F447912

General Info

Members Datasets Scaffolds Average Seq Length
457 157 914 296

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10002403|JGI24740J21852_100024032
Length 366
Sequence LPHEGRSSLVQVAPPTPRSFATPANLILALGLAALVLPTMFQVARVSWASEQGGHGPLVLATGVWLLWRELQEGRAERRPGGALPGTLMLLGCLIIFVIARITGVLEIEGFSMYGALIACAYLLFGGPVIRSIWFPLVYLAFTLPPPDTVVAAITQPIKIEISQMTVSLLHALGYPVASSGVMIYIGQYQLLVAAACAGLNSIVTLGALCLFYVYLRHRSNFTAFLVISVAAIPIAMFSNFVRVLALVVMIYIGQYQLLVAAACAGLNSIVTLGALCLFYVYLRHRSNFTAFLVISVAAIPIAMFSNFVRVLALVLITYYFGESAAQGFVHDFAGLLMFAVALLTVFAIDQLATPLFARAGRRTAS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
156 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
157 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.09
Rhizosphere 98.03
Stem 0
Stem Tuber 0
Unclassified 29.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002403 3300001979 Bacteria 8507
2 MBSR1b_contig_10078088 2162886012 Bacteria 1498
3 JGI24736J21556_1001013 3300001904 Bacteria 5140
4 JGI24735J21928_10005515 3300002067 Bacteria 4195
5 JGI24735J21928_10016635 3300002067 Unclassified 2278
6 JGI24745J21846_1000157 3300002073 Bacteria 5361
7 JGI24738J21930_10022842 3300002075 Bacteria 1292
8 rootH2_10121024 3300003320 Bacteria 1895
9 rootL2_10311366 3300003322 Bacteria 1297
10 rootH1_10163472 3300003323 Bacteria 3665
11 rootH1_10223665 3300003323 Bacteria 4839
12 Ga0065712_10074159 3300005290 Unclassified 4163
13 Ga0065715_10122835 3300005293 Bacteria 2194
14 Ga0070658_10004829 3300005327 Bacteria 10979
15 Ga0070658_10006874 3300005327 Bacteria 9194
16 Ga0070658_10007726 3300005327 Bacteria 8663
17 Ga0070658_10014784 3300005327 Bacteria 6256
18 Ga0070658_10039082 3300005327 Unclassified 3827
19 Ga0070658_10070176 3300005327 Bacteria 2868
20 Ga0070658_10119195 3300005327 Unclassified 2192
21 Ga0070658_10195944 3300005327 Unclassified 1703
22 Ga0070658_10221737 3300005327 Unclassified 1599
23 Ga0070676_10238957 3300005328 Bacteria 1207
24 Ga0070683_100002629 3300005329 Bacteria 14360
25 Ga0070683_100016104 3300005329 Bacteria 6581
26 Ga0070683_100020068 3300005329 Bacteria 5943
27 Ga0070690_100005963 3300005330 Bacteria 6881
28 Ga0070690_100078798 3300005330 Bacteria 2153
29 Ga0070670_100000482 3300005331 Bacteria 32026
30 Ga0070670_100001961 3300005331 Bacteria 16853
31 Ga0070670_100021632 3300005331 Bacteria 5530
32 Ga0070670_100043866 3300005331 Unclassified 3844
33 Ga0070677_10000655 3300005333 Bacteria 11570
34 Ga0070666_10001302 3300005335 Bacteria 15102
35 Ga0070666_10025157 3300005335 Unclassified 3880
36 Ga0070680_100020196 3300005336 Bacteria 5286
37 Ga0070682_100044647 3300005337 Unclassified 2745
38 Ga0068868_100166587 3300005338 Bacteria 1823
39 Ga0070660_100006193 3300005339 Bacteria 8277
40 Ga0070660_100007226 3300005339 Bacteria 7727
41 Ga0070660_100053382 3300005339 Unclassified 3117
42 Ga0070660_100079348 3300005339 Unclassified 2575
43 Ga0070660_100084264 3300005339 Bacteria 2498
44 Ga0070660_100085989 3300005339 Unclassified 2474
45 Ga0070660_100156751 3300005339 Bacteria 1833
46 Ga0070691_10008688 3300005341 Bacteria 4649
47 Ga0070687_100181134 3300005343 Unclassified 1262
48 Ga0070661_100003992 3300005344 Bacteria 10146
49 Ga0070661_100005291 3300005344 Bacteria 8893
50 Ga0070661_100031844 3300005344 Bacteria 3814
51 Ga0070661_100061837 3300005344 Unclassified 2749
52 Ga0070692_10095609 3300005345 Bacteria 1621
53 Ga0070668_100017861 3300005347 Bacteria 5321
54 Ga0070669_100022556 3300005353 Bacteria 4502
55 Ga0070669_100026431 3300005353 Unclassified 4176
56 Ga0070675_100000877 3300005354 Bacteria 21384
57 Ga0070675_100002093 3300005354 Bacteria 14774
58 Ga0070675_100002962 3300005354 Bacteria 12815
59 Ga0070675_100063561 3300005354 Bacteria 3051
60 Ga0070671_100001443 3300005355 Bacteria 17754
61 Ga0070671_100003827 3300005355 Bacteria 11819
62 Ga0070671_100014409 3300005355 Bacteria 6387
63 Ga0070671_100043097 3300005355 Bacteria 3751
64 Ga0070671_100142308 3300005355 Bacteria 2024
65 Ga0070674_100002176 3300005356 Bacteria 10775
66 Ga0070674_100018915 3300005356 Unclassified 4365
67 Ga0070674_100027807 3300005356 Unclassified 3709
68 Ga0070674_100183092 3300005356 Bacteria 1606
69 Ga0070673_100002199 3300005364 Bacteria 11788
70 Ga0070673_100004985 3300005364 Bacteria 8465
71 Ga0070673_100111205 3300005364 Unclassified 2272
72 Ga0070659_100007018 3300005366 Bacteria 8158
73 Ga0070659_100009371 3300005366 Bacteria 7190
74 Ga0070659_100161822 3300005366 Bacteria 1830
75 Ga0070667_100003311 3300005367 Bacteria 13770
76 Ga0070667_100011143 3300005367 Bacteria 7437
77 Ga0070667_100053321 3300005367 Bacteria 3413
78 Ga0070667_100269277 3300005367 Bacteria 1527
79 Ga0070709_10090420 3300005434 Bacteria 2018
80 Ga0070714_100046635 3300005435 Bacteria 3677
81 Ga0070713_100123284 3300005436 Unclassified 2276
82 Ga0070663_100008163 3300005455 Bacteria 6423
83 Ga0070663_100060216 3300005455 Unclassified 2730
84 Ga0070663_100060410 3300005455 Bacteria 2726
85 Ga0070663_100062121 3300005455 Unclassified 2692
86 Ga0070678_100108739 3300005456 Bacteria 2165
87 Ga0070678_100263158 3300005456 Bacteria 1451
88 Ga0070662_100037197 3300005457 Unclassified 3450
89 Ga0070662_100058372 3300005457 Unclassified 2808
90 Ga0070662_100114802 3300005457 Unclassified 2056
91 Ga0070662_100129167 3300005457 Bacteria 1946
92 Ga0070662_100184816 3300005457 Unclassified 1645
93 Ga0070681_10063561 3300005458 Bacteria 3663
94 Ga0070681_10080144 3300005458 Bacteria 3221
95 Ga0070685_10072206 3300005466 Unclassified 2048
96 Ga0070685_10182155 3300005466 Bacteria 1353
97 Ga0070679_100166365 3300005530 Unclassified 2179
98 Ga0070684_100004092 3300005535 Bacteria 11038
99 Ga0070684_100010106 3300005535 Bacteria 7464
100 Ga0068853_100027959 3300005539 Bacteria 4742
101 Ga0068853_100132645 3300005539 Bacteria 2231
102 Ga0070672_100001022 3300005543 Bacteria 17006
103 Ga0070672_100031012 3300005543 Unclassified 4021
104 Ga0070686_100190226 3300005544 Bacteria 1464
105 Ga0070665_100001865 3300005548 Bacteria 23913
106 Ga0070665_100032641 3300005548 Bacteria 5240
107 Ga0070665_100065985 3300005548 Unclassified 3630
108 Ga0068855_100014977 3300005563 Bacteria 9340
109 Ga0068855_100019199 3300005563 Bacteria 8215
110 Ga0068855_100031267 3300005563 Bacteria 6358
111 Ga0068855_100199319 3300005563 Unclassified 2254
112 Ga0068855_100241090 3300005563 Bacteria 2020
113 Ga0068855_100249922 3300005563 Bacteria 1978
114 Ga0068855_100433437 3300005563 Bacteria 1436
115 Ga0070664_100000161 3300005564 Bacteria 46245
116 Ga0070664_100003503 3300005564 Bacteria 12676
117 Ga0070664_100011435 3300005564 Bacteria 7203
118 Ga0070664_100012603 3300005564 Bacteria 6880
119 Ga0070664_100025357 3300005564 Bacteria 4913
120 Ga0070664_100027281 3300005564 Bacteria 4745
121 Ga0070664_100033439 3300005564 Bacteria 4306
122 Ga0070664_100043495 3300005564 Bacteria 3790
123 Ga0070664_100086527 3300005564 Unclassified 2708
124 Ga0068857_100015317 3300005577 Bacteria 6694
125 Ga0068857_100112004 3300005577 Unclassified 2453
126 Ga0068857_100240565 3300005577 Bacteria 1657
127 Ga0068857_100260821 3300005577 Unclassified 1590
128 Ga0068854_100012828 3300005578 Bacteria 5489
129 Ga0068854_100029291 3300005578 Bacteria 3811
130 Ga0068854_100098300 3300005578 Bacteria 2190
131 Ga0068856_100285094 3300005614 Unclassified 1668
132 Ga0068856_100308754 3300005614 Unclassified 1599
133 Ga0068856_100338184 3300005614 Unclassified 1523
134 Ga0070702_100312601 3300005615 Bacteria 1091
135 Ga0068852_100004519 3300005616 Bacteria 9842
136 Ga0068852_100014915 3300005616 Bacteria 6005
137 Ga0068852_100037574 3300005616 Bacteria 4061
138 Ga0068852_100199957 3300005616 Unclassified 1891
139 Ga0068852_100221550 3300005616 Unclassified 1799
140 Ga0068864_100158787 3300005618 Unclassified 2054
141 Ga0068866_10138533 3300005718 Bacteria 1394
142 Ga0068851_10008666 3300005834 Bacteria 4709
143 Ga0068851_10092421 3300005834 Unclassified 1594
144 Ga0068851_10100987 3300005834 Bacteria 1531
145 Ga0068851_10106645 3300005834 Unclassified 1492
146 Ga0068851_10107372 3300005834 Unclassified 1487
147 Ga0068870_10066866 3300005840 Unclassified 1948
148 Ga0068863_100068000 3300005841 Bacteria 3370
149 Ga0068863_100183232 3300005841 Unclassified 2010
150 Ga0068863_100345935 3300005841 Bacteria 1447
151 Ga0068858_100028249 3300005842 Bacteria 5212
152 Ga0081539_10025535 3300005985 Bacteria 3802
153 Ga0097621_100013198 3300006237 Bacteria 6146
154 Ga0097621_100192599 3300006237 Unclassified 1766
155 Ga0105243_10206038 3300009148 Bacteria 1728
156 Ga0105241_10299016 3300009174 Bacteria 1381
157 Ga0105248_10010282 3300009177 Bacteria 10301
158 Ga0105248_10021840 3300009177 Bacteria 7092
159 Ga0105248_10050700 3300009177 Unclassified 4656
160 Ga0105248_10301208 3300009177 Unclassified 1805
161 Ga0105248_10327057 3300009177 Unclassified 1727
162 Ga0105248_10385351 3300009177 Bacteria 1578
163 Ga0157373_10025010 3300013100 Unclassified 4323
164 Ga0157373_10038965 3300013100 Bacteria 3404
165 Ga0157371_10090169 3300013102 Unclassified 2172
166 Ga0157371_10148746 3300013102 Unclassified 1670
167 Ga0157370_10046619 3300013104 Bacteria 4156
168 Ga0157370_10077871 3300013104 Unclassified 3123
169 Ga0157370_10089298 3300013104 Bacteria 2895
170 Ga0157369_10071353 3300013105 Unclassified 3729
171 Ga0157369_10088507 3300013105 Bacteria 3305
172 Ga0157369_10175311 3300013105 Unclassified 2257
173 Ga0157374_10002028 3300013296 Bacteria 17001
174 Ga0157374_10004774 3300013296 Bacteria 11366
175 Ga0157374_10024050 3300013296 Bacteria 5457
176 Ga0157378_10036398 3300013297 Bacteria 4356
177 Ga0157378_10090576 3300013297 Bacteria 2779
178 Ga0163162_10019694 3300013306 Bacteria 6623
179 Ga0163162_10025893 3300013306 Bacteria 5797
180 Ga0163162_10066915 3300013306 Unclassified 3643
181 Ga0157375_10011719 3300013308 Bacteria 7750
182 Ga0157375_10108944 3300013308 Bacteria 2865
183 Ga0157375_10287735 3300013308 Bacteria 1806
184 Ga0207697_10002640 3300025315 Bacteria 9180
185 Ga0207697_10028241 3300025315 Bacteria 2295
186 Ga0207656_10021640 3300025321 Unclassified 2572
187 Ga0207656_10075442 3300025321 Unclassified 1506
188 Ga0207656_10146690 3300025321 Unclassified 1115
189 Ga0207682_10001230 3300025893 Bacteria 11840
190 Ga0207682_10007931 3300025893 Bacteria 4215
191 Ga0207682_10041736 3300025893 Bacteria 1873
192 Ga0207688_10008268 3300025901 Bacteria 5656
193 Ga0207688_10045671 3300025901 Unclassified 2444
194 Ga0207680_10000843 3300025903 Bacteria 14479
195 Ga0207680_10016580 3300025903 Unclassified 3872
196 Ga0207647_10000652 3300025904 Bacteria 27131
197 Ga0207647_10000953 3300025904 Bacteria 22378
198 Ga0207647_10008914 3300025904 Bacteria 7154
199 Ga0207647_10012953 3300025904 Bacteria 5795
200 Ga0207647_10023651 3300025904 Unclassified 4060
201 Ga0207647_10092270 3300025904 Unclassified 1805
202 Ga0207699_10054658 3300025906 Bacteria 2373
203 Ga0207645_10038918 3300025907 Bacteria 3048
204 Ga0207645_10231033 3300025907 Bacteria 1221
205 Ga0207643_10011534 3300025908 Bacteria 4773
206 Ga0207705_10000387 3300025909 Bacteria 39128
207 Ga0207705_10002169 3300025909 Bacteria 15185
208 Ga0207705_10002376 3300025909 Bacteria 14545
209 Ga0207705_10004357 3300025909 Bacteria 10702
210 Ga0207705_10013381 3300025909 Bacteria 5918
211 Ga0207705_10020054 3300025909 Bacteria 4780
212 Ga0207705_10034432 3300025909 Unclassified 3621
213 Ga0207705_10072312 3300025909 Unclassified 2501
214 Ga0207695_10019291 3300025913 Bacteria 7853
215 Ga0207695_10104104 3300025913 Unclassified 2828
216 Ga0207671_10233281 3300025914 Unclassified 1444
217 Ga0207662_10158270 3300025918 Unclassified 1445
218 Ga0207657_10004145 3300025919 Bacteria 15365
219 Ga0207657_10005549 3300025919 Bacteria 13174
220 Ga0207657_10007353 3300025919 Bacteria 11299
221 Ga0207657_10007984 3300025919 Bacteria 10789
222 Ga0207657_10012093 3300025919 Bacteria 8529
223 Ga0207657_10088734 3300025919 Unclassified 2584
224 Ga0207657_10132037 3300025919 Unclassified 2046
225 Ga0207657_10158791 3300025919 Bacteria 1837
226 Ga0207649_10072591 3300025920 Unclassified 2202
227 Ga0207681_10018237 3300025923 Unclassified 4420
228 Ga0207681_10069414 3300025923 Bacteria 2451
229 Ga0207650_10003792 3300025925 Bacteria 10337
230 Ga0207650_10005099 3300025925 Bacteria 8967
231 Ga0207650_10011538 3300025925 Bacteria 6085
232 Ga0207650_10051214 3300025925 Unclassified 3055
233 Ga0207650_10086849 3300025925 Unclassified 2382
234 Ga0207659_10001593 3300025926 Bacteria 13460
235 Ga0207659_10003287 3300025926 Bacteria 9674
236 Ga0207659_10016021 3300025926 Bacteria 4871
237 Ga0207659_10160754 3300025926 Bacteria 1763
238 Ga0207659_10173859 3300025926 Bacteria 1701
239 Ga0207700_10291927 3300025928 Bacteria 1405
240 Ga0207700_10296864 3300025928 Unclassified 1394
241 Ga0207664_10034681 3300025929 Bacteria 3888
242 Ga0207644_10000110 3300025931 Bacteria 60867
243 Ga0207644_10002765 3300025931 Bacteria 11299
244 Ga0207644_10003194 3300025931 Bacteria 10553
245 Ga0207644_10039149 3300025931 Unclassified 3344
246 Ga0207644_10081955 3300025931 Unclassified 2385
247 Ga0207644_10221407 3300025931 Bacteria 1500
248 Ga0207644_10233532 3300025931 Bacteria 1462
249 Ga0207690_10003887 3300025932 Bacteria 8831
250 Ga0207690_10029863 3300025932 Unclassified 3470
251 Ga0207690_10051391 3300025932 Bacteria 2756
252 Ga0207706_10004761 3300025933 Bacteria 12707
253 Ga0207706_10009871 3300025933 Bacteria 8758
254 Ga0207706_10011549 3300025933 Bacteria 8042
255 Ga0207706_10014253 3300025933 Bacteria 7203
256 Ga0207706_10014818 3300025933 Bacteria 7058
257 Ga0207706_10016645 3300025933 Bacteria 6635
258 Ga0207706_10019367 3300025933 Bacteria 6121
259 Ga0207706_10032192 3300025933 Unclassified 4670
260 Ga0207706_10034788 3300025933 Unclassified 4482
261 Ga0207706_10089022 3300025933 Unclassified 2714
262 Ga0207706_10162453 3300025933 Bacteria 1963
263 Ga0207706_10426858 3300025933 Bacteria 1148
264 Ga0207709_10237546 3300025935 Unclassified 1324
265 Ga0207669_10033950 3300025937 Bacteria 2885
266 Ga0207669_10054655 3300025937 Unclassified 2413
267 Ga0207669_10060456 3300025937 Bacteria 2323
268 Ga0207669_10067163 3300025937 Unclassified 2233
269 Ga0207691_10022111 3300025940 Bacteria 6000
270 Ga0207691_10022416 3300025940 Bacteria 5956
271 Ga0207691_10050820 3300025940 Unclassified 3793
272 Ga0207711_10001548 3300025941 Bacteria 21289
273 Ga0207711_10005517 3300025941 Bacteria 10698
274 Ga0207689_10219271 3300025942 Unclassified 1572
275 Ga0207661_10001486 3300025944 Bacteria 15865
276 Ga0207679_10004156 3300025945 Bacteria 8994
277 Ga0207679_10026010 3300025945 Bacteria 4031
278 Ga0207679_10028979 3300025945 Bacteria 3850
279 Ga0207679_10054031 3300025945 Unclassified 2955
280 Ga0207679_10116292 3300025945 Unclassified 2120
281 Ga0207679_10365544 3300025945 Bacteria 1261
282 Ga0207667_10002186 3300025949 Bacteria 24539
283 Ga0207667_10012704 3300025949 Bacteria 9677
284 Ga0207651_10002266 3300025960 Bacteria 9135
285 Ga0207651_10008091 3300025960 Bacteria 5650
286 Ga0207651_10020520 3300025960 Bacteria 3990
287 Ga0207651_10047356 3300025960 Bacteria 2898
288 Ga0207651_10082268 3300025960 Unclassified 2324
289 Ga0207640_10037699 3300025981 Bacteria 3044
290 Ga0207640_10224397 3300025981 Bacteria 1441
291 Ga0207658_10002182 3300025986 Bacteria 14559
292 Ga0207658_10072193 3300025986 Unclassified 2616
293 Ga0207658_10404649 3300025986 Bacteria 1200
294 Ga0207677_10024243 3300026023 Bacteria 3765
295 Ga0207703_10003041 3300026035 Bacteria 14194
296 Ga0207639_10015848 3300026041 Bacteria 5322
297 Ga0207639_10078966 3300026041 Unclassified 2600
298 Ga0207639_10097674 3300026041 Bacteria 2366
299 Ga0207639_10221164 3300026041 Unclassified 1635
300 Ga0207678_10003264 3300026067 Bacteria 14641
301 Ga0207678_10007049 3300026067 Bacteria 9982
302 Ga0207678_10008675 3300026067 Bacteria 8952
303 Ga0207678_10013246 3300026067 Bacteria 7237
304 Ga0207678_10024610 3300026067 Bacteria 5259
305 Ga0207678_10230213 3300026067 Bacteria 1587
306 Ga0207678_10350433 3300026067 Unclassified 1273
307 Ga0207702_10005931 3300026078 Bacteria 10614
308 Ga0207702_10011089 3300026078 Bacteria 7523
309 Ga0207702_10019425 3300026078 Bacteria 5622
310 Ga0207702_10057850 3300026078 Unclassified 3297
311 Ga0207702_10072614 3300026078 Unclassified 2966
312 Ga0207702_10445863 3300026078 Bacteria 1255
313 Ga0207641_10047089 3300026088 Bacteria 3636
314 Ga0207648_10009677 3300026089 Bacteria 9220
315 Ga0207648_10222351 3300026089 Bacteria 1678
316 Ga0207676_10007954 3300026095 Bacteria 7539
317 Ga0207676_10094602 3300026095 Unclassified 2462
318 Ga0207676_10297056 3300026095 Bacteria 1473
319 Ga0207674_10002992 3300026116 Bacteria 20959
320 Ga0207674_10007460 3300026116 Bacteria 12748
321 Ga0207674_10033569 3300026116 Bacteria 5372
322 Ga0207674_10139885 3300026116 Bacteria 2381
323 Ga0207674_10307062 3300026116 Unclassified 1535
324 Ga0207675_100098339 3300026118 Unclassified 2756
325 Ga0207683_10033866 3300026121 Bacteria 4439
326 Ga0207698_10004870 3300026142 Bacteria 8229
327 Ga0207698_10007590 3300026142 Bacteria 6801
328 Ga0207698_10007964 3300026142 Bacteria 6676
329 Ga0207698_10009963 3300026142 Bacteria 6080
330 Ga0207698_10078226 3300026142 Unclassified 2655
331 Ga0268266_10074634 3300028379 Plasmid 2945
332 Ga0268266_10088211 3300028379 Bacteria 2715
333 Ga0268266_10226480 3300028379 Bacteria 1720
334 Ga0307408_100005547 3300031548 Bacteria 8429
335 Ga0307408_100063445 3300031548 Unclassified 2703
336 Ga0307408_100083793 3300031548 Bacteria 2390
337 Ga0307405_10030471 3300031731 Bacteria 3164
338 Ga0307405_10081898 3300031731 Unclassified 2111
339 Ga0307413_10020129 3300031824 Bacteria 3541
340 Ga0307413_10028933 3300031824 Unclassified 3093
341 Ga0307413_10047089 3300031824 Bacteria 2569
342 Ga0307413_10108809 3300031824 Bacteria 1851
343 Ga0307413_10109872 3300031824 Unclassified 1843
344 Ga0307413_10114615 3300031824 Bacteria 1812
345 Ga0307413_10154255 3300031824 Unclassified 1604
346 Ga0307413_10208729 3300031824 Bacteria 1416
347 Ga0307410_10001568 3300031852 Bacteria 10450
348 Ga0307410_10011884 3300031852 Bacteria 5004
349 Ga0307410_10013317 3300031852 Bacteria 4794
350 Ga0307410_10018254 3300031852 Bacteria 4236
351 Ga0307410_10102408 3300031852 Bacteria 2054
352 Ga0307406_10021903 3300031901 Bacteria 3786
353 Ga0307406_10042031 3300031901 Bacteria 2852
354 Ga0307406_10052039 3300031901 Bacteria 2603
355 Ga0307406_10229441 3300031901 Bacteria 1385
356 Ga0307407_10002341 3300031903 Bacteria 7377
357 Ga0307407_10035072 3300031903 Unclassified 2752
358 Ga0307412_10008883 3300031911 Bacteria 5756
359 Ga0307412_10066033 3300031911 Unclassified 2451
360 Ga0307409_100004859 3300031995 Bacteria 7636
361 Ga0307409_100007942 3300031995 Bacteria 6393
362 Ga0307409_100033400 3300031995 Bacteria 3743
363 Ga0307409_100086733 3300031995 Bacteria 2549
364 Ga0307409_100137083 3300031995 Bacteria 2102
365 Ga0307409_100271753 3300031995 Viruses 1561
366 Ga0307416_100054225 3300032002 Bacteria 3222
367 Ga0307416_100079034 3300032002 Unclassified 2770
368 Ga0307416_100082497 3300032002 Bacteria 2724
369 Ga0307416_100102163 3300032002 Unclassified 2499
370 Ga0307416_100209991 3300032002 Bacteria 1856
371 Ga0307414_10007981 3300032004 Bacteria 5979
372 Ga0307414_10026446 3300032004 Bacteria 3735
373 Ga0307414_10226159 3300032004 Bacteria 1539
374 Ga0307414_10261104 3300032004 Bacteria 1445
375 Ga0307411_10003367 3300032005 Bacteria 7404
376 Ga0307411_10005225 3300032005 Bacteria 6356
377 Ga0307411_10019488 3300032005 Bacteria 3920
378 Ga0307411_10074530 3300032005 Unclassified 2313
379 Ga0307411_10092589 3300032005 Unclassified 2114
380 Ga0307411_10268436 3300032005 Unclassified 1352
381 Ga0307411_10320437 3300032005 Unclassified 1252
382 Ga0307415_100009900 3300032126 Bacteria 5373
383 Ga0307415_100010512 3300032126 Bacteria 5246
384 Ga0307415_100018520 3300032126 Bacteria 4208
385 Ga0307415_100029296 3300032126 Bacteria 3516
386 Ga0307415_100049590 3300032126 Bacteria 2840
387 Ga0307415_100061026 3300032126 Unclassified 2608
388 Ga0307415_100101625 3300032126 Unclassified 2110
389 Ga0307415_100336887 3300032126 Viruses 1264
390 Ga0395899_0014700 3300037312 Bacteria 5973
391 Ga0395899_0039292 3300037312 Unclassified 3542
392 Ga0395899_0080661 3300037312 Unclassified 2368
393 Ga0395899_0130937 3300037312 Bacteria 1791
394 Ga0395900_0000595 3300037418 Bacteria 49632
395 Ga0395900_0059258 3300037418 Bacteria 3941
396 Ga0395900_0059848 3300037418 Bacteria 3920
397 Ga0395900_0117081 3300037418 Unclassified 2734
398 Ga0395900_0144792 3300037418 Bacteria 2431
399 Ga0395900_0272355 3300037418 Bacteria 1687
400 Ga0395900_0319369 3300037418 Bacteria 1534
401 Ga0395900_0430771 3300037418 Bacteria 1278
402 Ga0395900_0461693 3300037418 Bacteria 1224
403 Ga0395900_0519026 3300037418 Unclassified 1139
404 Ga0395900_0530024 3300037418 Bacteria 1125
405 Ga0395900_0683927 3300037418 Unclassified 960
406 Ga0395898_0004759 3300037466 Bacteria 14774
407 Ga0395898_0008384 3300037466 Bacteria 10930
408 Ga0395898_0034810 3300037466 Bacteria 5013
409 Ga0395898_0220414 3300037466 Bacteria 1809
410 Ga0395898_0624283 3300037466 Unclassified 1020
411 Ga0395905_0010088 3300037471 Bacteria 9206
412 Ga0395905_0010952 3300037471 Bacteria 8777
413 Ga0395905_0013917 3300037471 Bacteria 7695
414 Ga0395905_0018128 3300037471 Bacteria 6680
415 Ga0395905_0020706 3300037471 Bacteria 6228
416 Ga0395905_0024408 3300037471 Bacteria 5706
417 Ga0395905_0046114 3300037471 Unclassified 4087
418 Ga0395905_0063047 3300037471 Bacteria 3468
419 Ga0395905_0100595 3300037471 Unclassified 2714
420 Ga0395905_0121272 3300037471 Bacteria 2457
421 Ga0395905_0184151 3300037471 Unclassified 1960
422 Ga0395905_0356029 3300037471 Bacteria 1356
423 Ga0395905_0369572 3300037471 Unclassified 1327
424 Ga0395901_0004508 3300038443 Bacteria 14046
425 Ga0395901_0005682 3300038443 Bacteria 12622
426 Ga0395901_0006695 3300038443 Bacteria 11643
427 Ga0395901_0025281 3300038443 Bacteria 6096
428 Ga0395901_0043586 3300038443 Unclassified 4653
429 Ga0395901_0070730 3300038443 Bacteria 3635
430 Ga0395901_0155214 3300038443 Bacteria 2404
431 Ga0395901_0155271 3300038443 Unclassified 2404
432 Ga0395901_0246618 3300038443 Bacteria 1862
433 Ga0395901_0434511 3300038443 Bacteria 1344
434 Ga0395901_0692612 3300038443 Unclassified 1017
435 Ga0439449_0066555 3300042007 Unclassified 1329
436 Ga0466972_0018542 3300044658 Bacteria 3481
437 Ga0466961_0062322 3300044693 Bacteria 2370
438 Ga0466971_0020915 3300044719 Bacteria 2909
439 Ga0466958_0014628 3300045836 Bacteria 4480
440 Ga0466967_0278866 3300045976 Unclassified 1603
441 Ga0466967_0366401 3300045976 Bacteria 1397
442 Ga0466967_0446877 3300045976 Bacteria 1263
443 Ga0495650_0017278 3300046471 Bacteria 3622
444 Ga0495621_0014694 3300046539 Unclassified 2483
445 Ga0495621_0028286 3300046539 Unclassified 1905
446 Ga0495668_0030918 3300046616 Bacteria 3019
447 Ga0495669_0010849 3300046684 Bacteria 3857
448 Ga0495677_0092433 3300047445 Bacteria 1141
449 Ga0496107_0566758 3300048910 Unclassified 841
450 Ga0496109_0408123 3300048912 Unclassified 1283
451 Ga0496110_0003415 3300048913 Bacteria 12149
452 Ga0496112_0048960 3300048915 Bacteria 4141
453 Ga0496114_0000006 3300048917 Bacteria 472921
454 Ga0501224_011259 3300049664 Unclassified 1315
455 Ga0501235_001852 3300049669 Bacteria 4524
456 Ga0501249_000159 3300049679 Bacteria 21017
457 Ga0501249_004971 3300049679 Bacteria 2712
458 JGI24740J21852_10002403
459 MBSR1b_contig_10078088
460 JGI24736J21556_1001013
461 JGI24735J21928_10005515
462 JGI24735J21928_10016635
463 JGI24745J21846_1000157
464 JGI24738J21930_10022842
465 rootH2_10121024
466 rootL2_10311366
467 rootH1_10163472
468 rootH1_10223665
469 Ga0065712_10074159
470 Ga0065715_10122835
471 Ga0070658_10004829
472 Ga0070658_10006874
473 Ga0070658_10007726
474 Ga0070658_10014784
475 Ga0070658_10039082
476 Ga0070658_10070176
477 Ga0070658_10119195
478 Ga0070658_10195944
479 Ga0070658_10221737
480 Ga0070676_10238957
481 Ga0070683_100002629
482 Ga0070683_100016104
483 Ga0070683_100020068
484 Ga0070690_100005963
485 Ga0070690_100078798
486 Ga0070670_100000482
487 Ga0070670_100001961
488 Ga0070670_100021632
489 Ga0070670_100043866
490 Ga0070677_10000655
491 Ga0070666_10001302
492 Ga0070666_10025157
493 Ga0070680_100020196
494 Ga0070682_100044647
495 Ga0068868_100166587
496 Ga0070660_100006193
497 Ga0070660_100007226
498 Ga0070660_100053382
499 Ga0070660_100079348
500 Ga0070660_100084264
501 Ga0070660_100085989
502 Ga0070660_100156751
503 Ga0070691_10008688
504 Ga0070687_100181134
505 Ga0070661_100003992
506 Ga0070661_100005291
507 Ga0070661_100031844
508 Ga0070661_100061837
509 Ga0070692_10095609
510 Ga0070668_100017861
511 Ga0070669_100022556
512 Ga0070669_100026431
513 Ga0070675_100000877
514 Ga0070675_100002093
515 Ga0070675_100002962
516 Ga0070675_100063561
517 Ga0070671_100001443
518 Ga0070671_100003827
519 Ga0070671_100014409
520 Ga0070671_100043097
521 Ga0070671_100142308
522 Ga0070674_100002176
523 Ga0070674_100018915
524 Ga0070674_100027807
525 Ga0070674_100183092
526 Ga0070673_100002199
527 Ga0070673_100004985
528 Ga0070673_100111205
529 Ga0070659_100007018
530 Ga0070659_100009371
531 Ga0070659_100161822
532 Ga0070667_100003311
533 Ga0070667_100011143
534 Ga0070667_100053321
535 Ga0070667_100269277
536 Ga0070709_10090420
537 Ga0070714_100046635
538 Ga0070713_100123284
539 Ga0070663_100008163
540 Ga0070663_100060216
541 Ga0070663_100060410
542 Ga0070663_100062121
543 Ga0070678_100108739
544 Ga0070678_100263158
545 Ga0070662_100037197
546 Ga0070662_100058372
547 Ga0070662_100114802
548 Ga0070662_100129167
549 Ga0070662_100184816
550 Ga0070681_10063561
551 Ga0070681_10080144
552 Ga0070685_10072206
553 Ga0070685_10182155
554 Ga0070679_100166365
555 Ga0070684_100004092
556 Ga0070684_100010106
557 Ga0068853_100027959
558 Ga0068853_100132645
559 Ga0070672_100001022
560 Ga0070672_100031012
561 Ga0070686_100190226
562 Ga0070665_100001865
563 Ga0070665_100032641
564 Ga0070665_100065985
565 Ga0068855_100014977
566 Ga0068855_100019199
567 Ga0068855_100031267
568 Ga0068855_100199319
569 Ga0068855_100241090
570 Ga0068855_100249922
571 Ga0068855_100433437
572 Ga0070664_100000161
573 Ga0070664_100003503
574 Ga0070664_100011435
575 Ga0070664_100012603
576 Ga0070664_100025357
577 Ga0070664_100027281
578 Ga0070664_100033439
579 Ga0070664_100043495
580 Ga0070664_100086527
581 Ga0068857_100015317
582 Ga0068857_100112004
583 Ga0068857_100240565
584 Ga0068857_100260821
585 Ga0068854_100012828
586 Ga0068854_100029291
587 Ga0068854_100098300
588 Ga0068856_100285094
589 Ga0068856_100308754
590 Ga0068856_100338184
591 Ga0070702_100312601
592 Ga0068852_100004519
593 Ga0068852_100014915
594 Ga0068852_100037574
595 Ga0068852_100199957
596 Ga0068852_100221550
597 Ga0068864_100158787
598 Ga0068866_10138533
599 Ga0068851_10008666
600 Ga0068851_10092421
601 Ga0068851_10100987
602 Ga0068851_10106645
603 Ga0068851_10107372
604 Ga0068870_10066866
605 Ga0068863_100068000
606 Ga0068863_100183232
607 Ga0068863_100345935
608 Ga0068858_100028249
609 Ga0081539_10025535
610 Ga0097621_100013198
611 Ga0097621_100192599
612 Ga0105243_10206038
613 Ga0105241_10299016
614 Ga0105248_10010282
615 Ga0105248_10021840
616 Ga0105248_10050700
617 Ga0105248_10301208
618 Ga0105248_10327057
619 Ga0105248_10385351
620 Ga0157373_10025010
621 Ga0157373_10038965
622 Ga0157371_10090169
623 Ga0157371_10148746
624 Ga0157370_10046619
625 Ga0157370_10077871
626 Ga0157370_10089298
627 Ga0157369_10071353
628 Ga0157369_10088507
629 Ga0157369_10175311
630 Ga0157374_10002028
631 Ga0157374_10004774
632 Ga0157374_10024050
633 Ga0157378_10036398
634 Ga0157378_10090576
635 Ga0163162_10019694
636 Ga0163162_10025893
637 Ga0163162_10066915
638 Ga0157375_10011719
639 Ga0157375_10108944
640 Ga0157375_10287735
641 Ga0207697_10002640
642 Ga0207697_10028241
643 Ga0207656_10021640
644 Ga0207656_10075442
645 Ga0207656_10146690
646 Ga0207682_10001230
647 Ga0207682_10007931
648 Ga0207682_10041736
649 Ga0207688_10008268
650 Ga0207688_10045671
651 Ga0207680_10000843
652 Ga0207680_10016580
653 Ga0207647_10000652
654 Ga0207647_10000953
655 Ga0207647_10008914
656 Ga0207647_10012953
657 Ga0207647_10023651
658 Ga0207647_10092270
659 Ga0207699_10054658
660 Ga0207645_10038918
661 Ga0207645_10231033
662 Ga0207643_10011534
663 Ga0207705_10000387
664 Ga0207705_10002169
665 Ga0207705_10002376
666 Ga0207705_10004357
667 Ga0207705_10013381
668 Ga0207705_10020054
669 Ga0207705_10034432
670 Ga0207705_10072312
671 Ga0207695_10019291
672 Ga0207695_10104104
673 Ga0207671_10233281
674 Ga0207662_10158270
675 Ga0207657_10004145
676 Ga0207657_10005549
677 Ga0207657_10007353
678 Ga0207657_10007984
679 Ga0207657_10012093
680 Ga0207657_10088734
681 Ga0207657_10132037
682 Ga0207657_10158791
683 Ga0207649_10072591
684 Ga0207681_10018237
685 Ga0207681_10069414
686 Ga0207650_10003792
687 Ga0207650_10005099
688 Ga0207650_10011538
689 Ga0207650_10051214
690 Ga0207650_10086849
691 Ga0207659_10001593
692 Ga0207659_10003287
693 Ga0207659_10016021
694 Ga0207659_10160754
695 Ga0207659_10173859
696 Ga0207700_10291927
697 Ga0207700_10296864
698 Ga0207664_10034681
699 Ga0207644_10000110
700 Ga0207644_10002765
701 Ga0207644_10003194
702 Ga0207644_10039149
703 Ga0207644_10081955
704 Ga0207644_10221407
705 Ga0207644_10233532
706 Ga0207690_10003887
707 Ga0207690_10029863
708 Ga0207690_10051391
709 Ga0207706_10004761
710 Ga0207706_10009871
711 Ga0207706_10011549
712 Ga0207706_10014253
713 Ga0207706_10014818
714 Ga0207706_10016645
715 Ga0207706_10019367
716 Ga0207706_10032192
717 Ga0207706_10034788
718 Ga0207706_10089022
719 Ga0207706_10162453
720 Ga0207706_10426858
721 Ga0207709_10237546
722 Ga0207669_10033950
723 Ga0207669_10054655
724 Ga0207669_10060456
725 Ga0207669_10067163
726 Ga0207691_10022111
727 Ga0207691_10022416
728 Ga0207691_10050820
729 Ga0207711_10001548
730 Ga0207711_10005517
731 Ga0207689_10219271
732 Ga0207661_10001486
733 Ga0207679_10004156
734 Ga0207679_10026010
735 Ga0207679_10028979
736 Ga0207679_10054031
737 Ga0207679_10116292
738 Ga0207679_10365544
739 Ga0207667_10002186
740 Ga0207667_10012704
741 Ga0207651_10002266
742 Ga0207651_10008091
743 Ga0207651_10020520
744 Ga0207651_10047356
745 Ga0207651_10082268
746 Ga0207640_10037699
747 Ga0207640_10224397
748 Ga0207658_10002182
749 Ga0207658_10072193
750 Ga0207658_10404649
751 Ga0207677_10024243
752 Ga0207703_10003041
753 Ga0207639_10015848
754 Ga0207639_10078966
755 Ga0207639_10097674
756 Ga0207639_10221164
757 Ga0207678_10003264
758 Ga0207678_10007049
759 Ga0207678_10008675
760 Ga0207678_10013246
761 Ga0207678_10024610
762 Ga0207678_10230213
763 Ga0207678_10350433
764 Ga0207702_10005931
765 Ga0207702_10011089
766 Ga0207702_10019425
767 Ga0207702_10057850
768 Ga0207702_10072614
769 Ga0207702_10445863
770 Ga0207641_10047089
771 Ga0207648_10009677
772 Ga0207648_10222351
773 Ga0207676_10007954
774 Ga0207676_10094602
775 Ga0207676_10297056
776 Ga0207674_10002992
777 Ga0207674_10007460
778 Ga0207674_10033569
779 Ga0207674_10139885
780 Ga0207674_10307062
781 Ga0207675_100098339
782 Ga0207683_10033866
783 Ga0207698_10004870
784 Ga0207698_10007590
785 Ga0207698_10007964
786 Ga0207698_10009963
787 Ga0207698_10078226
788 Ga0268266_10074634
789 Ga0268266_10088211
790 Ga0268266_10226480
791 Ga0307408_100005547
792 Ga0307408_100063445
793 Ga0307408_100083793
794 Ga0307405_10030471
795 Ga0307405_10081898
796 Ga0307413_10020129
797 Ga0307413_10028933
798 Ga0307413_10047089
799 Ga0307413_10108809
800 Ga0307413_10109872
801 Ga0307413_10114615
802 Ga0307413_10154255
803 Ga0307413_10208729
804 Ga0307410_10001568
805 Ga0307410_10011884
806 Ga0307410_10013317
807 Ga0307410_10018254
808 Ga0307410_10102408
809 Ga0307406_10021903
810 Ga0307406_10042031
811 Ga0307406_10052039
812 Ga0307406_10229441
813 Ga0307407_10002341
814 Ga0307407_10035072
815 Ga0307412_10008883
816 Ga0307412_10066033
817 Ga0307409_100004859
818 Ga0307409_100007942
819 Ga0307409_100033400
820 Ga0307409_100086733
821 Ga0307409_100137083
822 Ga0307409_100271753
823 Ga0307416_100054225
824 Ga0307416_100079034
825 Ga0307416_100082497
826 Ga0307416_100102163
827 Ga0307416_100209991
828 Ga0307414_10007981
829 Ga0307414_10026446
830 Ga0307414_10226159
831 Ga0307414_10261104
832 Ga0307411_10003367
833 Ga0307411_10005225
834 Ga0307411_10019488
835 Ga0307411_10074530
836 Ga0307411_10092589
837 Ga0307411_10268436
838 Ga0307411_10320437
839 Ga0307415_100009900
840 Ga0307415_100010512
841 Ga0307415_100018520
842 Ga0307415_100029296
843 Ga0307415_100049590
844 Ga0307415_100061026
845 Ga0307415_100101625
846 Ga0307415_100336887
847 Ga0395899_0014700
848 Ga0395899_0039292
849 Ga0395899_0080661
850 Ga0395899_0130937
851 Ga0395900_0000595
852 Ga0395900_0059258
853 Ga0395900_0059848
854 Ga0395900_0117081
855 Ga0395900_0144792
856 Ga0395900_0272355
857 Ga0395900_0319369
858 Ga0395900_0430771
859 Ga0395900_0461693
860 Ga0395900_0519026
861 Ga0395900_0530024
862 Ga0395900_0683927
863 Ga0395898_0004759
864 Ga0395898_0008384
865 Ga0395898_0034810
866 Ga0395898_0220414
867 Ga0395898_0624283
868 Ga0395905_0010088
869 Ga0395905_0010952
870 Ga0395905_0013917
871 Ga0395905_0018128
872 Ga0395905_0020706
873 Ga0395905_0024408
874 Ga0395905_0046114
875 Ga0395905_0063047
876 Ga0395905_0100595
877 Ga0395905_0121272
878 Ga0395905_0184151
879 Ga0395905_0356029
880 Ga0395905_0369572
881 Ga0395901_0004508
882 Ga0395901_0005682
883 Ga0395901_0006695
884 Ga0395901_0025281
885 Ga0395901_0043586
886 Ga0395901_0070730
887 Ga0395901_0155214
888 Ga0395901_0155271
889 Ga0395901_0246618
890 Ga0395901_0434511
891 Ga0395901_0692612
892 Ga0439449_0066555
893 Ga0466972_0018542
894 Ga0466961_0062322
895 Ga0466971_0020915
896 Ga0466958_0014628
897 Ga0466967_0278866
898 Ga0466967_0366401
899 Ga0466967_0446877
900 Ga0495650_0017278
901 Ga0495621_0014694
902 Ga0495621_0028286
903 Ga0495668_0030918
904 Ga0495669_0010849
905 Ga0495677_0092433
906 Ga0496107_0566758
907 Ga0496109_0408123
908 Ga0496110_0003415
909 Ga0496112_0048960
910 Ga0496114_0000006
911 Ga0501224_011259
912 Ga0501235_001852
913 Ga0501249_000159
914 Ga0501249_004971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09721

Exosortase_EpsH

Transmembrane exosortase (Exosortase_EpsH)

249

353

0.97

PF09721

Exosortase_EpsH

Transmembrane exosortase (Exosortase_EpsH)

29

252

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zmh-assembly1.cif.gz_J cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.4317 178 262
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.3816 136 267
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.3733 136 267
7fim-assembly1.cif.gz_R cryo-em structure of the tirzepatide (ly3298176)-bound human glp-1r-gs complex 0.3639 72 280
7uwa-assembly1.cif.gz_j citrus v-atpase state 1, h in contact with subunits ab 0.3367 133 271
ID Description Score Start End Superfamily
af_P0AAS3_1_89_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4989 172 279 1.10.287.70
af_P0AAS3_1_89_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4713 172 279 1.10.287.70
af_Q54MH1_156_413_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4045 69 264 1.20.1070.10
af_P86050_27_132_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3989 175 274 1.20.1250.20
af_Q9W4H3_28_207_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3842 131 267 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A840F914-F1-model_v4 Exosortase 0.9105 12 278 GO:0005886
GO:0006508
GO:0008233
AF-A0A0W1DMN7-F1-model_v4 Exosortase 0.909 24 279 GO:0005886
GO:0006508
GO:0008233
AF-A0A841IX64-F1-model_v4 Exosortase 0.9077 7 279 GO:0005886
GO:0006508
GO:0008233
AF-A0A7H0GCX7-F1-model_v4 deleted 0.9062 1 164
AF-A0A552UIC0-F1-model_v4 Exosortase (EC 3.4.22.-) 0.9054 1 274 GO:0005886
GO:0006508
GO:0008233

Map