F448075

General Info

Members Datasets Scaffolds Average Seq Length
457 220 914 342

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0119370|Ga0501040_0119370_406_1488
Length 360
Sequence MDLQILWFCLIAVLWGGYLVLEGFDFGVGMLLPFLPRDERERGAMFQTIGPVWDGNEVWLVVAAGATFAAFPAWYGTMFSGFYLALLLILFFLIVRVVSFEWRDKGEGTRWRRVWLWANAIGSTGIALVWGIGLSNLLHGVPLASDGAYAGSFWDLFSPYTVLGGVAFVLVFAFHGASYLTLRTTGDLCARARRAARALAIPAVVVGGGYLLWTVAVAVDRNDKDVFPPVLPAAVAIAAFVAAAILIYAGRSGLAFALSVVGTLSLVATLFTSLYPRVMVSSPDFGNSLTVQGAASAHYTLAVMSVVALVVLPLVLLYQGWTYYVFRARVTGGQVRSPADVLTRAADAVDVDAPGSSTTT

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 16.63
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0119370 3300049576 Bacteria 1849
2 JGI25407J50210_10008994 3300003373 Bacteria 2523
3 JGI25407J50210_10028105 3300003373 Bacteria 1459
4 Ga0070683_100215633 3300005329 Bacteria 1824
5 Ga0070670_100043461 3300005331 Bacteria 3862
6 Ga0070680_100188920 3300005336 Bacteria 1735
7 Ga0070682_100068475 3300005337 Bacteria 2264
8 Ga0070691_10005490 3300005341 Bacteria 5767
9 Ga0070691_10036614 3300005341 Bacteria 2313
10 Ga0070668_100065189 3300005347 Bacteria 2825
11 Ga0070675_100260012 3300005354 Bacteria 1521
12 Ga0070671_100169981 3300005355 Bacteria 1844
13 Ga0070673_100156882 3300005364 Bacteria 1932
14 Ga0070688_100027003 3300005365 Bacteria 3417
15 Ga0070709_10108925 3300005434 Bacteria 1859
16 Ga0070713_100074099 3300005436 Bacteria 2883
17 Ga0070713_100246334 3300005436 Bacteria 1629
18 Ga0070711_100084162 3300005439 Bacteria 2275
19 Ga0070700_100140853 3300005441 Bacteria 1639
20 Ga0070700_100214515 3300005441 Bacteria 1360
21 Ga0070708_100031575 3300005445 Bacteria 4586
22 Ga0070663_100066785 3300005455 Bacteria 2607
23 Ga0070678_100008330 3300005456 Bacteria 6208
24 Ga0070678_100326513 3300005456 Bacteria 1312
25 Ga0070681_10015967 3300005458 Bacteria 7488
26 Ga0070681_10134721 3300005458 Bacteria 2401
27 Ga0068867_100086990 3300005459 Bacteria 2365
28 Ga0070685_10007555 3300005466 Bacteria 5563
29 Ga0070706_100095411 3300005467 Bacteria 2761
30 Ga0070698_100002946 3300005471 Bacteria 18725
31 Ga0070679_100027514 3300005530 Bacteria 5597
32 Ga0070679_100048358 3300005530 Bacteria 4238
33 Ga0070684_100002563 3300005535 Bacteria 13421
34 Ga0070684_100027838 3300005535 Bacteria 4774
35 Ga0070684_100033636 3300005535 Bacteria 4378
36 Ga0070684_100209451 3300005535 Bacteria 1777
37 Ga0070686_100114626 3300005544 Bacteria 1842
38 Ga0070686_100134607 3300005544 Bacteria 1713
39 Ga0070686_100213705 3300005544 Bacteria 1390
40 Ga0070696_100020947 3300005546 Bacteria 4431
41 Ga0070693_100044736 3300005547 Bacteria 2506
42 Ga0070704_100095942 3300005549 Bacteria 2222
43 Ga0068855_100344012 3300005563 Bacteria 1644
44 Ga0070664_100017199 3300005564 Bacteria 5936
45 Ga0070664_100190019 3300005564 Bacteria 1829
46 Ga0068857_100025204 3300005577 Bacteria 5237
47 Ga0068857_100342669 3300005577 Bacteria 1383
48 Ga0068854_100129452 3300005578 Bacteria 1925
49 Ga0068856_100006126 3300005614 Bacteria 11803
50 Ga0068856_100076831 3300005614 Bacteria 3308
51 Ga0070702_100066070 3300005615 Bacteria 2120
52 Ga0068864_100107870 3300005618 Bacteria 2477
53 Ga0068861_100007504 3300005719 Bacteria 7476
54 Ga0068861_100273376 3300005719 Bacteria 1452
55 Ga0068870_10075856 3300005840 Bacteria 1845
56 Ga0068863_100277525 3300005841 Bacteria 1623
57 Ga0068863_100314731 3300005841 Bacteria 1520
58 Ga0081455_10009985 3300005937 Bacteria 9705
59 Ga0081455_10011733 3300005937 Bacteria 8782
60 Ga0081455_10041601 3300005937 Bacteria 4039
61 Ga0081455_10043714 3300005937 Bacteria 3915
62 Ga0081455_10076170 3300005937 Bacteria 2764
63 Ga0081455_10189282 3300005937 Bacteria 1551
64 Ga0081538_10000062 3300005981 Bacteria 100500
65 Ga0081538_10000183 3300005981 Bacteria 68671
66 Ga0070717_10015352 3300006028 Bacteria 5914
67 Ga0070717_10083856 3300006028 Bacteria 2681
68 Ga0075365_10075156 3300006038 Bacteria 2280
69 Ga0075432_10002690 3300006058 Bacteria 5941
70 Ga0070715_10072328 3300006163 Bacteria 1543
71 Ga0070715_10158267 3300006163 Bacteria 1117
72 Ga0070712_100011405 3300006175 Bacteria 5634
73 Ga0075428_100132378 3300006844 Bacteria 2712
74 Ga0075431_100105311 3300006847 Bacteria 2911
75 Ga0075431_100169586 3300006847 Bacteria 2243
76 Ga0075433_10119189 3300006852 Bacteria 2342
77 Ga0075433_10138756 3300006852 Bacteria 2161
78 Ga0075434_100012319 3300006871 Bacteria 8101
79 Ga0075434_100130619 3300006871 Bacteria 2530
80 Ga0075429_100102553 3300006880 Bacteria 2498
81 Ga0068865_100057866 3300006881 Bacteria 2706
82 Ga0075436_100012378 3300006914 Bacteria 5848
83 Ga0075436_100017769 3300006914 Bacteria 4870
84 Ga0075435_100155083 3300007076 Bacteria 1927
85 Ga0111539_10001189 3300009094 Bacteria 34587
86 Ga0111539_10029206 3300009094 Bacteria 6720
87 Ga0111539_10323434 3300009094 Bacteria 1795
88 Ga0111539_10489432 3300009094 Bacteria 1433
89 Ga0105245_10043914 3300009098 Bacteria 3988
90 Ga0105245_10099778 3300009098 Bacteria 2685
91 Ga0105245_10111514 3300009098 Bacteria 2544
92 Ga0105245_10294191 3300009098 Bacteria 1591
93 Ga0114129_10248049 3300009147 Bacteria 2391
94 Ga0105241_10056065 3300009174 Bacteria 3021
95 Ga0105249_10001530 3300009553 Bacteria 20289
96 Ga0105239_10011278 3300010375 Bacteria 9969
97 Ga0105239_10059635 3300010375 Bacteria 4188
98 Ga0105246_10018370 3300011119 Bacteria 4456
99 Ga0157371_10127171 3300013102 Bacteria 1813
100 Ga0157371_10137913 3300013102 Bacteria 1737
101 Ga0157370_10304910 3300013104 Bacteria 1470
102 Ga0157369_10034956 3300013105 Bacteria 5511
103 Ga0157374_10113202 3300013296 Bacteria 2612
104 Ga0157374_10189267 3300013296 Bacteria 2013
105 Ga0163162_10056770 3300013306 Bacteria 3943
106 Ga0163162_10154918 3300013306 Bacteria 2411
107 Ga0157372_10006441 3300013307 Bacteria 12499
108 Ga0157375_10257195 3300013308 Bacteria 1907
109 Ga0157375_10307998 3300013308 Bacteria 1748
110 Ga0163163_10123021 3300014325 Bacteria 2630
111 Ga0157380_10043671 3300014326 Bacteria 3510
112 Ga0157376_10009635 3300014969 Bacteria 7027
113 Ga0157376_10197545 3300014969 Bacteria 1849
114 Ga0163161_10055708 3300017792 Bacteria 2871
115 Ga0207692_10022590 3300025898 Bacteria 2896
116 Ga0207642_10035127 3300025899 Bacteria 2138
117 Ga0207642_10258434 3300025899 Bacteria 992
118 Ga0207688_10048164 3300025901 Bacteria 2381
119 Ga0207685_10000737 3300025905 Bacteria 5968
120 Ga0207699_10115130 3300025906 Bacteria 1730
121 Ga0207684_10048484 3300025910 Bacteria 3602
122 Ga0207693_10017735 3300025915 Bacteria 5676
123 Ga0207693_10025541 3300025915 Bacteria 4683
124 Ga0207693_10122472 3300025915 Bacteria 2043
125 Ga0207693_10278801 3300025915 Bacteria 1310
126 Ga0207663_10129502 3300025916 Bacteria 1741
127 Ga0207660_10030162 3300025917 Bacteria 3726
128 Ga0207657_10043942 3300025919 Bacteria 3932
129 Ga0207649_10011250 3300025920 Bacteria 4929
130 Ga0207652_10008951 3300025921 Bacteria 8068
131 Ga0207652_10042184 3300025921 Bacteria 3882
132 Ga0207646_10000903 3300025922 Bacteria 38217
133 Ga0207650_10061080 3300025925 Bacteria 2813
134 Ga0207687_10029445 3300025927 Bacteria 3694
135 Ga0207687_10032784 3300025927 Bacteria 3520
136 Ga0207687_10139274 3300025927 Bacteria 1839
137 Ga0207687_10204404 3300025927 Bacteria 1546
138 Ga0207687_10273199 3300025927 Bacteria 1352
139 Ga0207700_10027373 3300025928 Bacteria 3991
140 Ga0207664_10150787 3300025929 Bacteria 1975
141 Ga0207706_10011967 3300025933 Bacteria 7901
142 Ga0207686_10003756 3300025934 Bacteria 8149
143 Ga0207709_10134782 3300025935 Bacteria 1689
144 Ga0207665_10000419 3300025939 Bacteria 29265
145 Ga0207665_10044288 3300025939 Bacteria 2978
146 Ga0207691_10185264 3300025940 Bacteria 1817
147 Ga0207689_10183929 3300025942 Bacteria 1723
148 Ga0207661_10002247 3300025944 Bacteria 13322
149 Ga0207661_10145726 3300025944 Bacteria 2043
150 Ga0207661_10288830 3300025944 Bacteria 1467
151 Ga0207679_10019159 3300025945 Bacteria 4594
152 Ga0207667_10093043 3300025949 Bacteria 3113
153 Ga0207712_10228668 3300025961 Bacteria 1492
154 Ga0207668_10061781 3300025972 Bacteria 2636
155 Ga0207677_10344963 3300026023 Bacteria 1246
156 Ga0207677_10418348 3300026023 Bacteria 1141
157 Ga0207639_10144598 3300026041 Bacteria 1985
158 Ga0207708_10044521 3300026075 Bacteria 3381
159 Ga0207708_10197937 3300026075 Bacteria 1602
160 Ga0207708_10273753 3300026075 Bacteria 1366
161 Ga0207702_10012773 3300026078 Bacteria 6988
162 Ga0207702_10044216 3300026078 Bacteria 3743
163 Ga0207702_10081462 3300026078 Bacteria 2811
164 Ga0207648_10064997 3300026089 Bacteria 3180
165 Ga0207648_10229072 3300026089 Bacteria 1653
166 Ga0207648_10289199 3300026089 Bacteria 1467
167 Ga0207674_10009800 3300026116 Bacteria 10909
168 Ga0207675_100020323 3300026118 Bacteria 6190
169 Ga0207675_100026553 3300026118 Bacteria 5391
170 Ga0207675_100123416 3300026118 Bacteria 2452
171 Ga0207683_10006303 3300026121 Bacteria 10160
172 Ga0207683_10007267 3300026121 Bacteria 9493
173 Ga0207683_10022853 3300026121 Bacteria 5372
174 Ga0207428_10006489 3300027907 Bacteria 10798
175 Ga0207428_10017164 3300027907 Bacteria 6219
176 Ga0207428_10067757 3300027907 Bacteria 2810
177 Ga0265338_10007776 3300028800 Bacteria 13188
178 Ga0265327_10001557 3300031251 Bacteria 28167
179 Ga0265342_10121463 3300031712 Bacteria 1471
180 Ga0307415_100106052 3300032126 Bacteria 2074
181 Ga0373949_0003690 3300035090 Bacteria 3592
182 Ga0373941_0013674 3300035115 Bacteria 2152
183 Ga0373956_0035204 3300035119 Bacteria 2208
184 Ga0373961_0055797 3300035241 Bacteria 1185
185 Ga0373937_0004067 3300036401 Bacteria 12400
186 Ga0373925_0043449 3300037068 Bacteria 3336
187 Ga0395899_0003219 3300037312 Bacteria 12950
188 Ga0395899_0020902 3300037312 Bacteria 4964
189 Ga0395899_0041419 3300037312 Bacteria 3441
190 Ga0395899_0053643 3300037312 Bacteria 2984
191 Ga0395899_0074491 3300037312 Bacteria 2480
192 Ga0395900_0008673 3300037418 Bacteria 10443
193 Ga0395900_0019417 3300037418 Bacteria 6929
194 Ga0395900_0042906 3300037418 Bacteria 4660
195 Ga0395900_0156390 3300037418 Bacteria 2328
196 Ga0395900_0204447 3300037418 Bacteria 1996
197 Ga0395898_0002185 3300037466 Bacteria 23909
198 Ga0395898_0007751 3300037466 Bacteria 11400
199 Ga0395898_0007867 3300037466 Bacteria 11311
200 Ga0395898_0009235 3300037466 Bacteria 10374
201 Ga0395898_0056872 3300037466 Bacteria 3811
202 Ga0395905_0012545 3300037471 Bacteria 8152
203 Ga0395905_0047689 3300037471 Bacteria 4013
204 Ga0395905_0052808 3300037471 Bacteria 3804
205 Ga0395905_0148650 3300037471 Bacteria 2204
206 Ga0395901_0001009 3300038443 Bacteria 30451
207 Ga0395901_0001203 3300038443 Bacteria 27494
208 Ga0395901_0006560 3300038443 Bacteria 11765
209 Ga0395901_0008635 3300038443 Bacteria 10294
210 Ga0395901_0009551 3300038443 Bacteria 9841
211 Ga0395901_0131162 3300038443 Bacteria 2633
212 Ga0395901_0137075 3300038443 Bacteria 2572
213 Ga0395901_0245491 3300038443 Bacteria 1866
214 Ga0439460_0042969 3300042461 Bacteria 1334
215 Ga0451576_0040722 3300045051 Bacteria 4915
216 Ga0451576_0592171 3300045051 Bacteria 1165
217 Ga0495592_0002652 3300046454 Bacteria 12649
218 Ga0495592_0109264 3300046454 Bacteria 1959
219 Ga0495641_0143712 3300046461 Bacteria 1066
220 Ga0495651_0009501 3300046462 Bacteria 7468
221 Ga0495653_0010901 3300046463 Bacteria 7441
222 Ga0495653_0029762 3300046463 Bacteria 4355
223 Ga0495664_0013669 3300046477 Bacteria 4607
224 Ga0495596_0027363 3300046500 Bacteria 2294
225 Ga0495607_0022607 3300046501 Bacteria 3946
226 Ga0495608_0030076 3300046511 Bacteria 3680
227 Ga0495618_0006688 3300046514 Bacteria 6985
228 Ga0495628_0017510 3300046516 Bacteria 5963
229 Ga0495628_0024302 3300046516 Bacteria 4961
230 Ga0495663_0015748 3300046525 Bacteria 2133
231 Ga0495652_0051771 3300046529 Bacteria 3504
232 Ga0495640_0011971 3300046533 Bacteria 6651
233 Ga0495587_0030458 3300046536 Bacteria 3272
234 Ga0495587_0046664 3300046536 Bacteria 2570
235 Ga0495645_0026684 3300046543 Bacteria 4193
236 Ga0495645_0041289 3300046543 Bacteria 3364
237 Ga0495667_0011684 3300046559 Bacteria 5944
238 Ga0495656_0009690 3300046615 Bacteria 3474
239 Ga0495656_0077375 3300046615 Bacteria 1493
240 Ga0495611_0039596 3300046648 Bacteria 2099
241 Ga0495635_0024545 3300046663 Bacteria 4201
242 Ga0495635_0067955 3300046663 Bacteria 2444
243 Ga0495635_0078836 3300046663 Bacteria 2255
244 Ga0495657_0011627 3300046675 Bacteria 6572
245 Ga0495599_0002584 3300046678 Bacteria 10551
246 Ga0495599_0025081 3300046678 Bacteria 3731
247 Ga0495646_0114662 3300046680 Bacteria 1531
248 Ga0495670_0036798 3300046691 Bacteria 2439
249 Ga0495600_0137458 3300046809 Bacteria 1587
250 Ga0495636_0082682 3300047318 Bacteria 1385
251 Ga0495674_0010628 3300047319 Bacteria 8707
252 Ga0495674_0078454 3300047319 Bacteria 2837
253 Ga0495676_0230297 3300047321 Bacteria 1273
254 Ga0495680_0011511 3300047322 Bacteria 7825
255 Ga0495680_0013749 3300047322 Bacteria 7044
256 Ga0495680_0032359 3300047322 Bacteria 4246
257 Ga0495680_0064033 3300047322 Bacteria 2821
258 Ga0495684_0005270 3300047471 Bacteria 10067
259 Ga0495684_0005829 3300047471 Bacteria 9572
260 Ga0495602_0089063 3300048088 Bacteria 2567
261 Ga0496100_0017704 3300048903 Bacteria 4212
262 Ga0496100_0082789 3300048903 Bacteria 2171
263 Ga0496100_0090002 3300048903 Bacteria 2092
264 Ga0496100_0179383 3300048903 Bacteria 1531
265 Ga0496101_0000850 3300048904 Bacteria 18003
266 Ga0496101_0020868 3300048904 Bacteria 4494
267 Ga0496101_0061417 3300048904 Bacteria 2729
268 Ga0496101_0135497 3300048904 Bacteria 1873
269 Ga0496101_0164659 3300048904 Bacteria 1702
270 Ga0496101_0276282 3300048904 Bacteria 1312
271 Ga0496102_0001070 3300048905 Bacteria 25310
272 Ga0496102_0036354 3300048905 Bacteria 4436
273 Ga0496102_0143975 3300048905 Bacteria 2236
274 Ga0496103_0014177 3300048906 Bacteria 4732
275 Ga0496103_0065925 3300048906 Bacteria 2259
276 Ga0496104_0000826 3300048907 Bacteria 26702
277 Ga0496104_0001768 3300048907 Bacteria 18685
278 Ga0496104_0004458 3300048907 Bacteria 12200
279 Ga0496104_0014423 3300048907 Bacteria 7140
280 Ga0496105_0006022 3300048908 Bacteria 9268
281 Ga0496105_0017236 3300048908 Bacteria 5786
282 Ga0496105_0030657 3300048908 Bacteria 4407
283 Ga0496105_0165123 3300048908 Bacteria 1816
284 Ga0496106_0070675 3300048909 Bacteria 2666
285 Ga0496107_0009823 3300048910 Bacteria 6638
286 Ga0496107_0009866 3300048910 Bacteria 6621
287 Ga0496107_0011200 3300048910 Bacteria 6243
288 Ga0496107_0171697 3300048910 Bacteria 1609
289 Ga0496108_0013115 3300048911 Bacteria 6756
290 Ga0496108_0033880 3300048911 Bacteria 4242
291 Ga0496108_0036785 3300048911 Bacteria 4074
292 Ga0496108_0050280 3300048911 Bacteria 3489
293 Ga0496108_0389538 3300048911 Bacteria 1217
294 Ga0496109_0001697 3300048912 Bacteria 18359
295 Ga0496109_0002141 3300048912 Bacteria 16434
296 Ga0496109_0002814 3300048912 Bacteria 14568
297 Ga0496109_0005423 3300048912 Bacteria 10671
298 Ga0496109_0005805 3300048912 Bacteria 10337
299 Ga0496109_0014864 3300048912 Bacteria 6773
300 Ga0496109_0113517 3300048912 Bacteria 2520
301 Ga0496109_0169022 3300048912 Bacteria 2051
302 Ga0496109_0316690 3300048912 Bacteria 1472
303 Ga0496110_0001328 3300048913 Bacteria 17771
304 Ga0496110_0016885 3300048913 Bacteria 6100
305 Ga0496110_0029380 3300048913 Bacteria 4731
306 Ga0496110_0036592 3300048913 Bacteria 4263
307 Ga0496110_0057356 3300048913 Bacteria 3428
308 Ga0496110_0070759 3300048913 Bacteria 3092
309 Ga0496111_0003478 3300048914 Bacteria 9744
310 Ga0496111_0009508 3300048914 Bacteria 6494
311 Ga0496111_0021409 3300048914 Bacteria 4515
312 Ga0496111_0030074 3300048914 Bacteria 3861
313 Ga0496111_0030760 3300048914 Bacteria 3819
314 Ga0496111_0057320 3300048914 Bacteria 2820
315 Ga0496111_0069489 3300048914 Bacteria 2561
316 Ga0496111_0236964 3300048914 Bacteria 1355
317 Ga0496112_0011907 3300048915 Bacteria 7967
318 Ga0496112_0079440 3300048915 Bacteria 3245
319 Ga0496112_0150235 3300048915 Bacteria 2297
320 Ga0496112_0338165 3300048915 Bacteria 1449
321 Ga0496112_0483696 3300048915 Bacteria 1174
322 Ga0496113_0012637 3300048916 Bacteria 5682
323 Ga0496113_0174966 3300048916 Bacteria 1701
324 Ga0496114_0000615 3300048917 Bacteria 26335
325 Ga0496114_0001305 3300048917 Bacteria 18876
326 Ga0496114_0039978 3300048917 Bacteria 3881
327 Ga0496114_0041606 3300048917 Bacteria 3809
328 Ga0496114_0061092 3300048917 Bacteria 3151
329 Ga0496114_0068514 3300048917 Bacteria 2979
330 Ga0496114_0080180 3300048917 Bacteria 2756
331 Ga0496114_0159859 3300048917 Bacteria 1958
332 Ga0496114_0269274 3300048917 Bacteria 1501
333 Ga0496115_0004585 3300048918 Bacteria 10009
334 Ga0496115_0033902 3300048918 Bacteria 4034
335 Ga0496115_0041914 3300048918 Bacteria 3645
336 Ga0496115_0207370 3300048918 Bacteria 1619
337 Ga0501031_0001154 3300049568 Bacteria 16098
338 Ga0501032_0000274 3300049569 Bacteria 43406
339 Ga0501032_0003766 3300049569 Bacteria 11510
340 Ga0501032_0017678 3300049569 Bacteria 5004
341 Ga0501033_0000629 3300049570 Bacteria 32631
342 Ga0501033_0083671 3300049570 Bacteria 2338
343 Ga0501034_0019484 3300049571 Bacteria 6939
344 Ga0501036_0000296 3300049572 Bacteria 34579
345 Ga0501036_0004909 3300049572 Bacteria 10803
346 Ga0501036_0114249 3300049572 Bacteria 2282
347 Ga0501037_0000379 3300049573 Bacteria 36982
348 Ga0501037_0165903 3300049573 Bacteria 1573
349 Ga0501038_0000186 3300049574 Bacteria 53569
350 Ga0501038_0012334 3300049574 Bacteria 7808
351 Ga0501038_0148330 3300049574 Bacteria 1913
352 Ga0501038_0167152 3300049574 Bacteria 1784
353 Ga0501039_0000141 3300049575 Bacteria 49210
354 Ga0501039_0003178 3300049575 Bacteria 12289
355 Ga0501039_0033928 3300049575 Bacteria 3938
356 Ga0501040_0000360 3300049576 Bacteria 26851
357 Ga0501040_0005585 3300049576 Bacteria 8134
358 Ga0501041_0001374 3300049577 Bacteria 13445
359 Ga0501041_0013922 3300049577 Bacteria 4770
360 Ga0501042_0000670 3300049578 Bacteria 18434
361 Ga0501042_0077097 3300049578 Bacteria 2386
362 Ga0501042_0134232 3300049578 Bacteria 1784
363 Ga0501042_0163651 3300049578 Bacteria 1605
364 Ga0501043_0000171 3300049579 Bacteria 58361
365 Ga0501046_0005476 3300049580 Bacteria 11352
366 Ga0501047_0000481 3300049581 Bacteria 43439
367 Ga0501048_0001307 3300049582 Bacteria 18874
368 Ga0501048_0046747 3300049582 Bacteria 3089
369 Ga0501067_0000787 3300049583 Bacteria 17090
370 Ga0501068_0000250 3300049584 Bacteria 26520
371 Ga0501068_0005637 3300049584 Bacteria 6858
372 Ga0501068_0145456 3300049584 Bacteria 1487
373 Ga0501069_0000509 3300049585 Bacteria 17761
374 Ga0501069_0004021 3300049585 Bacteria 7586
375 Ga0501070_0001532 3300049586 Bacteria 20564
376 Ga0501070_0024468 3300049586 Bacteria 5064
377 Ga0501071_0000494 3300049587 Bacteria 19967
378 Ga0501071_0023606 3300049587 Bacteria 4295
379 Ga0501071_0215631 3300049587 Bacteria 1444
380 Ga0501072_0007396 3300049588 Bacteria 8331
381 Ga0501072_0018316 3300049588 Bacteria 5389
382 Ga0501073_0000337 3300049589 Bacteria 31624
383 Ga0501073_0173921 3300049589 Bacteria 1490
384 Ga0501074_0000054 3300049590 Bacteria 55953
385 Ga0501074_0008299 3300049590 Bacteria 7531
386 Ga0501075_0000768 3300049591 Bacteria 20045
387 Ga0501075_0012227 3300049591 Bacteria 6093
388 Ga0501075_0059039 3300049591 Bacteria 2889
389 Ga0501075_0087403 3300049591 Bacteria 2362
390 Ga0501075_0222965 3300049591 Bacteria 1438
391 Ga0501076_0000484 3300049592 Bacteria 25088
392 Ga0501076_0001429 3300049592 Bacteria 16027
393 Ga0501076_0004863 3300049592 Bacteria 9600
394 Ga0501076_0039193 3300049592 Bacteria 3720
395 Ga0501077_0000376 3300049593 Bacteria 26711
396 Ga0501077_0002158 3300049593 Bacteria 11889
397 Ga0501077_0077634 3300049593 Bacteria 2104
398 Ga0501077_0089548 3300049593 Bacteria 1950
399 Ga0501077_0143081 3300049593 Bacteria 1517
400 Ga0501079_0002105 3300049741 Bacteria 14298
401 Ga0501079_0212192 3300049741 Bacteria 1512
402 Ga0501079_0288015 3300049741 Bacteria 1284
403 Ga0501080_0000301 3300049742 Bacteria 37557
404 Ga0501080_0000889 3300049742 Bacteria 24470
405 Ga0501080_0041043 3300049742 Bacteria 4313
406 Ga0501081_0000758 3300049743 Bacteria 18903
407 Ga0501081_0001817 3300049743 Bacteria 13221
408 Ga0501081_0015857 3300049743 Bacteria 4973
409 Ga0501081_0042328 3300049743 Bacteria 3120
410 Ga0501081_0065369 3300049743 Bacteria 2528
411 Ga0501083_0000797 3300049744 Bacteria 20656
412 Ga0501083_0010307 3300049744 Bacteria 6585
413 Ga0501035_0015792 3300049822 Bacteria 6969
414 Ga0501035_0200498 3300049822 Bacteria 1712
415 Ga0501044_0005845 3300049823 Bacteria 13626
416 Ga0501045_0000050 3300049824 Bacteria 51884
417 Ga0501045_0006351 3300049824 Bacteria 8178
418 Ga0501045_0006631 3300049824 Bacteria 8024
419 Ga0501045_0080115 3300049824 Bacteria 2408
420 nmdc:mga00v17_88814_c1 3300050491 Bacteria 1939
421 nmdc:mga0yw44_39216_c1 3300050492 Bacteria 2807
422 nmdc:mga05p37_146233_c1 3300050507 Bacteria 2894
423 nmdc:mga05p37_357361_c1 3300050507 Bacteria 1718
424 nmdc:mga06r32_166859_c1 3300050510 Bacteria 2185
425 nmdc:mga06r32_688427_c1 3300050510 Bacteria 989
426 nmdc:mga08y16_235920_c1 3300050511 Bacteria 1891
427 nmdc:mga08y16_38679_c1 3300050511 Bacteria 5007
428 nmdc:mga08y16_83434_c1 3300050511 Bacteria 3330
429 nmdc:mga08y16_9774_c1 3300050511 Bacteria 10072
430 nmdc:mga0n895_117799_c1 3300050512 Bacteria 2675
431 nmdc:mga0n895_153370_c1 3300050512 Bacteria 2334
432 nmdc:mga0n895_280296_c1 3300050512 Bacteria 1690
433 nmdc:mga0n895_37911_c1 3300050512 Bacteria 4667
434 nmdc:mga0rr50_273758_c1 3300050513 Bacteria 1408
435 nmdc:mga0rr50_400540_c1 3300050513 Bacteria 1159
436 nmdc:mga0rr50_50845_c1 3300050513 Bacteria 3072
437 nmdc:mga08x19_121886_c1 3300050514 Bacteria 1749
438 nmdc:mga08x19_41491_c1 3300050514 Bacteria 2931
439 nmdc:mga0a205_38861_c1 3300050515 Bacteria 4580
440 Ga0495601_0003946 3300053077 Bacteria 8541
441 Ga0495601_0009179 3300053077 Bacteria 5844
442 Ga0495601_0014735 3300053077 Bacteria 4717
443 Ga0495595_0002764 3300053084 Bacteria 6896
444 Ga0495619_0005671 3300053085 Bacteria 7917
445 Ga0495619_0100160 3300053085 Bacteria 1971
446 Ga0501084_0003599 3300054114 Bacteria 12585
447 Ga0501082_0001712 3300060353 Bacteria 19340
448 Ga0501082_0005670 3300060353 Bacteria 10835
449 Ga0501082_0022463 3300060353 Bacteria 5434
450 Ga0501082_0119843 3300060353 Bacteria 2280
451 Ga0501082_0274471 3300060353 Bacteria 1467
452 Ga0501082_0389135 3300060353 Bacteria 1217
453 Ga0530510_0000188 3300061734 Bacteria 37875
454 Ga0530510_0004135 3300061734 Bacteria 10019
455 Ga0530510_0055695 3300061734 Bacteria 2857
456 Ga0530510_0073438 3300061734 Bacteria 2483
457 Ga0530510_0245224 3300061734 Bacteria 1334
458 Ga0501040_0119370
459 JGI25407J50210_10008994
460 JGI25407J50210_10028105
461 Ga0070683_100215633
462 Ga0070670_100043461
463 Ga0070680_100188920
464 Ga0070682_100068475
465 Ga0070691_10005490
466 Ga0070691_10036614
467 Ga0070668_100065189
468 Ga0070675_100260012
469 Ga0070671_100169981
470 Ga0070673_100156882
471 Ga0070688_100027003
472 Ga0070709_10108925
473 Ga0070713_100074099
474 Ga0070713_100246334
475 Ga0070711_100084162
476 Ga0070700_100140853
477 Ga0070700_100214515
478 Ga0070708_100031575
479 Ga0070663_100066785
480 Ga0070678_100008330
481 Ga0070678_100326513
482 Ga0070681_10015967
483 Ga0070681_10134721
484 Ga0068867_100086990
485 Ga0070685_10007555
486 Ga0070706_100095411
487 Ga0070698_100002946
488 Ga0070679_100027514
489 Ga0070679_100048358
490 Ga0070684_100002563
491 Ga0070684_100027838
492 Ga0070684_100033636
493 Ga0070684_100209451
494 Ga0070686_100114626
495 Ga0070686_100134607
496 Ga0070686_100213705
497 Ga0070696_100020947
498 Ga0070693_100044736
499 Ga0070704_100095942
500 Ga0068855_100344012
501 Ga0070664_100017199
502 Ga0070664_100190019
503 Ga0068857_100025204
504 Ga0068857_100342669
505 Ga0068854_100129452
506 Ga0068856_100006126
507 Ga0068856_100076831
508 Ga0070702_100066070
509 Ga0068864_100107870
510 Ga0068861_100007504
511 Ga0068861_100273376
512 Ga0068870_10075856
513 Ga0068863_100277525
514 Ga0068863_100314731
515 Ga0081455_10009985
516 Ga0081455_10011733
517 Ga0081455_10041601
518 Ga0081455_10043714
519 Ga0081455_10076170
520 Ga0081455_10189282
521 Ga0081538_10000062
522 Ga0081538_10000183
523 Ga0070717_10015352
524 Ga0070717_10083856
525 Ga0075365_10075156
526 Ga0075432_10002690
527 Ga0070715_10072328
528 Ga0070715_10158267
529 Ga0070712_100011405
530 Ga0075428_100132378
531 Ga0075431_100105311
532 Ga0075431_100169586
533 Ga0075433_10119189
534 Ga0075433_10138756
535 Ga0075434_100012319
536 Ga0075434_100130619
537 Ga0075429_100102553
538 Ga0068865_100057866
539 Ga0075436_100012378
540 Ga0075436_100017769
541 Ga0075435_100155083
542 Ga0111539_10001189
543 Ga0111539_10029206
544 Ga0111539_10323434
545 Ga0111539_10489432
546 Ga0105245_10043914
547 Ga0105245_10099778
548 Ga0105245_10111514
549 Ga0105245_10294191
550 Ga0114129_10248049
551 Ga0105241_10056065
552 Ga0105249_10001530
553 Ga0105239_10011278
554 Ga0105239_10059635
555 Ga0105246_10018370
556 Ga0157371_10127171
557 Ga0157371_10137913
558 Ga0157370_10304910
559 Ga0157369_10034956
560 Ga0157374_10113202
561 Ga0157374_10189267
562 Ga0163162_10056770
563 Ga0163162_10154918
564 Ga0157372_10006441
565 Ga0157375_10257195
566 Ga0157375_10307998
567 Ga0163163_10123021
568 Ga0157380_10043671
569 Ga0157376_10009635
570 Ga0157376_10197545
571 Ga0163161_10055708
572 Ga0207692_10022590
573 Ga0207642_10035127
574 Ga0207642_10258434
575 Ga0207688_10048164
576 Ga0207685_10000737
577 Ga0207699_10115130
578 Ga0207684_10048484
579 Ga0207693_10017735
580 Ga0207693_10025541
581 Ga0207693_10122472
582 Ga0207693_10278801
583 Ga0207663_10129502
584 Ga0207660_10030162
585 Ga0207657_10043942
586 Ga0207649_10011250
587 Ga0207652_10008951
588 Ga0207652_10042184
589 Ga0207646_10000903
590 Ga0207650_10061080
591 Ga0207687_10029445
592 Ga0207687_10032784
593 Ga0207687_10139274
594 Ga0207687_10204404
595 Ga0207687_10273199
596 Ga0207700_10027373
597 Ga0207664_10150787
598 Ga0207706_10011967
599 Ga0207686_10003756
600 Ga0207709_10134782
601 Ga0207665_10000419
602 Ga0207665_10044288
603 Ga0207691_10185264
604 Ga0207689_10183929
605 Ga0207661_10002247
606 Ga0207661_10145726
607 Ga0207661_10288830
608 Ga0207679_10019159
609 Ga0207667_10093043
610 Ga0207712_10228668
611 Ga0207668_10061781
612 Ga0207677_10344963
613 Ga0207677_10418348
614 Ga0207639_10144598
615 Ga0207708_10044521
616 Ga0207708_10197937
617 Ga0207708_10273753
618 Ga0207702_10012773
619 Ga0207702_10044216
620 Ga0207702_10081462
621 Ga0207648_10064997
622 Ga0207648_10229072
623 Ga0207648_10289199
624 Ga0207674_10009800
625 Ga0207675_100020323
626 Ga0207675_100026553
627 Ga0207675_100123416
628 Ga0207683_10006303
629 Ga0207683_10007267
630 Ga0207683_10022853
631 Ga0207428_10006489
632 Ga0207428_10017164
633 Ga0207428_10067757
634 Ga0265338_10007776
635 Ga0265327_10001557
636 Ga0265342_10121463
637 Ga0307415_100106052
638 Ga0373949_0003690
639 Ga0373941_0013674
640 Ga0373956_0035204
641 Ga0373961_0055797
642 Ga0373937_0004067
643 Ga0373925_0043449
644 Ga0395899_0003219
645 Ga0395899_0020902
646 Ga0395899_0041419
647 Ga0395899_0053643
648 Ga0395899_0074491
649 Ga0395900_0008673
650 Ga0395900_0019417
651 Ga0395900_0042906
652 Ga0395900_0156390
653 Ga0395900_0204447
654 Ga0395898_0002185
655 Ga0395898_0007751
656 Ga0395898_0007867
657 Ga0395898_0009235
658 Ga0395898_0056872
659 Ga0395905_0012545
660 Ga0395905_0047689
661 Ga0395905_0052808
662 Ga0395905_0148650
663 Ga0395901_0001009
664 Ga0395901_0001203
665 Ga0395901_0006560
666 Ga0395901_0008635
667 Ga0395901_0009551
668 Ga0395901_0131162
669 Ga0395901_0137075
670 Ga0395901_0245491
671 Ga0439460_0042969
672 Ga0451576_0040722
673 Ga0451576_0592171
674 Ga0495592_0002652
675 Ga0495592_0109264
676 Ga0495641_0143712
677 Ga0495651_0009501
678 Ga0495653_0010901
679 Ga0495653_0029762
680 Ga0495664_0013669
681 Ga0495596_0027363
682 Ga0495607_0022607
683 Ga0495608_0030076
684 Ga0495618_0006688
685 Ga0495628_0017510
686 Ga0495628_0024302
687 Ga0495663_0015748
688 Ga0495652_0051771
689 Ga0495640_0011971
690 Ga0495587_0030458
691 Ga0495587_0046664
692 Ga0495645_0026684
693 Ga0495645_0041289
694 Ga0495667_0011684
695 Ga0495656_0009690
696 Ga0495656_0077375
697 Ga0495611_0039596
698 Ga0495635_0024545
699 Ga0495635_0067955
700 Ga0495635_0078836
701 Ga0495657_0011627
702 Ga0495599_0002584
703 Ga0495599_0025081
704 Ga0495646_0114662
705 Ga0495670_0036798
706 Ga0495600_0137458
707 Ga0495636_0082682
708 Ga0495674_0010628
709 Ga0495674_0078454
710 Ga0495676_0230297
711 Ga0495680_0011511
712 Ga0495680_0013749
713 Ga0495680_0032359
714 Ga0495680_0064033
715 Ga0495684_0005270
716 Ga0495684_0005829
717 Ga0495602_0089063
718 Ga0496100_0017704
719 Ga0496100_0082789
720 Ga0496100_0090002
721 Ga0496100_0179383
722 Ga0496101_0000850
723 Ga0496101_0020868
724 Ga0496101_0061417
725 Ga0496101_0135497
726 Ga0496101_0164659
727 Ga0496101_0276282
728 Ga0496102_0001070
729 Ga0496102_0036354
730 Ga0496102_0143975
731 Ga0496103_0014177
732 Ga0496103_0065925
733 Ga0496104_0000826
734 Ga0496104_0001768
735 Ga0496104_0004458
736 Ga0496104_0014423
737 Ga0496105_0006022
738 Ga0496105_0017236
739 Ga0496105_0030657
740 Ga0496105_0165123
741 Ga0496106_0070675
742 Ga0496107_0009823
743 Ga0496107_0009866
744 Ga0496107_0011200
745 Ga0496107_0171697
746 Ga0496108_0013115
747 Ga0496108_0033880
748 Ga0496108_0036785
749 Ga0496108_0050280
750 Ga0496108_0389538
751 Ga0496109_0001697
752 Ga0496109_0002141
753 Ga0496109_0002814
754 Ga0496109_0005423
755 Ga0496109_0005805
756 Ga0496109_0014864
757 Ga0496109_0113517
758 Ga0496109_0169022
759 Ga0496109_0316690
760 Ga0496110_0001328
761 Ga0496110_0016885
762 Ga0496110_0029380
763 Ga0496110_0036592
764 Ga0496110_0057356
765 Ga0496110_0070759
766 Ga0496111_0003478
767 Ga0496111_0009508
768 Ga0496111_0021409
769 Ga0496111_0030074
770 Ga0496111_0030760
771 Ga0496111_0057320
772 Ga0496111_0069489
773 Ga0496111_0236964
774 Ga0496112_0011907
775 Ga0496112_0079440
776 Ga0496112_0150235
777 Ga0496112_0338165
778 Ga0496112_0483696
779 Ga0496113_0012637
780 Ga0496113_0174966
781 Ga0496114_0000615
782 Ga0496114_0001305
783 Ga0496114_0039978
784 Ga0496114_0041606
785 Ga0496114_0061092
786 Ga0496114_0068514
787 Ga0496114_0080180
788 Ga0496114_0159859
789 Ga0496114_0269274
790 Ga0496115_0004585
791 Ga0496115_0033902
792 Ga0496115_0041914
793 Ga0496115_0207370
794 Ga0501031_0001154
795 Ga0501032_0000274
796 Ga0501032_0003766
797 Ga0501032_0017678
798 Ga0501033_0000629
799 Ga0501033_0083671
800 Ga0501034_0019484
801 Ga0501036_0000296
802 Ga0501036_0004909
803 Ga0501036_0114249
804 Ga0501037_0000379
805 Ga0501037_0165903
806 Ga0501038_0000186
807 Ga0501038_0012334
808 Ga0501038_0148330
809 Ga0501038_0167152
810 Ga0501039_0000141
811 Ga0501039_0003178
812 Ga0501039_0033928
813 Ga0501040_0000360
814 Ga0501040_0005585
815 Ga0501041_0001374
816 Ga0501041_0013922
817 Ga0501042_0000670
818 Ga0501042_0077097
819 Ga0501042_0134232
820 Ga0501042_0163651
821 Ga0501043_0000171
822 Ga0501046_0005476
823 Ga0501047_0000481
824 Ga0501048_0001307
825 Ga0501048_0046747
826 Ga0501067_0000787
827 Ga0501068_0000250
828 Ga0501068_0005637
829 Ga0501068_0145456
830 Ga0501069_0000509
831 Ga0501069_0004021
832 Ga0501070_0001532
833 Ga0501070_0024468
834 Ga0501071_0000494
835 Ga0501071_0023606
836 Ga0501071_0215631
837 Ga0501072_0007396
838 Ga0501072_0018316
839 Ga0501073_0000337
840 Ga0501073_0173921
841 Ga0501074_0000054
842 Ga0501074_0008299
843 Ga0501075_0000768
844 Ga0501075_0012227
845 Ga0501075_0059039
846 Ga0501075_0087403
847 Ga0501075_0222965
848 Ga0501076_0000484
849 Ga0501076_0001429
850 Ga0501076_0004863
851 Ga0501076_0039193
852 Ga0501077_0000376
853 Ga0501077_0002158
854 Ga0501077_0077634
855 Ga0501077_0089548
856 Ga0501077_0143081
857 Ga0501079_0002105
858 Ga0501079_0212192
859 Ga0501079_0288015
860 Ga0501080_0000301
861 Ga0501080_0000889
862 Ga0501080_0041043
863 Ga0501081_0000758
864 Ga0501081_0001817
865 Ga0501081_0015857
866 Ga0501081_0042328
867 Ga0501081_0065369
868 Ga0501083_0000797
869 Ga0501083_0010307
870 Ga0501035_0015792
871 Ga0501035_0200498
872 Ga0501044_0005845
873 Ga0501045_0000050
874 Ga0501045_0006351
875 Ga0501045_0006631
876 Ga0501045_0080115
877 nmdc:mga00v17_88814_c1
878 nmdc:mga0yw44_39216_c1
879 nmdc:mga05p37_146233_c1
880 nmdc:mga05p37_357361_c1
881 nmdc:mga06r32_166859_c1
882 nmdc:mga06r32_688427_c1
883 nmdc:mga08y16_235920_c1
884 nmdc:mga08y16_38679_c1
885 nmdc:mga08y16_83434_c1
886 nmdc:mga08y16_9774_c1
887 nmdc:mga0n895_117799_c1
888 nmdc:mga0n895_153370_c1
889 nmdc:mga0n895_280296_c1
890 nmdc:mga0n895_37911_c1
891 nmdc:mga0rr50_273758_c1
892 nmdc:mga0rr50_400540_c1
893 nmdc:mga0rr50_50845_c1
894 nmdc:mga08x19_121886_c1
895 nmdc:mga08x19_41491_c1
896 nmdc:mga0a205_38861_c1
897 Ga0495601_0003946
898 Ga0495601_0009179
899 Ga0495601_0014735
900 Ga0495595_0002764
901 Ga0495619_0005671
902 Ga0495619_0100160
903 Ga0501084_0003599
904 Ga0501082_0001712
905 Ga0501082_0005670
906 Ga0501082_0022463
907 Ga0501082_0119843
908 Ga0501082_0274471
909 Ga0501082_0389135
910 Ga0530510_0000188
911 Ga0530510_0004135
912 Ga0530510_0055695
913 Ga0530510_0073438
914 Ga0530510_0245224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02322

Cyt_bd_oxida_II

Cytochrome bd terminal oxidase subunit II

3

326

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b4o-assembly1.cif.gz_B cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.8727 1 315
7d5i-assembly1.cif.gz_B structure of mycobacterium smegmatis bd complex in the apo-form. 0.8722 1 319
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8699 1 319
6rko-assembly1.cif.gz_B cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.8538 3 310
7ose-assembly1.cif.gz_B cytochrome bd-ii type oxidase with bound aurachin d 0.8525 3 310
ID Description Score Start End Superfamily
2vpwG00 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6079 16 252 1.20.1630.10
af_Q501Z6_33_157_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5886 151 250 1.20.1250.20
af_Q9Y4G6_789_912_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5833 154 250 1.20.120.230
2vpwG00 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5607 16 252 1.20.1630.10
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.5471 116 256 1.20.120.80
ID Description Score Start End GO Terms
AF-W1XNZ0-F1-model_v4 Cytochrome bd-II oxidase subunit 2 0.9376 115 199 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A349BQZ1-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9161 1 200 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A3B8ITQ0-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9141 96 244 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A353XCI6-F1-model_v4 deleted 0.9132 5 198
AF-Q3EWQ3-F1-model_v4 deleted 0.9092 1 245

Map