
134 Ga0495638_0024748 3300046460 Bacteria 3908
135 Ga0495638_0275852 3300046460 Bacteria 915
136 Ga0495653_0000502 3300046463 Bacteria 30211
137 Ga0495650_0000902 3300046471 Bacteria 34966
138 Ga0495650_0002334 3300046471 Bacteria 15692
139 Ga0495650_0008500 3300046471 Bacteria 5975
140 Ga0495582_0130171 3300046473 Bacteria 1421
141 Ga0495605_0000145 3300046474 Bacteria 91308
142 Ga0495605_0000250 3300046474 Bacteria 63615
143 Ga0495605_0002687 3300046474 Bacteria 10893
144 Ga0495605_0008433 3300046474 Bacteria 5825
145 Ga0495605_0010183 3300046474 Bacteria 5264
146 Ga0495605_0019496 3300046474 Bacteria 3622
147 Ga0495639_0000090 3300046475 Bacteria 44069
148 Ga0495639_0022070 3300046475 Bacteria 2790
149 Ga0495639_0213855 3300046475 Bacteria 946
150 Ga0495584_0001072 3300046491 Bacteria 16988
151 Ga0495584_0006215 3300046491 Bacteria 6266
152 Ga0495584_0009825 3300046491 Bacteria 4920
153 Ga0495584_0099332 3300046491 Bacteria 1470
154 Ga0495585_0002108 3300046492 Bacteria 14545
155 Ga0495585_0011813 3300046492 Bacteria 5158
156 Ga0495585_0013838 3300046492 Bacteria 4714
157 Ga0495585_0014456 3300046492 Bacteria 4598
158 Ga0495585_0018660 3300046492 Bacteria 4000
159 Ga0495585_0023538 3300046492 Bacteria 3534
160 Ga0495594_0000424 3300046499 Bacteria 21263
161 Ga0495594_0001807 3300046499 Bacteria 11115
162 Ga0495596_0000225 3300046500 Bacteria 38452
163 Ga0495607_0000609 3300046501 Bacteria 34781
164 Ga0495607_0006264 3300046501 Bacteria 8389
165 Ga0495607_0014982 3300046501 Bacteria 5039
166 Ga0495607_0160870 3300046501 Bacteria 1141
167 Ga0495583_0000538 3300046506 Bacteria 53381
168 Ga0495583_0001543 3300046506 Bacteria 22817
169 Ga0495583_0004566 3300046506 Bacteria 9841
170 Ga0495583_0010352 3300046506 Bacteria 5446
171 Ga0495583_0054070 3300046506 Bacteria 1819
172 Ga0495606_0064560 3300046507 Bacteria 2329
173 Ga0495606_0120961 3300046507 Bacteria 1567
174 Ga0495606_0160990 3300046507 Bacteria 1309
175 Ga0495606_0169725 3300046507 Bacteria 1266
176 Ga0495610_0007379 3300046512 Bacteria 7335
177 Ga0495610_0020144 3300046512 Bacteria 3710
178 Ga0495610_0040936 3300046512 Bacteria 2330
179 Ga0495616_0000041 3300046513 Bacteria 122413
180 Ga0495616_0000156 3300046513 Bacteria 59558
181 Ga0495616_0000245 3300046513 Bacteria 44179
182 Ga0495616_0020479 3300046513 Bacteria 3596
183 Ga0495616_0044126 3300046513 Bacteria 2262
184 Ga0495620_0000175 3300046515 Bacteria 50155
185 Ga0495620_0018660 3300046515 Bacteria 3431
186 Ga0495631_0020981 3300046518 Bacteria 3045
187 Ga0495632_0000295 3300046519 Bacteria 48203
188 Ga0495632_0004482 3300046519 Bacteria 9469
189 Ga0495632_0005172 3300046519 Bacteria 8704
190 Ga0495632_0005868 3300046519 Bacteria 8022
191 Ga0495632_0007158 3300046519 Bacteria 7055
192 Ga0495637_0001072 3300046520 Bacteria 17042
193 Ga0495637_0002032 3300046520 Bacteria 11403
194 Ga0495637_0007134 3300046520 Bacteria 5562
195 Ga0495637_0018053 3300046520 Bacteria 3276
196 Ga0495637_0019973 3300046520 Bacteria 3088
197 Ga0495643_0010326 3300046522 Bacteria 5749
198 Ga0495643_0043107 3300046522 Bacteria 2456
199 Ga0495644_0000005 3300046523 Bacteria 135313
200 Ga0495644_0000160 3300046523 Bacteria 31939
201 Ga0495644_0000504 3300046523 Bacteria 16685
202 Ga0495644_0011871 3300046523 Bacteria 3350
203 Ga0495648_0000237 3300046524 Bacteria 63132
204 Ga0495648_0000642 3300046524 Bacteria 37256
205 Ga0495648_0002220 3300046524 Bacteria 18185
206 Ga0495648_0005792 3300046524 Bacteria 10188
207 Ga0495648_0010226 3300046524 Bacteria 7166
208 Ga0495648_0092963 3300046524 Bacteria 1683
209 Ga0495648_0109143 3300046524 Bacteria 1509
210 Ga0495648_0198439 3300046524 Bacteria 1006
211 Ga0495666_0001628 3300046526 Bacteria 11051
212 Ga0495666_0013072 3300046526 Bacteria 4137
213 Ga0495642_0000006 3300046528 Bacteria 172412
214 Ga0495642_0000198 3300046528 Bacteria 35398
215 Ga0495654_0000050 3300046530 Bacteria 146814
216 Ga0495654_0000272 3300046530 Bacteria 47029
217 Ga0495654_0001044 3300046530 Bacteria 20280
218 Ga0495654_0011678 3300046530 Bacteria 4744
219 Ga0495654_0014402 3300046530 Bacteria 4208
220 Ga0495654_0018753 3300046530 Bacteria 3622
221 Ga0495654_0039396 3300046530 Bacteria 2359
222 Ga0495654_0044894 3300046530 Bacteria 2182
223 Ga0495587_0026572 3300046536 Bacteria 3529
224 Ga0495587_0116084 3300046536 Bacteria 1535
225 Ga0495609_0009479 3300046538 Bacteria 4709
226 Ga0495609_0009841 3300046538 Bacteria 4609
227 Ga0495609_0013125 3300046538 Bacteria 3917
228 Ga0495609_0022772 3300046538 Bacteria 2886
229 Ga0495609_0047119 3300046538 Bacteria 1929
230 Ga0495597_0018209 3300046542 Bacteria 3298
231 Ga0495597_0019213 3300046542 Bacteria 3200
232 Ga0495597_0144858 3300046542 Bacteria 978
233 Ga0495645_0085512 3300046543 Bacteria 2257
234 Ga0495645_0220384 3300046543 Bacteria 1276
235 Ga0495622_0001557 3300046557 Bacteria 11385
236 Ga0495622_0002032 3300046557 Bacteria 9889
237 Ga0495622_0026381 3300046557 Bacteria 2713
238 Ga0495656_0010213 3300046615 Bacteria 3406
239 Ga0495656_0060623 3300046615 Bacteria 1649
240 Ga0495668_0000253 3300046616 Bacteria 76112
241 Ga0495668_0049223 3300046616 Bacteria 2337
242 Ga0495668_0187580 3300046616 Bacteria 1132
243 Ga0495634_0002612 3300046642 Bacteria 14827
244 Ga0495634_0048277 3300046642 Bacteria 2866
245 Ga0495625_0000103 3300046660 Bacteria 136109
246 Ga0495625_0011576 3300046660 Bacteria 7181
247 Ga0495625_0012072 3300046660 Bacteria 7010
248 Ga0495625_0012312 3300046660 Bacteria 6936
249 Ga0495625_0013454 3300046660 Bacteria 6576
250 Ga0495625_0034807 3300046660 Bacteria 3715
251 Ga0495625_0060597 3300046660 Bacteria 2680
252 Ga0495625_0179663 3300046660 Bacteria 1408
253 Ga0495625_0247023 3300046660 Bacteria 1159
254 Ga0495659_0000295 3300046664 Bacteria 19818
255 Ga0495659_0007527 3300046664 Bacteria 3454
256 Ga0495661_0006911 3300046665 Bacteria 7935
257 Ga0495661_0017243 3300046665 Bacteria 4769
258 Ga0495661_0156533 3300046665 Bacteria 1226
259 Ga0495588_0010735 3300046674 Bacteria 4273
260 Ga0495588_0012182 3300046674 Bacteria 4055
261 Ga0495646_0000385 3300046680 Bacteria 23120
262 Ga0495646_0074962 3300046680 Bacteria 1984
263 Ga0495669_0016387 3300046684 Bacteria 3173
264 Ga0495669_0018920 3300046684 Bacteria 2967
265 Ga0495669_0089584 3300046684 Bacteria 1419
266 Ga0495613_0004033 3300046689 Bacteria 10983
267 Ga0495624_0000530 3300046690 Bacteria 29860
268 Ga0495670_0000491 3300046691 Bacteria 18744
269 Ga0495670_0008571 3300046691 Bacteria 5034
270 Ga0495670_0009442 3300046691 Bacteria 4795
271 Ga0495671_0000950 3300046692 Bacteria 20380
272 Ga0495671_0000961 3300046692 Bacteria 20223
273 Ga0495671_0001769 3300046692 Bacteria 13984
274 Ga0495671_0007198 3300046692 Bacteria 6363
275 Ga0495671_0009194 3300046692 Bacteria 5525
276 Ga0495671_0011441 3300046692 Bacteria 4881
277 Ga0495671_0023582 3300046692 Bacteria 3213
278 Ga0495671_0036168 3300046692 Bacteria 2502
279 Ga0495671_0036952 3300046692 Bacteria 2472
280 Ga0495671_0071970 3300046692 Bacteria 1697
281 Ga0495649_0000060 3300046694 Bacteria 97624
282 Ga0495649_0000566 3300046694 Bacteria 31267
283 Ga0495649_0001326 3300046694 Bacteria 18813
284 Ga0495649_0009074 3300046694 Bacteria 5935
285 Ga0495649_0009742 3300046694 Bacteria 5691
286 Ga0495649_0030338 3300046694 Bacteria 2986
287 Ga0495589_0000629 3300046794 Bacteria 23217
288 Ga0495589_0021050 3300046794 Bacteria 3333
289 Ga0495589_0022753 3300046794 Bacteria 3196
290 Ga0495589_0024127 3300046794 Bacteria 3091
291 Ga0495589_0062729 3300046794 Bacteria 1823
292 Ga0495589_0082279 3300046794 Bacteria 1565
293 Ga0495600_0011275 3300046809 Bacteria 5565
294 Ga0495600_0285638 3300046809 Bacteria 1043
295 Ga0495660_0000136 3300046810 Bacteria 79750
296 Ga0495660_0002857 3300046810 Bacteria 10859
297 Ga0495660_0004959 3300046810 Bacteria 8013
298 Ga0495660_0006220 3300046810 Bacteria 7083
299 Ga0495660_0007132 3300046810 Bacteria 6582
300 Ga0495660_0008786 3300046810 Bacteria 5899
301 Ga0495660_0046868 3300046810 Bacteria 2369
302 Ga0495660_0047481 3300046810 Bacteria 2351
303 Ga0495660_0057014 3300046810 Bacteria 2108
304 Ga0495581_0007539 3300047315 Bacteria 6292
305 Ga0495581_0030082 3300047315 Bacteria 3148
306 Ga0495604_0006449 3300047317 Bacteria 9305
307 Ga0495604_0045749 3300047317 Bacteria 3414
308 Ga0495636_0064020 3300047318 Bacteria 1559
309 Ga0495672_0000158 3300047320 Bacteria 98531
310 Ga0495672_0000190 3300047320 Bacteria 88698
311 Ga0495672_0004616 3300047320 Bacteria 11182
312 Ga0495672_0004811 3300047320 Bacteria 10888
313 Ga0495672_0005190 3300047320 Bacteria 10381
314 Ga0495672_0012797 3300047320 Bacteria 5829
315 Ga0495672_0013593 3300047320 Bacteria 5607
316 Ga0495672_0024229 3300047320 Bacteria 3913
317 Ga0495672_0085824 3300047320 Bacteria 1743
318 Ga0495672_0118431 3300047320 Bacteria 1411
319 Ga0495676_0000984 3300047321 Bacteria 23913
320 Ga0495680_0001081 3300047322 Bacteria 30215
321 Ga0495680_0004517 3300047322 Bacteria 13297
322 Ga0495683_0001223 3300047323 Bacteria 17497
323 Ga0495683_0002675 3300047323 Bacteria 10627
324 Ga0495683_0002985 3300047323 Bacteria 9985
325 Ga0495683_0008648 3300047323 Bacteria 5437
326 Ga0495683_0018557 3300047323 Bacteria 3594
327 Ga0495683_0061739 3300047323 Bacteria 1855
328 Ga0495683_0064296 3300047323 Bacteria 1811
329 Ga0495683_0086059 3300047323 Bacteria 1527
330 Ga0495687_000222 3300047443 Bacteria 80818
331 Ga0495675_0312173 3300047444 Bacteria 931
332 Ga0495677_0022784 3300047445 Bacteria 2272
333 Ga0495679_000440 3300047446 Bacteria 30708
334 Ga0495673_0000112 3300047469 Bacteria 164434
335 Ga0495673_0000288 3300047469 Bacteria 67701
336 Ga0495673_0000447 3300047469 Bacteria 45237
337 Ga0495673_0002300 3300047469 Bacteria 13669
338 Ga0495673_0009003 3300047469 Bacteria 5556
339 Ga0495673_0023821 3300047469 Bacteria 2969
340 Ga0495673_0026107 3300047469 Bacteria 2797
341 Ga0495673_0092093 3300047469 Bacteria 1237
342 Ga0495681_0000141 3300047470 Bacteria 60621
343 Ga0495681_0000668 3300047470 Bacteria 26039
344 Ga0495681_0005440 3300047470 Bacteria 8529
345 Ga0495681_0006859 3300047470 Bacteria 7394
346 Ga0495681_0009693 3300047470 Bacteria 5904
347 Ga0495681_0037736 3300047470 Bacteria 2376
348 Ga0495681_0040118 3300047470 Bacteria 2281
349 Ga0495684_0002261 3300047471 Bacteria 15431
350 Ga0495686_0030343 3300047472 Bacteria 3511
351 Ga0495686_0057010 3300047472 Bacteria 2439
352 Ga0495593_0000713 3300047673 Bacteria 19221
353 Ga0495593_0062992 3300047673 Bacteria 1937
354 Ga0495602_0002811 3300048088 Bacteria 17803
355 Ga0495626_0000032 3300048091 Bacteria 184235
356 Ga0495626_0000072 3300048091 Bacteria 134289
357 Ga0495626_0000074 3300048091 Bacteria 132552
358 Ga0495626_0001795 3300048091 Bacteria 16213
359 Ga0495626_0002407 3300048091 Bacteria 13038
360 Ga0495626_0022077 3300048091 Bacteria 3146
361 Ga0495626_0022846 3300048091 Bacteria 3086
362 Ga0496102_0001644 3300048905 Bacteria 19692
363 Ga0496103_0000781 3300048906 Bacteria 23421
364 Ga0496110_0008890 3300048913 Bacteria 8098
365 Ga0496111_0471922 3300048914 Bacteria 925
366 Ga0496112_0199284 3300048915 Bacteria 1962
367 Ga0496116_0000858 3300048919 Bacteria 38019
368 Ga0496116_0001153 3300048919 Bacteria 31191
369 Ga0496117_0004465 3300048920 Bacteria 15406
370 Ga0496117_0004826 3300048920 Bacteria 14575
371 Ga0496117_0046956 3300048920 Bacteria 3102
372 Ga0496117_0178807 3300048920 Bacteria 1222
373 Ga0496117_0262096 3300048920 Bacteria 936
374 Ga0496118_0008855 3300048921 Bacteria 10297
375 Ga0496118_0015141 3300048921 Bacteria 7162
376 Ga0496118_0179096 3300048921 Bacteria 1283
377 Ga0496118_0187560 3300048921 Bacteria 1241
378 Ga0496121_0002524 3300048924 Bacteria 27763
379 Ga0496121_0033101 3300048924 Bacteria 4684
380 Ga0496121_0372552 3300048924 Bacteria 944
381 Ga0496121_0379493 3300048924 Bacteria 932
382 Ga0496122_0011216 3300048925 Bacteria 9113
383 Ga0496122_0015428 3300048925 Bacteria 7305
384 Ga0496123_0004671 3300048926 Bacteria 14198
385 Ga0496123_0022424 3300048926 Bacteria 4867
386 Ga0496123_0067514 3300048926 Bacteria 2258
387 Ga0496124_0000547 3300048927 Bacteria 63558
388 Ga0496124_0019950 3300048927 Bacteria 6216
389 Ga0496124_0038414 3300048927 Bacteria 4158
390 Ga0496124_0121882 3300048927 Bacteria 2082
391 Ga0496124_0146828 3300048927 Bacteria 1855
392 Ga0496124_0239344 3300048927 Bacteria 1351
393 Ga0496125_0000465 3300048928 Bacteria 72631
394 Ga0496125_0016036 3300048928 Bacteria 7214
395 Ga0495678_001048 3300049459 Bacteria 23397
396 Ga0495678_002781 3300049459 Bacteria 11428
397 Ga0495678_003236 3300049459 Bacteria 10212
398 Ga0495678_004902 3300049459 Bacteria 7562
399 Ga0495678_011020 3300049459 Bacteria 4349
400 Ga0495678_012979 3300049459 Bacteria 3927
401 Ga0495678_017392 3300049459 Bacteria 3260
402 Ga0495678_019482 3300049459 Bacteria 3026
403 Ga0495678_026413 3300049459 Bacteria 2479
404 Ga0495682_0000483 3300049460 Bacteria 27500
405 Ga0495682_0003159 3300049460 Bacteria 7427
406 Ga0495682_0008879 3300049460 Bacteria 3946
407 Ga0495682_0042914 3300049460 Bacteria 1656
408 Ga0495682_0057046 3300049460 Bacteria 1414
409 Ga0495682_0067872 3300049460 Bacteria 1284
410 Ga0495682_0108364 3300049460 Bacteria 995
411 Ga0501222_000135 3300049662 Bacteria 15576
412 Ga0501269_005083 3300049766 Bacteria 1583
413 nmdc:mga03683_24622_c1 3300050489 Bacteria 2357
414 nmdc:mga00v17_114453_c1 3300050491 Bacteria 1713
415 nmdc:mga00v17_46307_c1 3300050491 Bacteria 2631

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0007539 Ga0495581_0007539_3690_4364 219
2 3300048924 Ga0496121_0379493 Ga0496121_0379493_10_684 219
3 3300049460 Ga0495682_0108364 Ga0495682_0108364_267_953 219
4 iso_pu_bacteria 2511231010 2511290373 220
5 iso_pu_bacteria 2511231017 2511332912 220
6 iso_pu_bacteria 2511231021 2511358148 220
7 iso_pu_bacteria 2600255318 2601799402 220
8 iso_pu_bacteria 2651869719 2652544753 220
9 iso_pu_bacteria 2713897149 2715760083 220
10 3300042533 Ga0450901_004567 Ga0450901_004567_478_1146 222
11 3300046460 Ga0495638_0000352 Ga0495638_0000352_50105_50776 223
12 3300047470 Ga0495681_0006859 Ga0495681_0006859_1567_2238 223
13 2162886011 MRS1b_contig_2161490 MRS1b_0040.00002350 224
14 3300005290 Ga0065712_10068163 Ga0065712_100681632 224
15 3300006177 Ga0075362_10087371 Ga0075362_100873711 224
16 3300006914 Ga0075436_100059121 Ga0075436_1000591212 224
17 3300006946 Ga0079104_1000085 Ga0079104_100008543 224
18 3300006946 Ga0079104_1000245 Ga0079104_100024550 224
19 3300006948 Ga0099826_10046937 Ga0099826_100469373 224
20 3300009011 Ga0105251_10001281 Ga0105251_1000128122 224
21 3300009011 Ga0105251_10003271 Ga0105251_1000327111 224
22 3300009011 Ga0105251_10005580 Ga0105251_100055802 224
23 3300009011 Ga0105251_10007455 Ga0105251_100074557 224
24 3300009011 Ga0105251_10033752 Ga0105251_100337523 224
25 3300009011 Ga0105251_10084135 Ga0105251_100841353 224
26 3300009036 Ga0105244_10000211 Ga0105244_1000021115 224
27 3300009036 Ga0105244_10002114 Ga0105244_1000211412 224
28 3300009148 Ga0105243_10000060 Ga0105243_1000006080 224
29 3300011119 Ga0105246_10000723 Ga0105246_100007239 224
30 3300011119 Ga0105246_10003519 Ga0105246_100035192 224
31 3300013100 Ga0157373_10005907 Ga0157373_100059072 224
32 3300013100 Ga0157373_10243691 Ga0157373_102436911 224
33 3300013105 Ga0157369_10169598 Ga0157369_101695984 224
34 3300017792 Ga0163161_10008081 Ga0163161_100080813 224
35 3300025711 Ga0207696_1001477 Ga0207696_100147710 224
36 3300025728 Ga0207655_1000076 Ga0207655_1000076125 224
37 3300025728 Ga0207655_1001113 Ga0207655_100111313 224
38 3300025735 Ga0207713_1001910 Ga0207713_10019107 224
39 3300025735 Ga0207713_1004432 Ga0207713_10044328 224
40 3300025735 Ga0207713_1015604 Ga0207713_10156044 224
41 3300025735 Ga0207713_1030951 Ga0207713_10309513 224
42 3300025935 Ga0207709_10000004 Ga0207709_1000000478 224
43 3300027111 Ga0209281_1000009 Ga0209281_1000009286 224
44 3300027111 Ga0209281_1000046 Ga0209281_100004646 224
45 3300027666 Ga0209282_1093736 Ga0209282_10937362 224
46 3300027907 Ga0207428_10041518 Ga0207428_100415183 224
47 3300031731 Ga0307405_10157499 Ga0307405_101574992 224
48 3300031824 Ga0307413_10453629 Ga0307413_104536291 224
49 3300032004 Ga0307414_10193301 Ga0307414_101933012 224
50 3300038705 Ga0237819_00249 Ga0237819_00249_9580_10254 224
51 3300041407 Ga0439447_030604 Ga0439447_030604_601_1275 224
52 3300042004 Ga0439445_0005906 Ga0439445_0005906_713_1387 224
53 3300042006 Ga0439432_000163 Ga0439432_000163_18257_18931 224
54 3300042009 Ga0439451_009932 Ga0439451_009932_1197_1871 224
55 3300042010 Ga0439452_010919 Ga0439452_010919_1578_2252 224
56 3300042010 Ga0439452_038010 Ga0439452_038010_323_997 224
57 3300042016 Ga0439463_006255 Ga0439463_006255_920_1594 224
58 3300042137 Ga0450902_009592 Ga0450902_009592_333_1007 224
59 3300042185 Ga0450909_000934 Ga0450909_000934_1343_2017 224
60 3300046452 Ga0495617_003672 Ga0495617_003672_171_845 224
61 3300046454 Ga0495592_0001154 Ga0495592_0001154_4830_5504 224
62 3300046455 Ga0495603_0008651 Ga0495603_0008651_5266_5940 224
63 3300046457 Ga0495590_0008292 Ga0495590_0008292_58_732 224
64 3300046458 Ga0495591_000330 Ga0495591_000330_16485_17159 224
65 3300046458 Ga0495591_000437 Ga0495591_000437_19292_19966 224
66 3300046460 Ga0495638_0000088 Ga0495638_0000088_102395_103069 224
67 3300046460 Ga0495638_0018375 Ga0495638_0018375_2884_3564 224
68 3300046460 Ga0495638_0021397 Ga0495638_0021397_2730_3404 224
69 3300046460 Ga0495638_0275852 Ga0495638_0275852_224_898 224
70 3300046463 Ga0495653_0000502 Ga0495653_0000502_12765_13439 224
71 3300046471 Ga0495650_0008500 Ga0495650_0008500_1367_2047 224
72 3300046474 Ga0495605_0000250 Ga0495605_0000250_23067_23741 224
73 3300046474 Ga0495605_0002687 Ga0495605_0002687_6943_7668 224
74 3300046474 Ga0495605_0010183 Ga0495605_0010183_4394_5068 224
75 3300046491 Ga0495584_0001072 Ga0495584_0001072_2280_2954 224
76 3300046491 Ga0495584_0099332 Ga0495584_0099332_270_944 224
77 3300046492 Ga0495585_0011813 Ga0495585_0011813_1228_1953 224
78 3300046492 Ga0495585_0023538 Ga0495585_0023538_1693_2370 224
79 3300046501 Ga0495607_0000609 Ga0495607_0000609_1431_2111 224
80 3300046501 Ga0495607_0014982 Ga0495607_0014982_1596_2321 224
81 3300046501 Ga0495607_0160870 Ga0495607_0160870_20_694 224
82 3300046506 Ga0495583_0004566 Ga0495583_0004566_6856_7530 224
83 3300046507 Ga0495606_0169725 Ga0495606_0169725_157_831 224
84 3300046512 Ga0495610_0040936 Ga0495610_0040936_1268_1942 224
85 3300046513 Ga0495616_0000041 Ga0495616_0000041_106001_106726 224
86 3300046513 Ga0495616_0000156 Ga0495616_0000156_28252_28932 224
87 3300046513 Ga0495616_0020479 Ga0495616_0020479_1477_2151 224
88 3300046519 Ga0495632_0004482 Ga0495632_0004482_5963_6688 224
89 3300046519 Ga0495632_0005868 Ga0495632_0005868_584_1258 224
90 3300046519 Ga0495632_0007158 Ga0495632_0007158_515_1189 224
91 3300046520 Ga0495637_0007134 Ga0495637_0007134_4526_5200 224
92 3300046520 Ga0495637_0018053 Ga0495637_0018053_1846_2571 224
93 3300046522 Ga0495643_0010326 Ga0495643_0010326_305_985 224
94 3300046523 Ga0495644_0000005 Ga0495644_0000005_81639_82313 224
95 3300046524 Ga0495648_0002220 Ga0495648_0002220_10816_11541 224
96 3300046524 Ga0495648_0092963 Ga0495648_0092963_678_1352 224
97 3300046524 Ga0495648_0198439 Ga0495648_0198439_271_945 224
98 3300046526 Ga0495666_0001628 Ga0495666_0001628_4099_4773 224
99 3300046528 Ga0495642_0000006 Ga0495642_0000006_148331_149005 224
100 3300046530 Ga0495654_0000050 Ga0495654_0000050_119886_120611 224
101 3300046530 Ga0495654_0011678 Ga0495654_0011678_863_1537 224
102 3300046530 Ga0495654_0018753 Ga0495654_0018753_913_1593 224
103 3300046530 Ga0495654_0039396 Ga0495654_0039396_1082_1756 224
104 3300046536 Ga0495587_0116084 Ga0495587_0116084_424_1098 224
105 3300046542 Ga0495597_0018209 Ga0495597_0018209_2607_3281 224
106 3300046542 Ga0495597_0019213 Ga0495597_0019213_1647_2321 224
107 3300046543 Ga0495645_0085512 Ga0495645_0085512_137_811 224
108 3300046616 Ga0495668_0187580 Ga0495668_0187580_239_913 224
109 3300046642 Ga0495634_0002612 Ga0495634_0002612_5418_6092 224
110 3300046660 Ga0495625_0000103 Ga0495625_0000103_15001_15726 224
111 3300046660 Ga0495625_0012072 Ga0495625_0012072_4254_4928 224
112 3300046660 Ga0495625_0013454 Ga0495625_0013454_420_1094 224
113 3300046660 Ga0495625_0034807 Ga0495625_0034807_2280_2954 224
114 3300046665 Ga0495661_0006911 Ga0495661_0006911_45_719 224
115 3300046674 Ga0495588_0010735 Ga0495588_0010735_3316_3990 224
116 3300046680 Ga0495646_0074962 Ga0495646_0074962_219_893 224
117 3300046684 Ga0495669_0016387 Ga0495669_0016387_608_1282 224
118 3300046689 Ga0495613_0004033 Ga0495613_0004033_2567_3241 224
119 3300046690 Ga0495624_0000530 Ga0495624_0000530_16103_16777 224
120 3300046691 Ga0495670_0009442 Ga0495670_0009442_3148_3822 224
121 3300046692 Ga0495671_0000950 Ga0495671_0000950_6723_7448 224
122 3300046692 Ga0495671_0001769 Ga0495671_0001769_4152_4826 224
123 3300046692 Ga0495671_0011441 Ga0495671_0011441_1097_1777 224
124 3300046692 Ga0495671_0036952 Ga0495671_0036952_1604_2278 224
125 3300046694 Ga0495649_0000060 Ga0495649_0000060_7656_8330 224
126 3300046694 Ga0495649_0009742 Ga0495649_0009742_666_1346 224
127 3300046694 Ga0495649_0030338 Ga0495649_0030338_596_1270 224
128 3300046794 Ga0495589_0000629 Ga0495589_0000629_12431_13105 224
129 3300046794 Ga0495589_0021050 Ga0495589_0021050_1017_1691 224
130 3300046794 Ga0495589_0022753 Ga0495589_0022753_510_1184 224
131 3300046809 Ga0495600_0011275 Ga0495600_0011275_740_1414 224
132 3300046809 Ga0495600_0285638 Ga0495600_0285638_322_996 224
133 3300046810 Ga0495660_0006220 Ga0495660_0006220_2784_3509 224
134 3300046810 Ga0495660_0008786 Ga0495660_0008786_3311_3985 224
135 3300047317 Ga0495604_0006449 Ga0495604_0006449_88_762 224
136 3300047320 Ga0495672_0000158 Ga0495672_0000158_21479_22153 224
137 3300047320 Ga0495672_0000190 Ga0495672_0000190_55494_56168 224
138 3300047320 Ga0495672_0004616 Ga0495672_0004616_117_791 224
139 3300047320 Ga0495672_0004811 Ga0495672_0004811_5002_5676 224
140 3300047321 Ga0495676_0000984 Ga0495676_0000984_10356_11030 224
141 3300047322 Ga0495680_0004517 Ga0495680_0004517_7018_7692 224
142 3300047323 Ga0495683_0008648 Ga0495683_0008648_4404_5078 224
143 3300047323 Ga0495683_0018557 Ga0495683_0018557_2905_3579 224
144 3300047446 Ga0495679_000440 Ga0495679_000440_23217_23942 224
145 3300047469 Ga0495673_0000288 Ga0495673_0000288_23968_24642 224
146 3300047469 Ga0495673_0023821 Ga0495673_0023821_949_1623 224
147 3300047470 Ga0495681_0000141 Ga0495681_0000141_25488_26162 224
148 3300047470 Ga0495681_0005440 Ga0495681_0005440_6989_7663 224
149 3300047470 Ga0495681_0009693 Ga0495681_0009693_1356_2036 224
150 3300047471 Ga0495684_0002261 Ga0495684_0002261_8319_8993 224
151 3300047673 Ga0495593_0000713 Ga0495593_0000713_12942_13616 224
152 3300048088 Ga0495602_0002811 Ga0495602_0002811_17013_17687 224
153 3300048091 Ga0495626_0000074 Ga0495626_0000074_116826_117551 224
154 3300048913 Ga0496110_0008890 Ga0496110_0008890_3988_4662 224
155 3300048914 Ga0496111_0471922 Ga0496111_0471922_185_859 224
156 3300048915 Ga0496112_0199284 Ga0496112_0199284_797_1471 224
157 3300048920 Ga0496117_0046956 Ga0496117_0046956_2375_3049 224
158 3300048921 Ga0496118_0187560 Ga0496118_0187560_317_991 224
159 3300048924 Ga0496121_0002524 Ga0496121_0002524_1371_2045 224
160 3300048924 Ga0496121_0372552 Ga0496121_0372552_247_921 224
161 3300048926 Ga0496123_0067514 Ga0496123_0067514_662_1336 224
162 3300048927 Ga0496124_0038414 Ga0496124_0038414_2691_3365 224
163 3300048927 Ga0496124_0121882 Ga0496124_0121882_808_1482 224
164 3300048928 Ga0496125_0000465 Ga0496125_0000465_16478_17176 224
165 3300049459 Ga0495678_001048 Ga0495678_001048_6604_7329 224
166 3300049459 Ga0495678_002781 Ga0495678_002781_1665_2339 224
167 3300049459 Ga0495678_003236 Ga0495678_003236_3459_4133 224
168 3300049459 Ga0495678_017392 Ga0495678_017392_2151_2825 224
169 3300049459 Ga0495678_026413 Ga0495678_026413_174_848 224
170 3300049460 Ga0495682_0000483 Ga0495682_0000483_5793_6467 224
171 3300049460 Ga0495682_0003159 Ga0495682_0003159_771_1445 224
172 3300049766 Ga0501269_005083 Ga0501269_005083_409_1083 224
173 3300050489 nmdc:mga03683_24622_c1 nmdc:mga03683_24622_c1_1645_2319 224
174 3300050491 nmdc:mga00v17_114453_c1 nmdc:mga00v17_114453_c1_130_804 224
175 3300050491 nmdc:mga00v17_46307_c1 nmdc:mga00v17_46307_c1_1615_2289 224
176 iso_pu_bacteria 2511231016 2511325538 227
177 iso_pu_bacteria 2599185307 2599970850 227
178 iso_pu_bacteria 2603880199 2606130473 227
179 iso_pu_bacteria 2643221565 2643845830 227
180 iso_pu_bacteria 2791355520 2794598033 227
181 iso_pu_bacteria 2808606361 2808857163 227
182 iso_pu_bacteria 2808606376 2808925044 227
183 iso_pu_bacteria 2808606378 2808937235 227
184 iso_pu_bacteria 2808606380 2808947146 227
185 iso_pu_bacteria 2808606383 2808965551 227
186 iso_pu_bacteria 2808606389 2809000493 227
187 iso_pu_bacteria 2842815866 2842820446 227
188 iso_pu_bacteria 2842849001 2842849050 227
189 iso_pu_bacteria 2878029506 2878032298 227
190 iso_pu_bacteria 2904550169 2904550747 227
191 iso_pu_bacteria 2912963787 2912967007 227
192 iso_pu_bacteria 2919697872 2919703562 227
193 iso_pu_bacteria 2988728565 2988728650 227
194 iso_pu_bacteria 3007252601 3007256173 227
195 iso_pu_bacteria 3007614139 3007619245 227
196 iso_pu_bacteria 3007872151 3007872193 227
197 iso_pu_bacteria 8056137416 8056140122 227
198 3300046543 Ga0495645_0220384 Ga0495645_0220384_286_984 230
199 iso_pu_bacteria 2842854478 2842857814 230
200 iso_pu_bacteria 8056143049 8056146365 230
201 3300005288 Ga0065714_10000150 Ga0065714_100001507 231
202 3300005288 Ga0065714_10003714 Ga0065714_100037149 231
203 3300005288 Ga0065714_10114457 Ga0065714_101144571 231
204 3300005290 Ga0065712_10001759 Ga0065712_100017594 231
205 3300006058 Ga0075432_10058625 Ga0075432_100586251 231
206 3300013104 Ga0157370_10006414 Ga0157370_100064143 231
207 3300014497 Ga0182008_10109843 Ga0182008_101098432 231
208 3300017792 Ga0163161_10003907 Ga0163161_100039079 231
209 3300025735 Ga0207713_1009432 Ga0207713_10094324 231
210 3300031548 Ga0307408_100045669 Ga0307408_1000456692 231
211 3300031901 Ga0307406_10039114 Ga0307406_100391141 231
212 3300041407 Ga0439447_023417 Ga0439447_023417_654_1349 231
213 3300042010 Ga0439452_000046 Ga0439452_000046_80404_81099 231
214 3300042137 Ga0450902_017556 Ga0450902_017556_148_843 231
215 3300046453 Ga0495627_000133 Ga0495627_000133_83290_84036 231
216 3300046455 Ga0495603_0013219 Ga0495603_0013219_2618_3313 231
217 3300046458 Ga0495591_011500 Ga0495591_011500_1546_2241 231
218 3300046475 Ga0495639_0213855 Ga0495639_0213855_188_883 231
219 3300046499 Ga0495594_0000424 Ga0495594_0000424_11926_12621 231
220 3300046507 Ga0495606_0120961 Ga0495606_0120961_477_1172 231
221 3300046507 Ga0495606_0160990 Ga0495606_0160990_396_1091 231
222 3300046520 Ga0495637_0019973 Ga0495637_0019973_569_1264 231
223 3300046524 Ga0495648_0000237 Ga0495648_0000237_40943_41638 231
224 3300046530 Ga0495654_0044894 Ga0495654_0044894_168_863 231
225 3300046538 Ga0495609_0013125 Ga0495609_0013125_2490_3185 231
226 3300046538 Ga0495609_0022772 Ga0495609_0022772_1303_1998 231
227 3300046557 Ga0495622_0026381 Ga0495622_0026381_1847_2542 231
228 3300046660 Ga0495625_0179663 Ga0495625_0179663_171_866 231
229 3300046684 Ga0495669_0089584 Ga0495669_0089584_685_1380 231
230 3300046692 Ga0495671_0000961 Ga0495671_0000961_15564_16259 231
231 3300046692 Ga0495671_0036168 Ga0495671_0036168_726_1421 231
232 3300046694 Ga0495649_0000566 Ga0495649_0000566_17913_18608 231
233 3300046694 Ga0495649_0001326 Ga0495649_0001326_15350_16096 231
234 3300046794 Ga0495589_0062729 Ga0495589_0062729_1069_1764 231
235 3300047323 Ga0495683_0002985 Ga0495683_0002985_5926_6672 231
236 3300047469 Ga0495673_0000112 Ga0495673_0000112_114374_115069 231
237 3300047469 Ga0495673_0002300 Ga0495673_0002300_10011_10757 231
238 3300047469 Ga0495673_0009003 Ga0495673_0009003_2883_3596 231
239 3300048091 Ga0495626_0001795 Ga0495626_0001795_8985_9680 231
240 3300048919 Ga0496116_0000858 Ga0496116_0000858_27193_27888 231
241 3300048920 Ga0496117_0004465 Ga0496117_0004465_8507_9202 231
242 3300048921 Ga0496118_0008855 Ga0496118_0008855_6122_6817 231
243 3300048924 Ga0496121_0033101 Ga0496121_0033101_1358_2053 231
244 3300048925 Ga0496122_0011216 Ga0496122_0011216_2440_3135 231
245 3300048926 Ga0496123_0004671 Ga0496123_0004671_7545_8240 231
246 3300048927 Ga0496124_0146828 Ga0496124_0146828_705_1400 231
247 iso_pu_bacteria 2826581358 2826585343 232
248 3300031548 Ga0307408_100000066 Ga0307408_10000006620 234
249 3300031824 Ga0307413_10174198 Ga0307413_101741982 234
250 3300032005 Ga0307411_10007411 Ga0307411_100074112 234
251 3300046474 Ga0495605_0019496 Ga0495605_0019496_746_1450 234
252 3300046474 Ga0495605_0000145 Ga0495605_0000145_42645_43358 236
253 3300046506 Ga0495583_0001543 Ga0495583_0001543_17563_18276 236
254 3300046515 Ga0495620_0000175 Ga0495620_0000175_8180_8893 236
255 3300046665 Ga0495661_0017243 Ga0495661_0017243_3583_4296 236
256 3300047469 Ga0495673_0026107 Ga0495673_0026107_31_744 236
257 3300049459 Ga0495678_011020 Ga0495678_011020_3621_4331 236
258 3300046455 Ga0495603_0199271 Ga0495603_0199271_387_1115 237
259 3300041407 Ga0439447_020727 Ga0439447_020727_762_1487 238
260 3300041997 Ga0439431_0000049 Ga0439431_0000049_15534_16259 238
261 3300042010 Ga0439452_001287 Ga0439452_001287_190_915 238
262 3300046491 Ga0495584_0009825 Ga0495584_0009825_3790_4512 238
263 3300046810 Ga0495660_0000136 Ga0495660_0000136_22660_23382 238
264 3300049459 Ga0495678_019482 Ga0495678_019482_2189_2917 238
265 iso_pu_bacteria 2511231014 2511316501 238
266 iso_pu_bacteria 2511231004 2511257491 241
267 3300041405 Ga0439438_000126 Ga0439438_000126_3631_4359 242
268 3300041407 Ga0439447_000290 Ga0439447_000290_7133_7861 242
269 3300041407 Ga0439447_002894 Ga0439447_002894_202_930 242
270 3300041411 Ga0439466_0008585 Ga0439466_0008585_2768_3496 242
271 3300042009 Ga0439451_035611 Ga0439451_035611_30_758 242
272 3300042138 Ga0450903_003905 Ga0450903_003905_1403_2131 242
273 3300046453 Ga0495627_011575 Ga0495627_011575_1015_1743 242
274 3300046455 Ga0495603_0042875 Ga0495603_0042875_18_746 242
275 3300046457 Ga0495590_0008569 Ga0495590_0008569_626_1354 242
276 3300046458 Ga0495591_009392 Ga0495591_009392_887_1615 242
277 3300046460 Ga0495638_0024748 Ga0495638_0024748_3119_3847 242
278 3300046471 Ga0495650_0002334 Ga0495650_0002334_8174_8902 242
279 3300046491 Ga0495584_0006215 Ga0495584_0006215_4739_5467 242
280 3300046492 Ga0495585_0002108 Ga0495585_0002108_12651_13379 242
281 3300046500 Ga0495596_0000225 Ga0495596_0000225_35328_36056 242
282 3300046512 Ga0495610_0007379 Ga0495610_0007379_5136_5864 242
283 3300046512 Ga0495610_0020144 Ga0495610_0020144_1279_2007 242
284 3300046515 Ga0495620_0018660 Ga0495620_0018660_668_1396 242
285 3300046518 Ga0495631_0020981 Ga0495631_0020981_507_1235 242
286 3300046519 Ga0495632_0005172 Ga0495632_0005172_6047_6775 242
287 3300046520 Ga0495637_0001072 Ga0495637_0001072_2584_3312 242
288 3300046522 Ga0495643_0043107 Ga0495643_0043107_1537_2265 242
289 3300046523 Ga0495644_0000160 Ga0495644_0000160_28180_28908 242
290 3300046523 Ga0495644_0011871 Ga0495644_0011871_2561_3289 242
291 3300046530 Ga0495654_0014402 Ga0495654_0014402_2171_2899 242
292 3300046542 Ga0495597_0144858 Ga0495597_0144858_59_793 242
293 3300046615 Ga0495656_0010213 Ga0495656_0010213_2180_2908 242
294 3300046616 Ga0495668_0000253 Ga0495668_0000253_51508_52236 242
295 3300046660 Ga0495625_0011576 Ga0495625_0011576_2352_3080 242
296 3300046665 Ga0495661_0156533 Ga0495661_0156533_127_855 242
297 3300046692 Ga0495671_0071970 Ga0495671_0071970_908_1636 242
298 3300046810 Ga0495660_0004959 Ga0495660_0004959_1183_1911 242
299 3300047320 Ga0495672_0013593 Ga0495672_0013593_1817_2545 242
300 3300047323 Ga0495683_0001223 Ga0495683_0001223_14632_15387 242
301 3300047470 Ga0495681_0000668 Ga0495681_0000668_2217_2945 242
302 3300047470 Ga0495681_0037736 Ga0495681_0037736_1356_2084 242
303 3300047472 Ga0495686_0030343 Ga0495686_0030343_838_1566 242
304 3300048091 Ga0495626_0000032 Ga0495626_0000032_59887_60615 242
305 3300048905 Ga0496102_0001644 Ga0496102_0001644_11421_12152 243
306 3300048906 Ga0496103_0000781 Ga0496103_0000781_7463_8194 243
307 3300048920 Ga0496117_0004826 Ga0496117_0004826_2444_3175 243
308 3300048921 Ga0496118_0015141 Ga0496118_0015141_1636_2367 243
309 3300046460 Ga0495638_0001330 Ga0495638_0001330_97_861 245
310 3300046692 Ga0495671_0007198 Ga0495671_0007198_2251_2988 245
311 3300047318 Ga0495636_0064020 Ga0495636_0064020_10_747 245
312 3300047322 Ga0495680_0001081 Ga0495680_0001081_7971_8708 245
313 3300047469 Ga0495673_0000447 Ga0495673_0000447_14574_15311 245
314 3300025735 Ga0207713_1020221 Ga0207713_10202213 246
315 3300046457 Ga0495590_0000339 Ga0495590_0000339_6053_6808 246
316 3300046513 Ga0495616_0000245 Ga0495616_0000245_16881_17636 246
317 iso_pu_bacteria 2738543004 2739197442 246
318 3300030733 Ga0314311_1236442 Ga0314311_12364422 248
319 3300031548 Ga0307408_100002922 Ga0307408_1000029227 248
320 3300031731 Ga0307405_10015857 Ga0307405_100158572 248
321 3300031824 Ga0307413_10024628 Ga0307413_100246284 248
322 3300031903 Ga0307407_10111426 Ga0307407_101114262 248
323 3300031911 Ga0307412_10009216 Ga0307412_100092163 248
324 3300032002 Ga0307416_100119421 Ga0307416_1001194212 248
325 3300032004 Ga0307414_10042171 Ga0307414_100421712 248
326 3300049662 Ga0501222_000135 Ga0501222_000135_11658_12410 248
327 3300046474 Ga0495605_0008433 Ga0495605_0008433_2266_3048 249
328 3300046810 Ga0495660_0007132 Ga0495660_0007132_2670_3452 249
329 3300009036 Ga0105244_10005578 Ga0105244_100055786 252
330 3300015261 Ga0182006_1001849 Ga0182006_10018496 252
331 3300015262 Ga0182007_10001264 Ga0182007_1000126410 252
332 3300015265 Ga0182005_1000844 Ga0182005_100084410 252
333 3300046475 Ga0495639_0000090 Ga0495639_0000090_39041_39814 252
334 3300046506 Ga0495583_0010352 Ga0495583_0010352_572_1345 252
335 3300046526 Ga0495666_0013072 Ga0495666_0013072_3039_3812 252
336 3300046557 Ga0495622_0002032 Ga0495622_0002032_5311_6084 252
337 3300046664 Ga0495659_0000295 Ga0495659_0000295_1979_2752 252
338 3300046694 Ga0495649_0009074 Ga0495649_0009074_4317_5090 252
339 3300046794 Ga0495589_0082279 Ga0495589_0082279_323_1096 252
340 3300046810 Ga0495660_0047481 Ga0495660_0047481_1436_2209 252
341 3300047323 Ga0495683_0061739 Ga0495683_0061739_386_1159 252
342 3300047470 Ga0495681_0040118 Ga0495681_0040118_876_1649 252
343 3300047673 Ga0495593_0062992 Ga0495593_0062992_843_1616 252
344 3300048091 Ga0495626_0002407 Ga0495626_0002407_11807_12580 252
345 3300048919 Ga0496116_0001153 Ga0496116_0001153_4242_5015 252
346 3300048920 Ga0496117_0262096 Ga0496117_0262096_80_853 252
347 3300048921 Ga0496118_0179096 Ga0496118_0179096_345_1118 252
348 3300048925 Ga0496122_0015428 Ga0496122_0015428_4316_5089 252
349 3300048926 Ga0496123_0022424 Ga0496123_0022424_3795_4568 252
350 3300048927 Ga0496124_0239344 Ga0496124_0239344_20_793 252
351 iso_pu_bacteria 2511231012 2511303556 253
352 iso_pu_bacteria 2623620446 2624492924 253
353 iso_pu_bacteria 2738543015 2739262346 253
354 iso_pu_bacteria 2773857670 2774119049 253
355 iso_pu_bacteria 2784132072 2784312688 253
356 iso_pu_bacteria 3007511990 3007514739 253
357 iso_pu_bacteria 8019775933 8019782207 253
358 iso_pu_bacteria 8056125926 8056129056 253
359 3300046538 Ga0495609_0047119 Ga0495609_0047119_663_1442 255
360 iso_pu_bacteria 2554235341 2555669375 256
361 2124908027 MRS2a_Contig_721 MRS2a_00578320 257
362 3300006058 Ga0075432_10001985 Ga0075432_100019856 257
363 3300009011 Ga0105251_10052809 Ga0105251_100528092 257
364 3300013104 Ga0157370_10052444 Ga0157370_100524445 257
365 3300014497 Ga0182008_10026348 Ga0182008_100263482 257
366 3300015261 Ga0182006_1005129 Ga0182006_10051293 257
367 3300017792 Ga0163161_10214436 Ga0163161_102144362 257
368 3300025292 Ga0209676_1003838 Ga0209676_10038382 257
369 3300025298 Ga0209050_1000782 Ga0209050_100078218 257
370 3300025303 Ga0209051_1013616 Ga0209051_10136162 257
371 3300025735 Ga0207713_1005809 Ga0207713_10058094 257
372 3300025735 Ga0207713_1015622 Ga0207713_10156224 257
373 3300027907 Ga0207428_10010472 Ga0207428_100104727 257
374 3300027907 Ga0207428_10016121 Ga0207428_100161212 257
375 3300027907 Ga0207428_10120407 Ga0207428_101204072 257
376 3300041407 Ga0439447_001296 Ga0439447_001296_1482_2255 257
377 3300042010 Ga0439452_000777 Ga0439452_000777_13903_14676 257
378 3300042122 Ga0450920_002733 Ga0450920_002733_1852_2625 257
379 3300042138 Ga0450903_011052 Ga0450903_011052_384_1157 257
380 3300042146 Ga0450907_000390 Ga0450907_000390_5598_6371 257
381 3300042147 Ga0450910_001978 Ga0450910_001978_625_1398 257
382 3300042461 Ga0439460_0006939 Ga0439460_0006939_500_1273 257
383 3300046452 Ga0495617_004252 Ga0495617_004252_2932_3705 257
384 3300046458 Ga0495591_002856 Ga0495591_002856_4268_5041 257
385 3300046459 Ga0495629_0017687 Ga0495629_0017687_3145_3918 257
386 3300046460 Ga0495638_0016047 Ga0495638_0016047_3984_4757 257
387 3300046471 Ga0495650_0000902 Ga0495650_0000902_5613_6386 257
388 3300046473 Ga0495582_0130171 Ga0495582_0130171_177_950 257
389 3300046475 Ga0495639_0022070 Ga0495639_0022070_1074_1847 257
390 3300046492 Ga0495585_0013838 Ga0495585_0013838_1864_2637 257
391 3300046492 Ga0495585_0014456 Ga0495585_0014456_1094_1867 257
392 3300046492 Ga0495585_0018660 Ga0495585_0018660_479_1252 257
393 3300046499 Ga0495594_0001807 Ga0495594_0001807_5050_5823 257
394 3300046501 Ga0495607_0006264 Ga0495607_0006264_6514_7287 257
395 3300046506 Ga0495583_0000538 Ga0495583_0000538_17463_18236 257
396 3300046506 Ga0495583_0054070 Ga0495583_0054070_733_1506 257
397 3300046507 Ga0495606_0064560 Ga0495606_0064560_750_1523 257
398 3300046513 Ga0495616_0044126 Ga0495616_0044126_717_1490 257
399 3300046519 Ga0495632_0000295 Ga0495632_0000295_31333_32106 257
400 3300046520 Ga0495637_0002032 Ga0495637_0002032_3721_4494 257
401 3300046523 Ga0495644_0000504 Ga0495644_0000504_359_1132 257
402 3300046524 Ga0495648_0000642 Ga0495648_0000642_5545_6318 257
403 3300046524 Ga0495648_0005792 Ga0495648_0005792_3616_4389 257
404 3300046524 Ga0495648_0010226 Ga0495648_0010226_4428_5201 257
405 3300046524 Ga0495648_0109143 Ga0495648_0109143_331_1104 257
406 3300046528 Ga0495642_0000198 Ga0495642_0000198_18491_19264 257
407 3300046530 Ga0495654_0000272 Ga0495654_0000272_4158_4931 257
408 3300046530 Ga0495654_0001044 Ga0495654_0001044_12125_12898 257
409 3300046536 Ga0495587_0026572 Ga0495587_0026572_472_1245 257
410 3300046538 Ga0495609_0009479 Ga0495609_0009479_2919_3692 257
411 3300046538 Ga0495609_0009841 Ga0495609_0009841_3505_4278 257
412 3300046557 Ga0495622_0001557 Ga0495622_0001557_9308_10081 257
413 3300046615 Ga0495656_0060623 Ga0495656_0060623_717_1490 257
414 3300046616 Ga0495668_0049223 Ga0495668_0049223_1062_1835 257
415 3300046642 Ga0495634_0048277 Ga0495634_0048277_1177_1950 257
416 3300046660 Ga0495625_0012312 Ga0495625_0012312_2024_2797 257
417 3300046660 Ga0495625_0060597 Ga0495625_0060597_341_1114 257
418 3300046660 Ga0495625_0247023 Ga0495625_0247023_341_1114 257
419 3300046664 Ga0495659_0007527 Ga0495659_0007527_852_1625 257
420 3300046674 Ga0495588_0012182 Ga0495588_0012182_2276_3049 257
421 3300046680 Ga0495646_0000385 Ga0495646_0000385_20740_21513 257
422 3300046684 Ga0495669_0018920 Ga0495669_0018920_208_981 257
423 3300046691 Ga0495670_0000491 Ga0495670_0000491_14757_15530 257
424 3300046691 Ga0495670_0008571 Ga0495670_0008571_3529_4302 257
425 3300046692 Ga0495671_0009194 Ga0495671_0009194_4005_4778 257
426 3300046692 Ga0495671_0023582 Ga0495671_0023582_195_995 257
427 3300046794 Ga0495589_0024127 Ga0495589_0024127_329_1102 257
428 3300046810 Ga0495660_0002857 Ga0495660_0002857_1681_2454 257
429 3300046810 Ga0495660_0046868 Ga0495660_0046868_851_1651 257
430 3300046810 Ga0495660_0057014 Ga0495660_0057014_862_1635 257
431 3300047315 Ga0495581_0030082 Ga0495581_0030082_191_964 257
432 3300047317 Ga0495604_0045749 Ga0495604_0045749_1167_1940 257
433 3300047320 Ga0495672_0005190 Ga0495672_0005190_5564_6337 257
434 3300047320 Ga0495672_0012797 Ga0495672_0012797_4652_5425 257
435 3300047320 Ga0495672_0024229 Ga0495672_0024229_2201_2974 257
436 3300047320 Ga0495672_0085824 Ga0495672_0085824_292_1065 257
437 3300047320 Ga0495672_0118431 Ga0495672_0118431_160_933 257
438 3300047323 Ga0495683_0002675 Ga0495683_0002675_3886_4686 257
439 3300047323 Ga0495683_0064296 Ga0495683_0064296_322_1095 257
440 3300047323 Ga0495683_0086059 Ga0495683_0086059_426_1199 257
441 3300047443 Ga0495687_000222 Ga0495687_000222_6192_6965 257
442 3300047444 Ga0495675_0312173 Ga0495675_0312173_145_918 257
443 3300047445 Ga0495677_0022784 Ga0495677_0022784_706_1479 257
444 3300047469 Ga0495673_0092093 Ga0495673_0092093_151_924 257
445 3300047472 Ga0495686_0057010 Ga0495686_0057010_79_852 257
446 3300048091 Ga0495626_0000072 Ga0495626_0000072_116676_117449 257
447 3300048091 Ga0495626_0022077 Ga0495626_0022077_1792_2565 257
448 3300048091 Ga0495626_0022846 Ga0495626_0022846_405_1178 257
449 3300048920 Ga0496117_0178807 Ga0496117_0178807_328_1101 257
450 3300048927 Ga0496124_0000547 Ga0496124_0000547_48514_49314 257
451 3300048927 Ga0496124_0019950 Ga0496124_0019950_3073_3846 257
452 3300048928 Ga0496125_0016036 Ga0496125_0016036_5456_6229 257
453 3300049459 Ga0495678_004902 Ga0495678_004902_2516_3316 257
454 3300049459 Ga0495678_012979 Ga0495678_012979_2438_3211 257
455 3300049460 Ga0495682_0008879 Ga0495682_0008879_3148_3921 257
456 3300049460 Ga0495682_0042914 Ga0495682_0042914_479_1252 257
457 3300049460 Ga0495682_0057046 Ga0495682_0057046_33_806 257
458 3300049460 Ga0495682_0067872 Ga0495682_0067872_479_1252 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12847

Methyltransf_18

Methyltransferase domain

32

178

0.99

PF04816

TrmK

tRNA (adenine(22)-N(1))-methyltransferase

49

245

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gnl-assembly2.cif.gz_B structure of uncharacterized protein (lmof2365_1472) from listeria monocytogenes serotype 4b 0.949 31 253
3ku1-assembly2.cif.gz_B crystal structure of streptococcus pneumoniae sp1610, a putative trna (m1a22) methyltransferase, in complex with s-adenosyl-l-methionine 0.9423 31 253
3ku1-assembly2.cif.gz_B crystal structure of streptococcus pneumoniae sp1610, a putative trna (m1a22) methyltransferase, in complex with s-adenosyl-l-methionine 0.938 31 253
3lec-assembly1.cif.gz_A the crystal structure of a protein in the nadb-rossmann superfamily from streptococcus agalactiae to 1.8a 0.9352 31 253
6q56-assembly4.cif.gz_D crystal structure of the b. subtilis m1a22 trna methyltransferase trmk 0.9236 30 253
ID Description Score Start End Superfamily
af_Q2FY13_1_163_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9657 31 189 3.40.50.150
3gnlB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9518 31 188 3.40.50.150
3lecA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9495 31 185 3.40.50.150
af_Q2FY13_1_163_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9368 31 189 3.40.50.150
3gnlB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9346 31 188 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6L3MCM4-F1-model_v4 deleted 0.9969 29 135
AF-A0A4U3MR54-F1-model_v4 SAM-dependent methyltransferase 0.9944 29 111 GO:0032259
GO:0160105
AF-A0A1T2Z700-F1-model_v4 tRNA (Adenine-N(1))-methyltransferase 0.9929 29 105 GO:0008168
GO:0032259
AF-A0A3M2VW08-F1-model_v4 SAM-dependent methyltransferase 0.9896 28 153
AF-A0A519EMQ9-F1-model_v4 tRNA (Adenine-N(1))-methyltransferase 0.9852 29 199 GO:0032259
GO:0160105

Feature Viewer

pLDDT pTM Quality
86.69 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map