metagRoot

F448116

General Info

Members	Datasets	Scaffolds	Average Seq Length
458	286	417	244

Family's Representative Sequence

Representative Sequence	3300003323\|rootH1_10270102\|rootH1_102701021
Length	290
Sequence	MAHGRHAMIDAAGTPWHRHMTRGSAVLPKATIRRTRNDEASVAGGEAGWQQSLRRLYEGHSAAGQRFRYGLVALDVVTVLYIVATSFLDHSRLIGIIDVTLGVVLLADFAARMVLARRRWRELLYPSTWADVAAIVSFLAPILGEGLAFLRALVAQLRADSPYFRRHEEVILALANLVVFIFIVTGAVYETQHYTNPSIHNYVDALYFTVAALTTTGFGDITLSGTVGRLLSVIIMIFGVTLFFNLARALLSPSKVRFSCPTCGLQRHDSDAVHCKACGTVLNIPDEGLT

Samples

	Sample ID	Description	Type	Environment
1	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
2	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
3	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
4	2595698237	Methylobacterium sp. UNCCL125	Isolate	Unclassified
5	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
6	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
7	2791355048	Caulobacter flavus CGMCC1 15093	Isolate	Rhizosphere
8	2791355199
9	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
10	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
11	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
12	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
13	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
14	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
15	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
16	2829745981	Methylorubrum rhodinum DSM 2163	Isolate	Rhizosphere
17	2840878972	Albibacillus kandeliae J95	Isolate	Rhizosphere
18	2843744320	Caulobacter flavus RHGG3	Isolate	Unclassified
19	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
20	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
21	2849560528	Caulobacter zeae 410	Isolate	Unclassified
22	2849573788	Caulobacter endophyticus 774	Isolate	Unclassified
23	2851153111	Caulobacter radicis 736	Isolate	Unclassified
24	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
25	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
26	2861691609	Methylorubrum thiocyanatum DSM 11490	Isolate	Rhizosphere
27	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
28	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
29	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
30	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
31	2902405164	Methylobacterium sp. P1-11	Isolate	Unclassified
32	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
33	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
34	2928125067	Methylobacterium sp. 1973	Isolate	Unclassified
35	3003665799	Methylobacterium aquaticum BG2	Isolate	Unclassified
36	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
37	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
38	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
39	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
40	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
41	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
42	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
43	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
44	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
45	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
46	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
47	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
48	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
49	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
50	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
51	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
52	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
53	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
54	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
55	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
56	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
57	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
58	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
59	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
60	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
61	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
62	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
63	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
64	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
65	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
66	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
67	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
68	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
69	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
70	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
71	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
72	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
73	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
74	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
75	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
76	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
77	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
78	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
79	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
80	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
81	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
82	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
83	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
84	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
85	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
86	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
87	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
88	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
89	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
90	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
91	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
92	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
93	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
94	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
95	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
96	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
97	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
98	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
99	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
100	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
101	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
102	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
103	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
104	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
105	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
106	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
107	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
108	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
109	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
110	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
111	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
112	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
113	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
114	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
115	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
116	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
117	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
118	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
119	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
121	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
123	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
158	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
159	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
163	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
164	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
165	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
166	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
167	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
168	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
169	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
170	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
171	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
172	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
173	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
174	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
175	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
176	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
177	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
178	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
179	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
180	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
181	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
182	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
183	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
184	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
185	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
186	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
187	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
188	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
189	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
190	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
191	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
192	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
193	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
194	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
195	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
196	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
197	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
198	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
199	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
200	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
201	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
202	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
203	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
204	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
205	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
206	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
207	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
208	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
209	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
210	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
211	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
212	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
213	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
214	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
215	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
216	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
217	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
218	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
219	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
220	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
221	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
222	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
223	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
224	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
225	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
226	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
227	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
228	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
229	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
230	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
231	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
232	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
233	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
234	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
235	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
236	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
237	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
238	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
239	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
240	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
241	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
242	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
243	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
244	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
245	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
246	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
247	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
248	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
249	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
250	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
251	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
252	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
253	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
254	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
255	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
256	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
257	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
258	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
259	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
260	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
261	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
262	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
263	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
264	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
265	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
266	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
267	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
268	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
269	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
270	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
271	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
272	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
273	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
274	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
275	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
276	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
277	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
278	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
279	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
280	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
281	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
282	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
283	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
284	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
285	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
286	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	91.25
Metatranscriptomes	0
Isolates	8.75

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.23
Nodule	2.84
Rhizoplane	8.52
Rhizosphere	67.9
Stem	0
Stem Tuber	0
Unclassified	8.52

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10005123	3300003203	Bacteria	6078
2	JGI25153J46596_10000703	3300003215	Bacteria	20474
3	JGI25153J46596_10004919	3300003215	Bacteria	7102
4	rootL2_10113382	3300003322	Bacteria	2248
5	rootL2_10338969	3300003322	Bacteria	1455
6	rootH1_10270102	3300003323	Bacteria	1376
7	JGI25404J52841_10000420	3300003659	Bacteria	5930
8	Ga0055531_10004834	3300003794	Bacteria	8038
9	Ga0065165_1004197	3300005262	Bacteria	9179
10	Ga0065165_1005620	3300005262	Bacteria	6942
11	Ga0070658_10109157	3300005327	Bacteria	2291
12	Ga0070658_10499897	3300005327	Bacteria	1050
13	Ga0068869_100019026	3300005334	Bacteria	4684
14	Ga0070680_100022165	3300005336	Bacteria	5054
15	Ga0070682_100166421	3300005337	Bacteria	1528
16	Ga0070682_100498859	3300005337	Bacteria	943
17	Ga0070687_100038286	3300005343	Bacteria	2403
18	Ga0070668_100011610	3300005347	Bacteria	6558
19	Ga0070668_100025351	3300005347	Bacteria	4495
20	Ga0070668_100055140	3300005347	Bacteria	3067
21	Ga0070668_100063510	3300005347	Bacteria	2862
22	Ga0070668_100132939	3300005347	Bacteria	1998
23	Ga0070668_100341187	3300005347	Bacteria	1266
24	Ga0070668_100452108	3300005347	Bacteria	1104
25	Ga0070669_100094933	3300005353	Bacteria	2242
26	Ga0070669_100391214	3300005353	Bacteria	1136
27	Ga0070671_100408620	3300005355	Bacteria	1162
28	Ga0070674_100218409	3300005356	Bacteria	1482
29	Ga0070674_100589632	3300005356	Bacteria	938
30	Ga0070659_100297076	3300005366	Bacteria	1346
31	Ga0070667_100072674	3300005367	Bacteria	2931
32	Ga0070701_10149865	3300005438	Bacteria	1342
33	Ga0070700_100332209	3300005441	Bacteria	1120
34	Ga0070663_100098802	3300005455	Bacteria	2175
35	Ga0070663_100201170	3300005455	Bacteria	1555
36	Ga0070663_100463718	3300005455	Bacteria	1046
37	Ga0070678_100057226	3300005456	Bacteria	2856
38	Ga0070678_100078023	3300005456	Bacteria	2500
39	Ga0070678_100142272	3300005456	Bacteria	1921
40	Ga0070678_100164067	3300005456	Bacteria	1803
41	Ga0070662_100004117	3300005457	Bacteria	9142
42	Ga0070662_100041912	3300005457	Bacteria	3268
43	Ga0070662_100269699	3300005457	Bacteria	1374
44	Ga0070681_10023400	3300005458	Bacteria	6212
45	Ga0068867_100094913	3300005459	Bacteria	2269
46	Ga0070699_100269739	3300005518	Bacteria	1523
47	Ga0070679_100347652	3300005530	Bacteria	1431
48	Ga0070684_100524671	3300005535	Bacteria	1098
49	Ga0070697_100348268	3300005536	Bacteria	1279
50	Ga0068853_100246480	3300005539	Bacteria	1639
51	Ga0070696_100074679	3300005546	Bacteria	2391
52	Ga0070665_100029095	3300005548	Bacteria	5561
53	Ga0070665_100088317	3300005548	Bacteria	3105
54	Ga0070665_100119765	3300005548	Bacteria	2634
55	Ga0070665_100183221	3300005548	Bacteria	2095
56	Ga0070665_100208593	3300005548	Bacteria	1954
57	Ga0070665_100366664	3300005548	Bacteria	1447
58	Ga0070665_100423184	3300005548	Bacteria	1340
59	Ga0070665_100461335	3300005548	Bacteria	1280
60	Ga0070665_100608800	3300005548	Bacteria	1105
61	Ga0070704_100265120	3300005549	Bacteria	1417
62	Ga0070664_100551324	3300005564	Bacteria	1066
63	Ga0068854_100083307	3300005578	Bacteria	2365
64	Ga0070702_100016652	3300005615	Bacteria	3775
65	Ga0068859_100026003	3300005617	Bacteria	5872
66	Ga0068866_10041919	3300005718	Bacteria	2275
67	Ga0068861_100091001	3300005719	Bacteria	2408
68	Ga0068861_100162636	3300005719	Bacteria	1842
69	Ga0068861_100348834	3300005719	Bacteria	1298
70	Ga0068861_100376096	3300005719	Bacteria	1253
71	Ga0068870_10054031	3300005840	Bacteria	2135
72	Ga0068870_10224909	3300005840	Bacteria	1151
73	Ga0068860_100064619	3300005843	Bacteria	3475
74	Ga0068860_100081532	3300005843	Bacteria	3076
75	Ga0068862_100047142	3300005844	Bacteria	3677
76	Ga0068862_100081382	3300005844	Bacteria	2809
77	Ga0068862_100099275	3300005844	Bacteria	2544
78	Ga0068862_100214149	3300005844	Bacteria	1741
79	Ga0081455_10012953	3300005937	Bacteria	8272
80	Ga0081540_1006401	3300005983	Bacteria	8583
81	Ga0081539_10000737	3300005985	Bacteria	65468
82	Ga0075365_10003516	3300006038	Bacteria	8099
83	Ga0075365_10037539	3300006038	Bacteria	3146
84	Ga0075365_10171178	3300006038	Bacteria	1516
85	Ga0075365_10178371	3300006038	Bacteria	1485
86	Ga0075365_10242126	3300006038	Bacteria	1267
87	Ga0075368_10046577	3300006042	Unclassified	1715
88	Ga0075363_100025060	3300006048	Bacteria	3038
89	Ga0075363_100220975	3300006048	Bacteria	1086
90	Ga0075364_10082837	3300006051	Bacteria	2122
91	Ga0075364_10122698	3300006051	Bacteria	1740
92	Ga0075362_10012399	3300006177	Bacteria	3385
93	Ga0075367_10035342	3300006178	Unclassified	2892
94	Ga0075367_10089796	3300006178	Bacteria	1868
95	Ga0075369_10102051	3300006186	Bacteria	1288
96	Ga0075370_10011359	3300006353	Bacteria	4676
97	Ga0075428_100047973	3300006844	Unclassified	4689
98	Ga0075428_100217122	3300006844	Bacteria	2066
99	Ga0075428_100475264	3300006844	Bacteria	1338
100	Ga0075428_100788626	3300006844	Bacteria	1010
101	Ga0075430_100136898	3300006846	Bacteria	2040
102	Ga0075431_100570145	3300006847	Bacteria	1118
103	Ga0068865_100004347	3300006881	Bacteria	8548
104	Ga0068865_100395353	3300006881	Bacteria	1131
105	Ga0097620_100026006	3300006931	Bacteria	5872
106	Ga0075435_100152784	3300007076	Bacteria	1942
107	Ga0099795_10002852	3300007788	Bacteria	4177
108	Ga0105250_10067158	3300009092	Bacteria	1446
109	Ga0111539_10084388	3300009094	Unclassified	3734
110	Ga0111539_10417720	3300009094	Bacteria	1562
111	Ga0111539_10649828	3300009094	Bacteria	1228
112	Ga0105245_10004015	3300009098	Bacteria	13084
113	Ga0105245_10068840	3300009098	Bacteria	3208
114	Ga0105245_10237560	3300009098	Bacteria	1765
115	Ga0105245_10453838	3300009098	Bacteria	1291
116	Ga0105247_10119257	3300009101	Bacteria	1707
117	Ga0105247_10263119	3300009101	Bacteria	1183
118	Ga0114129_10165922	3300009147	Bacteria	3014
119	Ga0114129_10496696	3300009147	Bacteria	1594
120	Ga0105243_10160096	3300009148	Bacteria	1940
121	Ga0105242_10048044	3300009176	Bacteria	3467
122	Ga0105248_10520662	3300009177	Bacteria	1341
123	Ga0105238_10124884	3300009551	Bacteria	2553
124	Ga0105249_10067607	3300009553	Bacteria	3293
125	Ga0099796_10031571	3300010159	Bacteria	1729
126	Ga0105246_10164114	3300011119	Bacteria	1695
127	Ga0105246_10233375	3300011119	Bacteria	1450
128	Ga0105246_10464767	3300011119	Bacteria	1067
129	Ga0105246_10617121	3300011119	Bacteria	939
130	Ga0157374_10063432	3300013296	Bacteria	3465
131	Ga0157374_10516437	3300013296	Bacteria	1200
132	Ga0157378_10011054	3300013297	Bacteria	7901
133	Ga0163162_10135158	3300013306	Bacteria	2576
134	Ga0163162_10623281	3300013306	Bacteria	1204
135	Ga0163162_10636267	3300013306	Bacteria	1191
136	Ga0157372_10874084	3300013307	Bacteria	1043
137	Ga0157375_10339669	3300013308	Bacteria	1667
138	Ga0157375_10511036	3300013308	Bacteria	1365
139	Ga0163163_10202658	3300014325	Bacteria	2032
140	Ga0163163_10344753	3300014325	Bacteria	1545
141	Ga0163163_10959077	3300014325	Bacteria	918
142	Ga0157380_10312590	3300014326	Bacteria	1453
143	Ga0157380_10339838	3300014326	Bacteria	1400
144	Ga0157380_10581605	3300014326	Bacteria	1104
145	Ga0157379_10091724	3300014968	Bacteria	2725
146	Ga0157379_10685361	3300014968	Bacteria	961
147	Ga0157376_10270962	3300014969	Bacteria	1595
148	Ga0157376_10314146	3300014969	Bacteria	1487
149	Ga0163161_10085342	3300017792	Bacteria	2329
150	Ga0209148_1000462	3300025254	Bacteria	43711
151	Ga0209455_1000870	3300025272	Bacteria	16003
152	Ga0209758_1000140	3300025297	Bacteria	174267
153	Ga0209758_1017704	3300025297	Bacteria	3529
154	Ga0209758_1025749	3300025297	Bacteria	2570
155	Ga0209256_1002028	3300025299	Bacteria	18027
156	Ga0209257_1002350	3300025304	Bacteria	19025
157	Ga0207682_10086946	3300025893	Bacteria	1349
158	Ga0207642_10011521	3300025899	Bacteria	3159
159	Ga0207710_10137763	3300025900	Bacteria	1176
160	Ga0207688_10130964	3300025901	Bacteria	1470
161	Ga0207643_10126624	3300025908	Bacteria	1517
162	Ga0207705_10084954	3300025909	Bacteria	2312
163	Ga0207707_10001429	3300025912	Bacteria	22080
164	Ga0207707_10046127	3300025912	Bacteria	3795
165	Ga0207663_10025281	3300025916	Bacteria	3430
166	Ga0207663_10222271	3300025916	Bacteria	1375
167	Ga0207662_10044481	3300025918	Bacteria	2621
168	Ga0207657_10036516	3300025919	Bacteria	4397
169	Ga0207652_10055889	3300025921	Bacteria	3397
170	Ga0207694_10231407	3300025924	Bacteria	1509
171	Ga0207700_10483640	3300025928	Bacteria	1094
172	Ga0207706_10027152	3300025933	Bacteria	5120
173	Ga0207706_10029379	3300025933	Bacteria	4907
174	Ga0207706_10063273	3300025933	Bacteria	3258
175	Ga0207706_10066608	3300025933	Bacteria	3169
176	Ga0207686_10012991	3300025934	Bacteria	4596
177	Ga0207709_10036047	3300025935	Bacteria	2929
178	Ga0207669_10489214	3300025937	Bacteria	982
179	Ga0207704_10579368	3300025938	Bacteria	916
180	Ga0207691_10013516	3300025940	Bacteria	7808
181	Ga0207691_10163515	3300025940	Bacteria	1951
182	Ga0207689_10012148	3300025942	Bacteria	7371
183	Ga0207689_10025703	3300025942	Bacteria	4933
184	Ga0207689_10239478	3300025942	Bacteria	1500
185	Ga0207712_10035509	3300025961	Bacteria	3388
186	Ga0207668_10229001	3300025972	Bacteria	1497
187	Ga0207668_10343027	3300025972	Bacteria	1246
188	Ga0207668_10383071	3300025972	Bacteria	1184
189	Ga0207640_10045787	3300025981	Bacteria	2811
190	Ga0207677_10027440	3300026023	Bacteria	3586
191	Ga0207677_10060072	3300026023	Bacteria	2626
192	Ga0207639_10169530	3300026041	Bacteria	1847
193	Ga0207678_10011242	3300026067	Bacteria	7860
194	Ga0207678_10014065	3300026067	Bacteria	7037
195	Ga0207678_10021209	3300026067	Bacteria	5695
196	Ga0207678_10031040	3300026067	Bacteria	4663
197	Ga0207678_10084356	3300026067	Bacteria	2717
198	Ga0207678_10100497	3300026067	Bacteria	2471
199	Ga0207678_10156416	3300026067	Bacteria	1946
200	Ga0207678_10264040	3300026067	Bacteria	1476
201	Ga0207678_10273009	3300026067	Bacteria	1450
202	Ga0207708_10060639	3300026075	Bacteria	2887
203	Ga0207708_10171012	3300026075	Bacteria	1721
204	Ga0207648_10010726	3300026089	Bacteria	8662
205	Ga0207675_100031707	3300026118	Bacteria	4924
206	Ga0207675_100186034	3300026118	Bacteria	1991
207	Ga0207675_100228575	3300026118	Bacteria	1794
208	Ga0207683_10048458	3300026121	Bacteria	3720
209	Ga0207683_10063932	3300026121	Bacteria	3242
210	Ga0207683_10174913	3300026121	Bacteria	1945
211	Ga0207698_10040306	3300026142	Bacteria	3469
212	Ga0209179_1001150	3300027512	Bacteria	3102
213	Ga0209983_1036254	3300027665	Bacteria	1060
214	Ga0209813_10072617	3300027866	Bacteria	1122
215	Ga0207428_10124214	3300027907	Bacteria	1977
216	Ga0268266_10027379	3300028379	Bacteria	4847
217	Ga0268266_10066199	3300028379	Bacteria	3124
218	Ga0268266_10137830	3300028379	Bacteria	2187
219	Ga0268266_10143370	3300028379	Bacteria	2145
220	Ga0268266_10256099	3300028379	Bacteria	1620
221	Ga0268266_10631075	3300028379	Bacteria	1030
222	Ga0268265_10254158	3300028380	Bacteria	1558
223	Ga0268264_10054016	3300028381	Bacteria	3353
224	Ga0307517_10057283	3300028786	Bacteria	3779
225	Ga0307408_100061913	3300031548	Bacteria	2733
226	Ga0307408_100105705	3300031548	Bacteria	2153
227	Ga0307408_100355376	3300031548	Bacteria	1245
228	Ga0316579_10030348	3300031691	Bacteria	2470
229	Ga0316579_10053303	3300031691	Bacteria	1895
230	Ga0307516_10071747	3300031730	Bacteria	3324
231	Ga0307516_10316716	3300031730	Bacteria	1232
232	Ga0307405_10022480	3300031731	Bacteria	3566
233	Ga0307413_10085861	3300031824	Bacteria	2033
234	Ga0307412_10031710	3300031911	Bacteria	3341
235	Ga0307412_10116224	3300031911	Bacteria	1919
236	Ga0307412_10170044	3300031911	Bacteria	1629
237	Ga0307409_100676868	3300031995	Bacteria	1028
238	Ga0307416_100110595	3300032002	Bacteria	2420
239	Ga0307416_100256404	3300032002	Bacteria	1706
240	Ga0307414_10370567	3300032004	Bacteria	1235
241	Ga0316583_10002192	3300032133	Bacteria	6732
242	Ga0373923_0043350	3300035111	Bacteria	1862
243	Ga0373960_0030425	3300035121	Bacteria	1504
244	Ga0373946_0026613	3300035171	Bacteria	2283
245	Ga0373931_0012556	3300035691	Bacteria	4106
246	Ga0373931_0112332	3300035691	Bacteria	1547
247	Ga0373935_0010119	3300035692	Bacteria	5648
248	Ga0373935_0048326	3300035692	Bacteria	2694
249	Ga0373927_0027596	3300035695	Bacteria	3706
250	Ga0316582_0000859	3300036647	Bacteria	12375
251	Ga0316582_0086236	3300036647	Bacteria	2059
252	Ga0316582_0152131	3300036647	Bacteria	1564
253	Ga0316584_0089973	3300036712	Bacteria	2298
254	Ga0373925_0032199	3300037068	Bacteria	3858
255	Ga0451797_0244539	3300041453	Bacteria	908
256	Ga0451807_2326971	3300041486	Bacteria	1191
257	Ga0439458_0004268	3300042157	Bacteria	3297
258	Ga0466968_0095348	3300044735	Bacteria	1323
259	Ga0451576_0096917	3300045051	Bacteria	3068
260	Ga0495603_0050930	3300046455	Bacteria	2461
261	Ga0495603_0095020	3300046455	Bacteria	1741
262	Ga0495603_0140100	3300046455	Bacteria	1407
263	Ga0495629_0006842	3300046459	Bacteria	8425
264	Ga0495629_0188132	3300046459	Bacteria	1429
265	Ga0495638_0000150	3300046460	Bacteria	109804
266	Ga0495641_0044684	3300046461	Bacteria	2042
267	Ga0495580_0165364	3300046472	Bacteria	1530
268	Ga0495582_0010966	3300046473	Bacteria	4988
269	Ga0495582_0084691	3300046473	Bacteria	1762
270	Ga0495639_0027324	3300046475	Bacteria	2525
271	Ga0495639_0051454	3300046475	Bacteria	1873
272	Ga0495662_0181482	3300046476	Bacteria	1037
273	Ga0495585_0208797	3300046492	Bacteria	991
274	Ga0495585_0263143	3300046492	Bacteria	857
275	Ga0495594_0028219	3300046499	Bacteria	3027
276	Ga0495594_0064465	3300046499	Bacteria	2031
277	Ga0495596_0065875	3300046500	Bacteria	1409
278	Ga0495596_0075070	3300046500	Bacteria	1313
279	Ga0495606_0000903	3300046507	Bacteria	44130
280	Ga0495610_0105999	3300046512	Bacteria	1252
281	Ga0495610_0145983	3300046512	Unclassified	1013
282	Ga0495616_0130537	3300046513	Bacteria	1152
283	Ga0495620_0097427	3300046515	Bacteria	1175
284	Ga0495631_0072995	3300046518	Bacteria	1482
285	Ga0495644_0036069	3300046523	Bacteria	1866
286	Ga0495648_0086271	3300046524	Bacteria	1771
287	Ga0495648_0202395	3300046524	Bacteria	993
288	Ga0495640_0157280	3300046533	Bacteria	1458
289	Ga0495609_0044941	3300046538	Bacteria	1980
290	Ga0495622_0132183	3300046557	Bacteria	1136
291	Ga0495656_0037223	3300046615	Bacteria	2008
292	Ga0495668_0178890	3300046616	Bacteria	1162
293	Ga0495634_0112918	3300046642	Bacteria	1746
294	Ga0495625_0001809	3300046660	Bacteria	24504
295	Ga0495625_0024193	3300046660	Bacteria	4627
296	Ga0495625_0059452	3300046660	Bacteria	2712
297	Ga0495625_0159338	3300046660	Bacteria	1513
298	Ga0495635_0142287	3300046663	Bacteria	1633
299	Ga0495659_0012271	3300046664	Bacteria	2772
300	Ga0495661_0017097	3300046665	Bacteria	4793
301	Ga0495661_0183756	3300046665	Bacteria	1106
302	Ga0495646_0144108	3300046680	Bacteria	1330
303	Ga0495658_0008531	3300046683	Bacteria	5082
304	Ga0495658_0118866	3300046683	Bacteria	1596
305	Ga0495669_0084839	3300046684	Bacteria	1457
306	Ga0495613_0005999	3300046689	Bacteria	9096
307	Ga0495624_0101728	3300046690	Bacteria	1769
308	Ga0495670_0055160	3300046691	Bacteria	1992
309	Ga0495671_0228243	3300046692	Bacteria	901
310	Ga0495649_0023140	3300046694	Bacteria	3471
311	Ga0495649_0137567	3300046694	Bacteria	1287
312	Ga0495581_0138802	3300047315	Bacteria	1417
313	Ga0495581_0255099	3300047315	Bacteria	1026
314	Ga0495674_0210941	3300047319	Bacteria	1608
315	Ga0495676_0085929	3300047321	Bacteria	2369
316	Ga0495677_0036356	3300047445	Bacteria	1799
317	Ga0495681_0132240	3300047470	Bacteria	1061
318	Ga0495686_0000013	3300047472	Bacteria	489656
319	Ga0495686_0123605	3300047472	Bacteria	1540
320	Ga0495593_0015498	3300047673	Bacteria	4316
321	Ga0495593_0072596	3300047673	Bacteria	1786
322	Ga0495615_0026962	3300048090	Bacteria	1345
323	Ga0496100_0057817	3300048903	Bacteria	2542
324	Ga0496100_0114227	3300048903	Bacteria	1881
325	Ga0496101_0060471	3300048904	Bacteria	2749
326	Ga0496101_0120763	3300048904	Bacteria	1981
327	Ga0496102_0032216	3300048905	Bacteria	4709
328	Ga0496102_0056888	3300048905	Bacteria	3569
329	Ga0496102_0069162	3300048905	Bacteria	3241
330	Ga0496102_0145034	3300048905	Bacteria	2228
331	Ga0496102_0212613	3300048905	Bacteria	1823
332	Ga0496102_0293788	3300048905	Bacteria	1532
333	Ga0496102_0334550	3300048905	Bacteria	1426
334	Ga0496103_0388564	3300048906	Bacteria	896
335	Ga0496104_0119992	3300048907	Bacteria	2525
336	Ga0496104_0155689	3300048907	Bacteria	2193
337	Ga0496105_0385956	3300048908	Bacteria	1114
338	Ga0496106_0011117	3300048909	Bacteria	6657
339	Ga0496106_0128575	3300048909	Bacteria	1985
340	Ga0496106_0140854	3300048909	Bacteria	1897
341	Ga0496106_0441147	3300048909	Bacteria	1046
342	Ga0496106_0541263	3300048909	Bacteria	934
343	Ga0496107_0026368	3300048910	Bacteria	4119
344	Ga0496107_0030984	3300048910	Bacteria	3814
345	Ga0496107_0069619	3300048910	Bacteria	2554
346	Ga0496108_0001200	3300048911	Bacteria	20310
347	Ga0496108_0519367	3300048911	Bacteria	1040
348	Ga0496109_0003922	3300048912	Bacteria	12432
349	Ga0496109_0308020	3300048912	Bacteria	1494
350	Ga0496110_0218571	3300048913	Bacteria	1733
351	Ga0496110_0289418	3300048913	Bacteria	1492
352	Ga0496112_0250273	3300048915	Bacteria	1723
353	Ga0496112_0389546	3300048915	Bacteria	1334
354	Ga0496113_0265796	3300048916	Bacteria	1371
355	Ga0496113_0413414	3300048916	Bacteria	1083
356	Ga0496114_0657001	3300048917	Bacteria	922
357	Ga0496115_0027901	3300048918	Bacteria	4420
358	Ga0496115_0035076	3300048918	Bacteria	3968
359	Ga0496115_0128425	3300048918	Bacteria	2089
360	Ga0496117_0169467	3300048920	Bacteria	1269
361	Ga0496118_0239691	3300048921	Bacteria	1039
362	Ga0496121_0078638	3300048924	Bacteria	2621
363	Ga0496121_0112308	3300048924	Bacteria	2076
364	Ga0496125_0001203	3300048928	Bacteria	38917
365	Ga0496125_0040419	3300048928	Bacteria	4002
366	Ga0496126_0013029	3300048929	Bacteria	8485
367	Ga0496126_0026642	3300048929	Bacteria	5539
368	Ga0496126_0120839	3300048929	Bacteria	2272
369	Ga0495682_0050787	3300049460	Bacteria	1509
370	Ga0501031_0288295	3300049568	Bacteria	1064
371	Ga0501032_0049685	3300049569	Bacteria	2830
372	Ga0501034_0075156	3300049571	Bacteria	3386
373	Ga0501039_0060554	3300049575	Bacteria	2932
374	Ga0501039_0207323	3300049575	Bacteria	1541
375	Ga0501042_0130089	3300049578	Bacteria	1814
376	Ga0501067_0281580	3300049583	Bacteria	926
377	Ga0501072_0113920	3300049588	Bacteria	2153
378	Ga0501076_0495285	3300049592	Bacteria	1007
379	Ga0501079_0158868	3300049741	Bacteria	1762
380	Ga0501035_0042519	3300049822	Bacteria	4098
381	nmdc:mga03683_98912_c1	3300050489	Bacteria	1280
382	nmdc:mga03n38_2842_c1	3300050490	Bacteria	5449
383	nmdc:mga00v17_133402_c1	3300050491	Unclassified	1588
384	nmdc:mga00v17_30196_c1	3300050491	Unclassified	3187
385	nmdc:mga0yw44_16666_c1	3300050492	Bacteria	3977
386	nmdc:mga0yw44_268478_c1	3300050492	Bacteria	1138
387	nmdc:mga0yw44_289388_c1	3300050492	Unclassified	1096
388	nmdc:mga0yw44_43963_c1	3300050492	Plasmid	2670
389	nmdc:mga0k408_96842_c1	3300050493	Bacteria	1737
390	nmdc:mga06z11_11035_c1	3300050494	Bacteria	3877
391	nmdc:mga06z11_36982_c1	3300050494	Bacteria	2414
392	nmdc:mga06z11_398340_c1	3300050494	Bacteria	828
393	nmdc:mga04h51_36574_c1	3300050495	Bacteria	1580
394	nmdc:mga05p37_201494_c1	3300050507	Bacteria	2410
395	nmdc:mga05p37_256241_c1	3300050507	Bacteria	2096
396	nmdc:mga05p37_576628_c1	3300050507	Bacteria	1275
397	nmdc:mga0qj67_341692_c1	3300050509	Unclassified	1211
398	nmdc:mga06r32_133350_c1	3300050510	Bacteria	2458
399	nmdc:mga06r32_161908_c1	3300050510	Bacteria	2220
400	nmdc:mga06r32_466044_c1	3300050510	Unclassified	1242
401	Ga0495619_0054293	3300053085	Bacteria	2651
402	Ga0500643_044272	3300053087	Bacteria	1294
403	Ga0500641_0005591	3300053096	Bacteria	4451
404	Ga0500641_0017892	3300053096	Bacteria	2658
405	Ga0500641_0019903	3300053096	Bacteria	2542
406	Ga0500562_004881	3300053108	Bacteria	3378
407	Ga0500562_013051	3300053108	Bacteria	2117
408	Ga0500607_063058	3300053121	Bacteria	1935
409	Ga0500652_001145	3300053131	Bacteria	8502
410	Ga0500658_0039796	3300053134	Bacteria	1880
411	Ga0500577_0000378	3300053142	Bacteria	11339
412	Ga0500586_000574	3300053145	Bacteria	7459
413	Ga0500616_0000036	3300053153	Bacteria	390769
414	Ga0500616_0002488	3300053153	Bacteria	15274
415	Ga0500616_0063653	3300053153	Bacteria	1901
416	Ga0500616_0070832	3300053153	Bacteria	1778
417	Ga0501082_0439416	3300060353	Bacteria	1140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025900	Ga0207710_10137763	Ga0207710_101377631	208
2	iso_pu_bacteria	2824696289	2824701494	213
3	iso_pu_bacteria	2849076700	2849079169	213
4	iso_pu_bacteria	2847939898	2847946712	215
5	3300013296	Ga0157374_10516437	Ga0157374_105164372	219
6	3300025916	Ga0207663_10222271	Ga0207663_102222712	219
7	3300048903	Ga0496100_0114227	Ga0496100_0114227_936_1766	219
8	3300048904	Ga0496101_0120763	Ga0496101_0120763_241_1071	219
9	3300048905	Ga0496102_0334550	Ga0496102_0334550_60_890	219
10	3300048907	Ga0496104_0155689	Ga0496104_0155689_1018_1848	219
11	3300048908	Ga0496105_0385956	Ga0496105_0385956_221_1051	219
12	3300048909	Ga0496106_0011117	Ga0496106_0011117_511_1341	219
13	3300048910	Ga0496107_0069619	Ga0496107_0069619_1182_2012	219
14	3300048911	Ga0496108_0001200	Ga0496108_0001200_8368_9198	219
15	3300048912	Ga0496109_0003922	Ga0496109_0003922_5132_5962	219
16	3300048916	Ga0496113_0413414	Ga0496113_0413414_256_1050	219
17	3300003215	JGI25153J46596_10000703	JGI25153J46596_1000070312	220
18	3300003794	Ga0055531_10004834	Ga0055531_100048347	220
19	3300005262	Ga0065165_1004197	Ga0065165_10041973	220
20	3300005327	Ga0070658_10499897	Ga0070658_104998971	220
21	3300005337	Ga0070682_100166421	Ga0070682_1001664212	220
22	3300005548	Ga0070665_100119765	Ga0070665_1001197653	220
23	3300006038	Ga0075365_10037539	Ga0075365_100375392	220
24	3300006048	Ga0075363_100025060	Ga0075363_1000250602	220
25	3300006353	Ga0075370_10011359	Ga0075370_100113593	220
26	3300009098	Ga0105245_10237560	Ga0105245_102375602	220
27	3300009101	Ga0105247_10119257	Ga0105247_101192572	220
28	3300014325	Ga0163163_10344753	Ga0163163_103447532	220
29	3300025297	Ga0209758_1000140	Ga0209758_1000140137	220
30	3300025299	Ga0209256_1002028	Ga0209256_10020288	220
31	3300025304	Ga0209257_1002350	Ga0209257_100235013	220
32	3300026067	Ga0207678_10021209	Ga0207678_100212092	220
33	3300028379	Ga0268266_10143370	Ga0268266_101433702	220
34	3300044735	Ga0466968_0095348	Ga0466968_0095348_615_1295	220
35	3300048905	Ga0496102_0212613	Ga0496102_0212613_284_1060	220
36	3300048909	Ga0496106_0541263	Ga0496106_0541263_137_913	220
37	3300048915	Ga0496112_0389546	Ga0496112_0389546_151_927	220
38	3300048916	Ga0496113_0265796	Ga0496113_0265796_378_1154	220
39	3300048917	Ga0496114_0657001	Ga0496114_0657001_26_802	220
40	3300048929	Ga0496126_0120839	Ga0496126_0120839_611_1387	220
41	3300050490	nmdc:mga03n38_2842_c1	nmdc:mga03n38_2842_c1_3044_3820	220
42	3300050494	nmdc:mga06z11_11035_c1	nmdc:mga06z11_11035_c1_2843_3619	220
43	3300053096	Ga0500641_0017892	Ga0500641_0017892_170_973	220
44	3300046660	Ga0495625_0159338	Ga0495625_0159338_118_924	221
45	3300048909	Ga0496106_0140854	Ga0496106_0140854_831_1607	221
46	3300048913	Ga0496110_0289418	Ga0496110_0289418_123_899	221
47	3300006038	Ga0075365_10171178	Ga0075365_101711782	222
48	3300006042	Ga0075368_10046577	Ga0075368_100465771	222
49	3300006051	Ga0075364_10082837	Ga0075364_100828372	222
50	3300006177	Ga0075362_10012399	Ga0075362_100123993	222
51	3300006178	Ga0075367_10035342	Ga0075367_100353423	222
52	3300027866	Ga0209813_10072617	Ga0209813_100726171	222
53	3300050489	nmdc:mga03683_98912_c1	nmdc:mga03683_98912_c1_221_1042	222
54	3300050491	nmdc:mga00v17_30196_c1	nmdc:mga00v17_30196_c1_1511_2275	222
55	3300050492	nmdc:mga0yw44_289388_c1	nmdc:mga0yw44_289388_c1_208_972	222
56	3300050494	nmdc:mga06z11_36982_c1	nmdc:mga06z11_36982_c1_963_1727	222
57	3300050495	nmdc:mga04h51_36574_c1	nmdc:mga04h51_36574_c1_738_1502	222
58	3300003322	rootL2_10113382	rootL2_101133822	223
59	3300005343	Ga0070687_100038286	Ga0070687_1000382862	223
60	3300005347	Ga0070668_100132939	Ga0070668_1001329391	223
61	3300005353	Ga0070669_100094933	Ga0070669_1000949332	223
62	3300005353	Ga0070669_100391214	Ga0070669_1003912141	223
63	3300005367	Ga0070667_100072674	Ga0070667_1000726744	223
64	3300005456	Ga0070678_100078023	Ga0070678_1000780232	223
65	3300005456	Ga0070678_100142272	Ga0070678_1001422722	223
66	3300005459	Ga0068867_100094913	Ga0068867_1000949131	223
67	3300005518	Ga0070699_100269739	Ga0070699_1002697391	223
68	3300005539	Ga0068853_100246480	Ga0068853_1002464802	223
69	3300005548	Ga0070665_100366664	Ga0070665_1003666641	223
70	3300005548	Ga0070665_100423184	Ga0070665_1004231842	223
71	3300005549	Ga0070704_100265120	Ga0070704_1002651202	223
72	3300005578	Ga0068854_100083307	Ga0068854_1000833072	223
73	3300005615	Ga0070702_100016652	Ga0070702_1000166525	223
74	3300005718	Ga0068866_10041919	Ga0068866_100419192	223
75	3300005719	Ga0068861_100162636	Ga0068861_1001626362	223
76	3300005719	Ga0068861_100376096	Ga0068861_1003760962	223
77	3300005840	Ga0068870_10054031	Ga0068870_100540315	223
78	3300005843	Ga0068860_100081532	Ga0068860_1000815324	223
79	3300005937	Ga0081455_10012953	Ga0081455_100129534	223
80	3300006881	Ga0068865_100004347	Ga0068865_1000043476	223
81	3300009092	Ga0105250_10067158	Ga0105250_100671582	223
82	3300009094	Ga0111539_10649828	Ga0111539_106498282	223
83	3300009098	Ga0105245_10068840	Ga0105245_100688403	223
84	3300009098	Ga0105245_10453838	Ga0105245_104538382	223
85	3300009551	Ga0105238_10124884	Ga0105238_101248842	223
86	3300009553	Ga0105249_10067607	Ga0105249_100676072	223
87	3300013306	Ga0163162_10135158	Ga0163162_101351582	223
88	3300013306	Ga0163162_10623281	Ga0163162_106232812	223
89	3300013306	Ga0163162_10636267	Ga0163162_106362671	223
90	3300014326	Ga0157380_10312590	Ga0157380_103125902	223
91	3300014326	Ga0157380_10339838	Ga0157380_103398382	223
92	3300014326	Ga0157380_10581605	Ga0157380_105816052	223
93	3300017792	Ga0163161_10085342	Ga0163161_100853422	223
94	3300025893	Ga0207682_10086946	Ga0207682_100869462	223
95	3300025899	Ga0207642_10011521	Ga0207642_100115213	223
96	3300025908	Ga0207643_10126624	Ga0207643_101266242	223
97	3300025918	Ga0207662_10044481	Ga0207662_100444812	223
98	3300025924	Ga0207694_10231407	Ga0207694_102314072	223
99	3300025933	Ga0207706_10027152	Ga0207706_100271523	223
100	3300025933	Ga0207706_10029379	Ga0207706_100293792	223
101	3300025940	Ga0207691_10013516	Ga0207691_100135165	223
102	3300025942	Ga0207689_10025703	Ga0207689_100257034	223
103	3300025961	Ga0207712_10035509	Ga0207712_100355092	223
104	3300025981	Ga0207640_10045787	Ga0207640_100457872	223
105	3300026023	Ga0207677_10027440	Ga0207677_100274404	223
106	3300026041	Ga0207639_10169530	Ga0207639_101695302	223
107	3300026067	Ga0207678_10014065	Ga0207678_100140654	223
108	3300026067	Ga0207678_10084356	Ga0207678_100843562	223
109	3300026075	Ga0207708_10060639	Ga0207708_100606393	223
110	3300026089	Ga0207648_10010726	Ga0207648_100107265	223
111	3300026118	Ga0207675_100031707	Ga0207675_1000317074	223
112	3300026118	Ga0207675_100186034	Ga0207675_1001860342	223
113	3300026121	Ga0207683_10063932	Ga0207683_100639322	223
114	3300026121	Ga0207683_10174913	Ga0207683_101749132	223
115	3300026142	Ga0207698_10040306	Ga0207698_100403061	223
116	3300028379	Ga0268266_10256099	Ga0268266_102560991	223
117	3300028379	Ga0268266_10631075	Ga0268266_106310751	223
118	3300047445	Ga0495677_0036356	Ga0495677_0036356_561_1355	223
119	3300048905	Ga0496102_0056888	Ga0496102_0056888_2622_3416	223
120	3300048905	Ga0496102_0145034	Ga0496102_0145034_1264_2070	223
121	3300048906	Ga0496103_0388564	Ga0496103_0388564_78_872	223
122	3300048907	Ga0496104_0119992	Ga0496104_0119992_1391_2197	223
123	3300048918	Ga0496115_0128425	Ga0496115_0128425_713_1507	223
124	3300049741	Ga0501079_0158868	Ga0501079_0158868_348_1151	223
125	3300053096	Ga0500641_0005591	Ga0500641_0005591_1819_2625	223
126	3300047673	Ga0495593_0015498	Ga0495593_0015498_2054_2935	224
127	3300048910	Ga0496107_0026368	Ga0496107_0026368_3135_3929	224
128	3300003215	JGI25153J46596_10004919	JGI25153J46596_100049193	225
129	3300025297	Ga0209758_1017704	Ga0209758_10177042	225
130	3300042157	Ga0439458_0004268	Ga0439458_0004268_1436_2242	225
131	3300050507	nmdc:mga05p37_256241_c1	nmdc:mga05p37_256241_c1_596_1360	225
132	3300050509	nmdc:mga0qj67_341692_c1	nmdc:mga0qj67_341692_c1_392_1156	225
133	3300050510	nmdc:mga06r32_161908_c1	nmdc:mga06r32_161908_c1_334_1098	225
134	3300005336	Ga0070680_100022165	Ga0070680_1000221651	226
135	3300005337	Ga0070682_100498859	Ga0070682_1004988591	226
136	3300005347	Ga0070668_100055140	Ga0070668_1000551403	226
137	3300005441	Ga0070700_100332209	Ga0070700_1003322091	226
138	3300005455	Ga0070663_100201170	Ga0070663_1002011702	226
139	3300005456	Ga0070678_100164067	Ga0070678_1001640672	226
140	3300005457	Ga0070662_100041912	Ga0070662_1000419121	226
141	3300005458	Ga0070681_10023400	Ga0070681_100234009	226
142	3300005530	Ga0070679_100347652	Ga0070679_1003476521	226
143	3300005536	Ga0070697_100348268	Ga0070697_1003482681	226
144	3300005546	Ga0070696_100074679	Ga0070696_1000746792	226
145	3300005844	Ga0068862_100214149	Ga0068862_1002141492	226
146	3300006038	Ga0075365_10178371	Ga0075365_101783712	226
147	3300006881	Ga0068865_100395353	Ga0068865_1003953531	226
148	3300009098	Ga0105245_10004015	Ga0105245_1000401518	226
149	3300009176	Ga0105242_10048044	Ga0105242_100480443	226
150	3300013297	Ga0157378_10011054	Ga0157378_100110545	226
151	3300014968	Ga0157379_10685361	Ga0157379_106853611	226
152	3300014969	Ga0157376_10270962	Ga0157376_102709622	226
153	3300025912	Ga0207707_10046127	Ga0207707_100461273	226
154	3300025919	Ga0207657_10036516	Ga0207657_100365163	226
155	3300025921	Ga0207652_10055889	Ga0207652_100558891	226
156	3300025933	Ga0207706_10066608	Ga0207706_100666084	226
157	3300025934	Ga0207686_10012991	Ga0207686_100129912	226
158	3300025938	Ga0207704_10579368	Ga0207704_105793681	226
159	3300025972	Ga0207668_10229001	Ga0207668_102290012	226
160	3300026067	Ga0207678_10011242	Ga0207678_100112429	226
161	3300026067	Ga0207678_10156416	Ga0207678_101564162	226
162	3300026121	Ga0207683_10048458	Ga0207683_100484587	226
163	3300031911	Ga0307412_10116224	Ga0307412_101162242	226
164	3300035691	Ga0373931_0012556	Ga0373931_0012556_1718_2527	226
165	3300048904	Ga0496101_0060471	Ga0496101_0060471_749_1558	226
166	3300048905	Ga0496102_0032216	Ga0496102_0032216_1048_1857	226
167	3300048909	Ga0496106_0128575	Ga0496106_0128575_1098_1907	226
168	3300048910	Ga0496107_0030984	Ga0496107_0030984_343_1152	226
169	3300048918	Ga0496115_0027901	Ga0496115_0027901_928_1737	226
170	3300053108	Ga0500562_013051	Ga0500562_013051_122_967	226
171	3300053153	Ga0500616_0000036	Ga0500616_0000036_381466_382311	226
172	3300005347	Ga0070668_100452108	Ga0070668_1004521081	227
173	3300005548	Ga0070665_100029095	Ga0070665_1000290955	227
174	3300005548	Ga0070665_100088317	Ga0070665_1000883173	227
175	3300005548	Ga0070665_100608800	Ga0070665_1006088001	227
176	3300006844	Ga0075428_100475264	Ga0075428_1004752642	227
177	3300009147	Ga0114129_10496696	Ga0114129_104966962	227
178	3300014968	Ga0157379_10091724	Ga0157379_100917243	227
179	3300028379	Ga0268266_10066199	Ga0268266_100661993	227
180	3300028379	Ga0268266_10137830	Ga0268266_101378302	227
181	3300050507	nmdc:mga05p37_201494_c1	nmdc:mga05p37_201494_c1_288_1067	227
182	3300050510	nmdc:mga06r32_466044_c1	nmdc:mga06r32_466044_c1_28_807	227
183	3300006186	Ga0075369_10102051	Ga0075369_101020512	228
184	3300009094	Ga0111539_10084388	Ga0111539_100843881	228
185	3300046492	Ga0495585_0208797	Ga0495585_0208797_13_819	228
186	3300046513	Ga0495616_0130537	Ga0495616_0130537_61_864	228
187	3300005457	Ga0070662_100004117	Ga0070662_1000041172	229
188	3300007076	Ga0075435_100152784	Ga0075435_1001527843	229
189	3300011119	Ga0105246_10617121	Ga0105246_106171211	229
190	3300035121	Ga0373960_0030425	Ga0373960_0030425_446_1255	229
191	3300035171	Ga0373946_0026613	Ga0373946_0026613_1127_1936	229
192	3300035692	Ga0373935_0048326	Ga0373935_0048326_723_1532	229
193	3300037068	Ga0373925_0032199	Ga0373925_0032199_1209_2018	229
194	3300046459	Ga0495629_0006842	Ga0495629_0006842_5536_6345	229
195	3300046473	Ga0495582_0010966	Ga0495582_0010966_2107_2916	229
196	3300046499	Ga0495594_0064465	Ga0495594_0064465_598_1407	229
197	3300046683	Ga0495658_0008531	Ga0495658_0008531_2895_3704	229
198	3300046689	Ga0495613_0005999	Ga0495613_0005999_6941_7750	229
199	3300048911	Ga0496108_0519367	Ga0496108_0519367_54_863	229
200	3300053085	Ga0495619_0054293	Ga0495619_0054293_612_1421	229
201	3300005334	Ga0068869_100019026	Ga0068869_1000190263	230
202	3300005347	Ga0070668_100025351	Ga0070668_1000253513	230
203	3300005347	Ga0070668_100063510	Ga0070668_1000635103	230
204	3300005347	Ga0070668_100341187	Ga0070668_1003411872	230
205	3300005356	Ga0070674_100218409	Ga0070674_1002184092	230
206	3300005356	Ga0070674_100589632	Ga0070674_1005896321	230
207	3300005438	Ga0070701_10149865	Ga0070701_101498651	230
208	3300005456	Ga0070678_100057226	Ga0070678_1000572262	230
209	3300005548	Ga0070665_100208593	Ga0070665_1002085932	230
210	3300005617	Ga0068859_100026003	Ga0068859_1000260035	230
211	3300005719	Ga0068861_100091001	Ga0068861_1000910012	230
212	3300005719	Ga0068861_100348834	Ga0068861_1003488342	230
213	3300005840	Ga0068870_10224909	Ga0068870_102249092	230
214	3300005843	Ga0068860_100064619	Ga0068860_1000646194	230
215	3300005844	Ga0068862_100047142	Ga0068862_1000471422	230
216	3300005844	Ga0068862_100081382	Ga0068862_1000813822	230
217	3300005844	Ga0068862_100099275	Ga0068862_1000992753	230
218	3300006844	Ga0075428_100217122	Ga0075428_1002171222	230
219	3300006931	Ga0097620_100026006	Ga0097620_1000260065	230
220	3300009094	Ga0111539_10417720	Ga0111539_104177202	230
221	3300009101	Ga0105247_10263119	Ga0105247_102631191	230
222	3300009147	Ga0114129_10165922	Ga0114129_101659222	230
223	3300009148	Ga0105243_10160096	Ga0105243_101600962	230
224	3300009177	Ga0105248_10520662	Ga0105248_105206622	230
225	3300011119	Ga0105246_10164114	Ga0105246_101641142	230
226	3300011119	Ga0105246_10233375	Ga0105246_102333752	230
227	3300013308	Ga0157375_10339669	Ga0157375_103396692	230
228	3300014325	Ga0163163_10959077	Ga0163163_109590771	230
229	3300014969	Ga0157376_10314146	Ga0157376_103141462	230
230	3300025901	Ga0207688_10130964	Ga0207688_101309642	230
231	3300025933	Ga0207706_10063273	Ga0207706_100632732	230
232	3300025935	Ga0207709_10036047	Ga0207709_100360472	230
233	3300025937	Ga0207669_10489214	Ga0207669_104892142	230
234	3300025940	Ga0207691_10163515	Ga0207691_101635152	230
235	3300025942	Ga0207689_10012148	Ga0207689_100121483	230
236	3300025942	Ga0207689_10239478	Ga0207689_102394781	230
237	3300025972	Ga0207668_10343027	Ga0207668_103430272	230
238	3300025972	Ga0207668_10383071	Ga0207668_103830711	230
239	3300026023	Ga0207677_10060072	Ga0207677_100600723	230
240	3300026067	Ga0207678_10273009	Ga0207678_102730092	230
241	3300026075	Ga0207708_10171012	Ga0207708_101710122	230
242	3300026118	Ga0207675_100228575	Ga0207675_1002285752	230
243	3300027907	Ga0207428_10124214	Ga0207428_101242142	230
244	3300028379	Ga0268266_10027379	Ga0268266_100273792	230
245	3300028380	Ga0268265_10254158	Ga0268265_102541581	230
246	3300028381	Ga0268264_10054016	Ga0268264_100540162	230
247	3300028786	Ga0307517_10057283	Ga0307517_100572832	230
248	3300031730	Ga0307516_10071747	Ga0307516_100717473	230
249	3300041453	Ga0451797_0244539	Ga0451797_0244539_11_817	230
250	3300041486	Ga0451807_2326971	Ga0451807_2326971_347_1153	230
251	3300046455	Ga0495603_0050930	Ga0495603_0050930_1005_1811	230
252	3300046455	Ga0495603_0140100	Ga0495603_0140100_415_1221	230
253	3300046475	Ga0495639_0051454	Ga0495639_0051454_435_1241	230
254	3300046492	Ga0495585_0263143	Ga0495585_0263143_27_833	230
255	3300046500	Ga0495596_0075070	Ga0495596_0075070_253_1059	230
256	3300046518	Ga0495631_0072995	Ga0495631_0072995_112_918	230
257	3300046523	Ga0495644_0036069	Ga0495644_0036069_10_816	230
258	3300046615	Ga0495656_0037223	Ga0495656_0037223_862_1668	230
259	3300046664	Ga0495659_0012271	Ga0495659_0012271_1244_2050	230
260	3300046665	Ga0495661_0183756	Ga0495661_0183756_86_892	230
261	3300046691	Ga0495670_0055160	Ga0495670_0055160_904_1710	230
262	3300046694	Ga0495649_0023140	Ga0495649_0023140_1788_2594	230
263	3300047315	Ga0495581_0255099	Ga0495581_0255099_33_839	230
264	3300047470	Ga0495681_0132240	Ga0495681_0132240_206_1012	230
265	3300047472	Ga0495686_0123605	Ga0495686_0123605_564_1370	230
266	3300048090	Ga0495615_0026962	Ga0495615_0026962_14_820	230
267	3300048921	Ga0496118_0239691	Ga0496118_0239691_21_827	230
268	3300048924	Ga0496121_0078638	Ga0496121_0078638_1726_2532	230
269	3300048928	Ga0496125_0040419	Ga0496125_0040419_1422_2228	230
270	3300048929	Ga0496126_0026642	Ga0496126_0026642_1571_2377	230
271	3300013307	Ga0157372_10874084	Ga0157372_108740841	231
272	3300026067	Ga0207678_10100497	Ga0207678_101004973	231
273	3300053142	Ga0500577_0000378	Ga0500577_0000378_5104_5880	231
274	3300045051	Ga0451576_0096917	Ga0451576_0096917_2108_2863	232
275	3300046500	Ga0495596_0065875	Ga0495596_0065875_363_1169	232
276	3300046524	Ga0495648_0202395	Ga0495648_0202395_125_931	232
277	3300046660	Ga0495625_0059452	Ga0495625_0059452_152_958	232
278	3300046692	Ga0495671_0228243	Ga0495671_0228243_52_858	232
279	3300046694	Ga0495649_0137567	Ga0495649_0137567_194_1000	232
280	3300048905	Ga0496102_0293788	Ga0496102_0293788_446_1252	232
281	3300049460	Ga0495682_0050787	Ga0495682_0050787_623_1429	232
282	3300053134	Ga0500658_0039796	Ga0500658_0039796_623_1429	232
283	3300025297	Ga0209758_1025749	Ga0209758_10257493	234
284	3300005548	Ga0070665_100183221	Ga0070665_1001832212	236
285	3300025912	Ga0207707_10001429	Ga0207707_1000142922	236
286	3300036647	Ga0316582_0000859	Ga0316582_0000859_10439_11176	238
287	3300036647	Ga0316582_0152131	Ga0316582_0152131_35_796	238
288	3300007788	Ga0099795_10002852	Ga0099795_100028523	239
289	3300010159	Ga0099796_10031571	Ga0099796_100315712	239
290	3300027512	Ga0209179_1001150	Ga0209179_10011503	239
291	3300046507	Ga0495606_0000903	Ga0495606_0000903_1894_2670	239
292	3300049569	Ga0501032_0049685	Ga0501032_0049685_1427_2203	239
293	3300049578	Ga0501042_0130089	Ga0501042_0130089_381_1157	240
294	3300049592	Ga0501076_0495285	Ga0501076_0495285_24_764	240
295	3300003659	JGI25404J52841_10000420	JGI25404J52841_100004204	241
296	3300053096	Ga0500641_0019903	Ga0500641_0019903_20_823	241
297	3300003322	rootL2_10338969	rootL2_103389692	242
298	3300005983	Ga0081540_1006401	Ga0081540_10064016	242
299	3300026067	Ga0207678_10031040	Ga0207678_100310404	242
300	3300046512	Ga0495610_0105999	Ga0495610_0105999_102_917	242
301	3300048920	Ga0496117_0169467	Ga0496117_0169467_412_1227	242
302	3300048924	Ga0496121_0112308	Ga0496121_0112308_86_901	242
303	3300048928	Ga0496125_0001203	Ga0496125_0001203_26427_27242	242
304	3300048929	Ga0496126_0013029	Ga0496126_0013029_6761_7576	242
305	3300053121	Ga0500607_063058	Ga0500607_063058_424_1239	242
306	3300053145	Ga0500586_000574	Ga0500586_000574_5727_6542	242
307	3300046460	Ga0495638_0000150	Ga0495638_0000150_31442_32257	243
308	3300046515	Ga0495620_0097427	Ga0495620_0097427_348_1163	243
309	3300046660	Ga0495625_0024193	Ga0495625_0024193_1174_1989	243
310	3300046665	Ga0495661_0017097	Ga0495661_0017097_3281_4096	243
311	3300053087	Ga0500643_044272	Ga0500643_044272_402_1217	243
312	3300053108	Ga0500562_004881	Ga0500562_004881_1953_2768	243
313	3300053131	Ga0500652_001145	Ga0500652_001145_2831_3646	243
314	iso_pu_bacteria	2840878972	2840882693	243
315	iso_pu_bacteria	2861691609	2861695749	243
316	3300049571	Ga0501034_0075156	Ga0501034_0075156_1235_2044	244
317	3300049588	Ga0501072_0113920	Ga0501072_0113920_332_1141	244
318	iso_pu_bacteria	2791355048	2792460865	244
319	iso_pu_bacteria	2843744320	2843745475	244
320	iso_pu_bacteria	2849573788	2849578553	244
321	iso_pu_bacteria	2851153111	2851157124	244
322	3300005366	Ga0070659_100297076	Ga0070659_1002970762	246
323	3300005455	Ga0070663_100098802	Ga0070663_1000988022	246
324	3300005455	Ga0070663_100463718	Ga0070663_1004637181	246
325	3300006038	Ga0075365_10242126	Ga0075365_102421262	246
326	3300031548	Ga0307408_100061913	Ga0307408_1000619134	246
327	3300031730	Ga0307516_10316716	Ga0307516_103167162	246
328	3300031911	Ga0307412_10170044	Ga0307412_101700442	246
329	3300032002	Ga0307416_100110595	Ga0307416_1001105952	246
330	3300046660	Ga0495625_0001809	Ga0495625_0001809_20420_21235	246
331	3300049568	Ga0501031_0288295	Ga0501031_0288295_196_957	246
332	3300049575	Ga0501039_0060554	Ga0501039_0060554_730_1491	246
333	3300049822	Ga0501035_0042519	Ga0501035_0042519_1163_1924	246
334	3300050492	nmdc:mga0yw44_268478_c1	nmdc:mga0yw44_268478_c1_203_991	246
335	3300050494	nmdc:mga06z11_398340_c1	nmdc:mga06z11_398340_c1_13_789	246
336	3300053153	Ga0500616_0002488	Ga0500616_0002488_12166_12954	246
337	iso_pu_bacteria	2595698237	2596375236	246
338	iso_pu_bacteria	2902405164	2902407546	246
339	iso_pu_bacteria	2928125067	2928126553	246
340	iso_pu_bacteria	3003665799	3003672513	246
341	3300003323	rootH1_10270102	rootH1_102701021	247
342	3300027665	Ga0209983_1036254	Ga0209983_10362541	247
343	3300031548	Ga0307408_100355376	Ga0307408_1003553762	247
344	3300031691	Ga0316579_10053303	Ga0316579_100533033	247
345	3300032002	Ga0307416_100256404	Ga0307416_1002564043	247
346	3300035111	Ga0373923_0043350	Ga0373923_0043350_1036_1812	247
347	3300046455	Ga0495603_0095020	Ga0495603_0095020_143_919	247
348	3300046459	Ga0495629_0188132	Ga0495629_0188132_242_1018	247
349	3300046461	Ga0495641_0044684	Ga0495641_0044684_1195_1971	247
350	3300046472	Ga0495580_0165364	Ga0495580_0165364_468_1244	247
351	3300046473	Ga0495582_0084691	Ga0495582_0084691_439_1215	247
352	3300046475	Ga0495639_0027324	Ga0495639_0027324_348_1124	247
353	3300046476	Ga0495662_0181482	Ga0495662_0181482_111_887	247
354	3300046499	Ga0495594_0028219	Ga0495594_0028219_1979_2755	247
355	3300046512	Ga0495610_0145983	Ga0495610_0145983_197_967	247
356	3300046524	Ga0495648_0086271	Ga0495648_0086271_340_1152	247
357	3300046533	Ga0495640_0157280	Ga0495640_0157280_170_946	247
358	3300046538	Ga0495609_0044941	Ga0495609_0044941_1066_1869	247
359	3300046557	Ga0495622_0132183	Ga0495622_0132183_332_1108	247
360	3300046663	Ga0495635_0142287	Ga0495635_0142287_66_842	247
361	3300046680	Ga0495646_0144108	Ga0495646_0144108_425_1201	247
362	3300046683	Ga0495658_0118866	Ga0495658_0118866_292_1068	247
363	3300046690	Ga0495624_0101728	Ga0495624_0101728_605_1381	247
364	3300047315	Ga0495581_0138802	Ga0495581_0138802_236_1012	247
365	3300047319	Ga0495674_0210941	Ga0495674_0210941_682_1458	247
366	3300047321	Ga0495676_0085929	Ga0495676_0085929_169_945	247
367	3300047472	Ga0495686_0000013	Ga0495686_0000013_339324_340139	247
368	3300047673	Ga0495593_0072596	Ga0495593_0072596_151_927	247
369	3300049583	Ga0501067_0281580	Ga0501067_0281580_16_798	247
370	iso_pu_bacteria	2849560528	2849561088	247
371	3300013296	Ga0157374_10063432	Ga0157374_100634324	248
372	3300031691	Ga0316579_10030348	Ga0316579_100303482	248
373	3300032133	Ga0316583_10002192	Ga0316583_100021923	248
374	3300036712	Ga0316584_0089973	Ga0316584_0089973_467_1234	248
375	3300048918	Ga0496115_0035076	Ga0496115_0035076_1298_2092	248
376	iso_pu_bacteria	2513237101	2513696481	248
377	iso_pu_bacteria	2513237139	2513872913	248
378	iso_pu_bacteria	2617270735	2617347371	248
379	iso_pu_bacteria	2721755755	2723842987	248
380	iso_pu_bacteria	2791355199	2793082458	248
381	iso_pu_bacteria	2802429603	2805915189	248
382	iso_pu_bacteria	2824773399	2824780879	248
383	iso_pu_bacteria	2857509624	2857514162	248
384	iso_pu_bacteria	2874604998	2874606358	248
385	iso_pu_bacteria	2889033259	2889033716	248
386	iso_pu_bacteria	2922386360	2922390145	248
387	iso_pu_bacteria	3005506211	3005510472	248
388	iso_pu_bacteria	8006964411	8006966615	248
389	iso_pu_bacteria	8006994254	8006997926	248
390	3300005327	Ga0070658_10109157	Ga0070658_101091573	249
391	3300025909	Ga0207705_10084954	Ga0207705_100849542	249
392	3300048903	Ga0496100_0057817	Ga0496100_0057817_948_1760	249
393	3300053153	Ga0500616_0063653	Ga0500616_0063653_256_1032	249
394	3300005535	Ga0070684_100524671	Ga0070684_1005246711	250
395	3300005548	Ga0070665_100461335	Ga0070665_1004613351	250
396	3300005564	Ga0070664_100551324	Ga0070664_1005513241	250
397	3300006038	Ga0075365_10003516	Ga0075365_100035164	250
398	3300006048	Ga0075363_100220975	Ga0075363_1002209752	250
399	3300006051	Ga0075364_10122698	Ga0075364_101226981	250
400	3300006844	Ga0075428_100047973	Ga0075428_1000479733	250
401	3300011119	Ga0105246_10464767	Ga0105246_104647672	250
402	3300013308	Ga0157375_10511036	Ga0157375_105110362	250
403	3300026067	Ga0207678_10264040	Ga0207678_102640402	250
404	3300046616	Ga0495668_0178890	Ga0495668_0178890_40_885	250
405	3300046684	Ga0495669_0084839	Ga0495669_0084839_67_912	250
406	3300048909	Ga0496106_0441147	Ga0496106_0441147_142_987	250
407	3300048912	Ga0496109_0308020	Ga0496109_0308020_433_1278	250
408	3300048913	Ga0496110_0218571	Ga0496110_0218571_192_1037	250
409	3300048915	Ga0496112_0250273	Ga0496112_0250273_857_1702	250
410	3300050491	nmdc:mga00v17_133402_c1	nmdc:mga00v17_133402_c1_55_993	250
411	3300050492	nmdc:mga0yw44_16666_c1	nmdc:mga0yw44_16666_c1_1176_2021	250
412	3300050492	nmdc:mga0yw44_43963_c1	nmdc:mga0yw44_43963_c1_1311_2249	250
413	3300050493	nmdc:mga0k408_96842_c1	nmdc:mga0k408_96842_c1_507_1352	250
414	iso_pu_bacteria	2829745981	2829748386	250
415	iso_pu_bacteria	3003665799	3003672152	250
416	3300036647	Ga0316582_0086236	Ga0316582_0086236_287_1075	251
417	3300053153	Ga0500616_0070832	Ga0500616_0070832_508_1302	251
418	iso_pu_bacteria	2857524615	2857529811	251
419	3300003203	JGI25406J46586_10005123	JGI25406J46586_100051236	252
420	3300005262	Ga0065165_1005620	Ga0065165_10056204	252
421	3300005347	Ga0070668_100011610	Ga0070668_1000116108	252
422	3300005355	Ga0070671_100408620	Ga0070671_1004086202	252
423	3300005457	Ga0070662_100269699	Ga0070662_1002696993	252
424	3300005985	Ga0081539_10000737	Ga0081539_100007372	252
425	3300006178	Ga0075367_10089796	Ga0075367_100897963	252
426	3300006844	Ga0075428_100788626	Ga0075428_1007886261	252
427	3300006846	Ga0075430_100136898	Ga0075430_1001368982	252
428	3300006847	Ga0075431_100570145	Ga0075431_1005701451	252
429	3300014325	Ga0163163_10202658	Ga0163163_102026583	252
430	3300025254	Ga0209148_1000462	Ga0209148_100046213	252
431	3300025272	Ga0209455_1000870	Ga0209455_100087013	252
432	3300025916	Ga0207663_10025281	Ga0207663_100252812	252
433	3300025928	Ga0207700_10483640	Ga0207700_104836402	252
434	3300031548	Ga0307408_100105705	Ga0307408_1001057052	252
435	3300031731	Ga0307405_10022480	Ga0307405_100224802	252
436	3300031824	Ga0307413_10085861	Ga0307413_100858611	252
437	3300031911	Ga0307412_10031710	Ga0307412_100317102	252
438	3300031995	Ga0307409_100676868	Ga0307409_1006768681	252
439	3300032004	Ga0307414_10370567	Ga0307414_103705672	252
440	3300035691	Ga0373931_0112332	Ga0373931_0112332_667_1512	252
441	3300035692	Ga0373935_0010119	Ga0373935_0010119_4290_5150	252
442	3300035695	Ga0373927_0027596	Ga0373927_0027596_939_1799	252
443	3300046642	Ga0495634_0112918	Ga0495634_0112918_317_1177	252
444	3300048905	Ga0496102_0069162	Ga0496102_0069162_2212_3117	252
445	3300049575	Ga0501039_0207323	Ga0501039_0207323_603_1493	252
446	3300050507	nmdc:mga05p37_576628_c1	nmdc:mga05p37_576628_c1_357_1160	252
447	3300050510	nmdc:mga06r32_133350_c1	nmdc:mga06r32_133350_c1_1099_1896	252
448	3300060353	Ga0501082_0439416	Ga0501082_0439416_221_1054	252
449	iso_pu_bacteria	2513237161	2514013672	252
450	iso_pu_bacteria	2824600985	2824602900	252
451	iso_pu_bacteria	2824609381	2824611877	252
452	iso_pu_bacteria	2824653114	2824660931	252
453	iso_pu_bacteria	2824746037	2824752328	252
454	iso_pu_bacteria	2885366525	2885373011	252
455	iso_pu_bacteria	2888419890	2888425712	252
456	iso_pu_bacteria	2922393267	2922400651	252
457	iso_pu_bacteria	8006984368	8006989459	252
458	iso_pu_bacteria	8056673599	8056674954	252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00520

Ion_trans

Ion transport protein

170

254

0.87 PF07885

Ion_trans_2

Ion channel

176

252

0.82 Feature Viewer

pLDDT	pTM	Quality
70.65	0.44	Low

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448116

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00520

Ion_trans

Ion transport protein

170

254

0.87

PF07885

Ion_trans_2

Ion channel

176

252

0.82

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map