F447751

General Info

Members Datasets Scaffolds Average Seq Length
456 221 400 114

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10336445|Ga0105244_103364451
Length 119
Sequence MDMSVKLNLSYPAAAPQSAPAPVSNDPQQAKVDPVPAAVQTKQDSKPSDLEQAVTDIRKFVQAAQRNLEFSIDDSTHQVVVKVIATDSGEVIRQIPSETALKLAQSLHDASNVLFDAKV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231015 Pseudomonas sp. GM49 Isolate Nodule
3 2511231017 Pseudomonas sp. GM55 Isolate Nodule
4 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
5 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
6 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
7 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
8 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
9 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
10 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
11 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
12 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
13 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
14 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
15 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
16 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
17 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
18 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
19 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
20 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
21 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
22 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
23 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
24 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
25 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
26 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
27 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
28 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
29 2765235841 Pseudomonas putida AA7 Isolate Unclassified
30 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
31 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
32 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
33 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
34 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
35 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
36 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
37 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
38 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
39 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
40 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
41 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
42 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
43 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
44 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
45 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
46 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
47 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
48 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
49 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
50 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
51 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
52 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
53 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
54 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
55 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
58 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
59 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
60 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
96 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
135 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
139 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
140 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
141 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
142 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
143 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
144 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
206 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
207 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
213 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
214 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
215 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
216 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
217 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
218 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
219 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
220 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
221 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.72
Metatranscriptomes 0
Isolates 12.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.7
Nodule 0.66
Rhizoplane 2.85
Rhizosphere 74.34
Stem 0
Stem Tuber 0
Unclassified 16.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2441698 2162886007 Bacteria 2356
2 JGI25155J39150_1003435 3300002704 Bacteria 797
3 Ga0055538_1000086 3300003751 Bacteria 80460
4 Ga0055539_1000128 3300003752 Bacteria 80565
5 Ga0055533_1000185 3300003756 Bacteria 52131
6 Ga0055532_1000188 3300003758 Bacteria 51859
7 Ga0055525_1000195 3300003759 Bacteria 71342
8 Ga0055535_1003404 3300003761 Bacteria 4538
9 Ga0055530_10005528 3300003791 Bacteria 5967
10 Ga0055541_1000120 3300003841 Bacteria 52131
11 Ga0065714_10067663 3300005288 Bacteria 5300
12 Ga0065714_10067776 3300005288 Bacteria 5203
13 Ga0065714_10072024 3300005288 Bacteria 3431
14 Ga0065714_10122267 3300005288 Bacteria 1334
15 Ga0065714_10153175 3300005288 Bacteria 1094
16 Ga0065704_10007903 3300005289 Bacteria 3477
17 Ga0065712_10084822 3300005290 Bacteria 2739
18 Ga0070670_100000415 3300005331 Bacteria 35170
19 Ga0070670_100002735 3300005331 Bacteria 14563
20 Ga0070661_100000008 3300005344 Bacteria 183494
21 Ga0070669_100000847 3300005353 Bacteria 22200
22 Ga0070674_101015742 3300005356 Bacteria 728
23 Ga0070662_100001088 3300005457 Bacteria 16566
24 Ga0068853_100161510 3300005539 Bacteria 2022
25 Ga0070665_100790309 3300005548 Bacteria 962
26 Ga0070664_100000466 3300005564 Bacteria 30705
27 Ga0070664_101209741 3300005564 Bacteria 713
28 Ga0068854_100088319 3300005578 Bacteria 2302
29 Ga0068851_10000028 3300005834 Bacteria 117106
30 Ga0075364_10033752 3300006051 Bacteria 3297
31 Ga0075364_10298357 3300006051 Bacteria 1097
32 Ga0075432_10013837 3300006058 Bacteria 2744
33 Ga0075432_10028165 3300006058 Bacteria 1937
34 Ga0075432_10054549 3300006058 Bacteria 1415
35 Ga0075432_10200368 3300006058 Bacteria 789
36 Ga0075362_10016844 3300006177 Bacteria 3001
37 Ga0075436_100145937 3300006914 Bacteria 1664
38 Ga0105251_10000630 3300009011 Bacteria 32361
39 Ga0105251_10004900 3300009011 Bacteria 8929
40 Ga0105251_10005008 3300009011 Bacteria 8804
41 Ga0105251_10005989 3300009011 Bacteria 7842
42 Ga0105251_10066987 3300009011 Bacteria 1678
43 Ga0105251_10069835 3300009011 Bacteria 1637
44 Ga0105251_10109974 3300009011 Bacteria 1256
45 Ga0105244_10000558 3300009036 Bacteria 33269
46 Ga0105244_10013296 3300009036 Bacteria 4817
47 Ga0105244_10014649 3300009036 Bacteria 4529
48 Ga0105244_10034168 3300009036 Bacteria 2679
49 Ga0105244_10048675 3300009036 Bacteria 2169
50 Ga0105244_10336445 3300009036 Bacteria 696
51 Ga0105250_10000478 3300009092 Bacteria 28090
52 Ga0105250_10014770 3300009092 Bacteria 3203
53 Ga0105250_10016804 3300009092 Bacteria 2978
54 Ga0105250_10253010 3300009092 Bacteria 753
55 Ga0105243_10011479 3300009148 Bacteria 6702
56 Ga0105243_10057017 3300009148 Bacteria 3109
57 Ga0105243_10221848 3300009148 Bacteria 1672
58 Ga0105242_10032299 3300009176 Bacteria 4185
59 Ga0105242_10510889 3300009176 Bacteria 1145
60 Ga0105248_10020194 3300009177 Bacteria 7380
61 Ga0105237_10000944 3300009545 Bacteria 39047
62 Ga0105237_10099914 3300009545 Bacteria 2892
63 Ga0105246_10000349 3300011119 Bacteria 24718
64 Ga0105246_10002364 3300011119 Bacteria 11387
65 Ga0157337_1034864 3300012483 Bacteria 532
66 Ga0157373_10023042 3300013100 Bacteria 4516
67 Ga0157373_10026396 3300013100 Bacteria 4195
68 Ga0157373_10064552 3300013100 Bacteria 2592
69 Ga0157373_10268868 3300013100 Bacteria 1207
70 Ga0157373_10885820 3300013100 Bacteria 662
71 Ga0157371_10042414 3300013102 Bacteria 3243
72 Ga0157371_10307928 3300013102 Bacteria 1147
73 Ga0157371_10314218 3300013102 Bacteria 1136
74 Ga0157370_10042291 3300013104 Bacteria 4392
75 Ga0157370_10046954 3300013104 Bacteria 4140
76 Ga0157370_10302885 3300013104 Bacteria 1475
77 Ga0157370_10425341 3300013104 Bacteria 1222
78 Ga0157370_10892366 3300013104 Bacteria 807
79 Ga0157369_10071758 3300013105 Bacteria 3716
80 Ga0157369_10224987 3300013105 Bacteria 1963
81 Ga0157369_10339072 3300013105 Bacteria 1561
82 Ga0157369_10646810 3300013105 Bacteria 1090
83 Ga0163162_10008959 3300013306 Bacteria 9728
84 Ga0163162_10059257 3300013306 Bacteria 3860
85 Ga0163162_10093183 3300013306 Bacteria 3097
86 Ga0157375_10003543 3300013308 Bacteria 13559
87 Ga0157375_10007213 3300013308 Bacteria 9722
88 Ga0157375_10029682 3300013308 Bacteria 5146
89 Ga0157375_10047497 3300013308 Bacteria 4193
90 Ga0182008_10012660 3300014497 Bacteria 4449
91 Ga0182008_10019951 3300014497 Bacteria 3454
92 Ga0182008_10022376 3300014497 Bacteria 3237
93 Ga0182008_10023691 3300014497 Bacteria 3131
94 Ga0182008_10064537 3300014497 Bacteria 1803
95 Ga0182008_10098460 3300014497 Bacteria 1444
96 Ga0182006_1004238 3300015261 Bacteria 7104
97 Ga0182006_1007715 3300015261 Bacteria 4913
98 Ga0182006_1026490 3300015261 Bacteria 2372
99 Ga0182006_1065027 3300015261 Bacteria 1366
100 Ga0182007_10002191 3300015262 Bacteria 9917
101 Ga0182007_10025393 3300015262 Bacteria 2065
102 Ga0182007_10151164 3300015262 Bacteria 789
103 Ga0182005_1025767 3300015265 Bacteria 1605
104 Ga0182005_1075210 3300015265 Bacteria 930
105 Ga0182005_1142836 3300015265 Bacteria 693
106 Ga0163161_10004730 3300017792 Bacteria 9467
107 Ga0163161_10023345 3300017792 Bacteria 4364
108 Ga0163161_10024319 3300017792 Bacteria 4279
109 Ga0163161_10036123 3300017792 Bacteria 3538
110 Ga0163161_10045676 3300017792 Bacteria 3159
111 Ga0163161_10078052 3300017792 Bacteria 2433
112 Ga0163161_10095852 3300017792 Bacteria 2202
113 Ga0209435_100199 3300025206 Bacteria 17490
114 Ga0209784_100017 3300025224 Bacteria 472003
115 Ga0209566_100014 3300025225 Bacteria 472003
116 Ga0209674_100028 3300025226 Bacteria 472003
117 Ga0209147_100038 3300025229 Bacteria 314497
118 Ga0209563_100032 3300025230 Bacteria 472003
119 Ga0209258_100409 3300025242 Bacteria 51954
120 Ga0209646_1000469 3300025246 Bacteria 20378
121 Ga0209677_100018 3300025253 Bacteria 472003
122 Ga0209759_1040392 3300025256 Bacteria 810
123 Ga0209676_1003009 3300025292 Bacteria 10960
124 Ga0209050_1001829 3300025298 Bacteria 20690
125 Ga0209051_1004624 3300025303 Bacteria 8383
126 Ga0207656_10000095 3300025321 Bacteria 33160
127 Ga0207696_1000043 3300025711 Bacteria 307112
128 Ga0207696_1014164 3300025711 Bacteria 2745
129 Ga0207696_1033119 3300025711 Bacteria 1550
130 Ga0207655_1000095 3300025728 Bacteria 195899
131 Ga0207655_1004602 3300025728 Bacteria 9712
132 Ga0207655_1005173 3300025728 Bacteria 8975
133 Ga0207655_1019861 3300025728 Bacteria 3486
134 Ga0207655_1068992 3300025728 Bacteria 1323
135 Ga0207713_1001453 3300025735 Bacteria 18875
136 Ga0207713_1003068 3300025735 Bacteria 11610
137 Ga0207713_1006718 3300025735 Bacteria 6950
138 Ga0207713_1016219 3300025735 Bacteria 3790
139 Ga0207713_1105679 3300025735 Bacteria 964
140 Ga0207671_10000035 3300025914 Bacteria 237603
141 Ga0207671_10258116 3300025914 Bacteria 1371
142 Ga0207649_10000017 3300025920 Bacteria 225193
143 Ga0207681_10056734 3300025923 Bacteria 2672
144 Ga0207650_10000180 3300025925 Bacteria 74406
145 Ga0207650_10000181 3300025925 Bacteria 73955
146 Ga0207706_10001223 3300025933 Bacteria 25958
147 Ga0207686_10072263 3300025934 Bacteria 2223
148 Ga0207709_10138847 3300025935 Bacteria 1668
149 Ga0207711_10114631 3300025941 Bacteria 2400
150 Ga0207679_10000005 3300025945 Bacteria 525011
151 Ga0207640_10188094 3300025981 Bacteria 1554
152 Ga0207639_10003532 3300026041 Bacteria 10497
153 Ga0207428_10004544 3300027907 Bacteria 13156
154 Ga0207428_10763126 3300027907 Bacteria 689
155 Ga0268266_10374959 3300028379 Bacteria 1341
156 Ga0307509_10089061 3300031507 Bacteria 3166
157 Ga0307408_100004438 3300031548 Bacteria 9525
158 Ga0307405_10024760 3300031731 Bacteria 3434
159 Ga0307405_10198156 3300031731 Bacteria 1456
160 Ga0307406_10230769 3300031901 Bacteria 1382
161 Ga0307407_10207362 3300031903 Bacteria 1317
162 Ga0307412_10007691 3300031911 Bacteria 6124
163 Ga0307412_10087634 3300031911 Bacteria 2169
164 Ga0307414_10039786 3300032004 Bacteria 3170
165 Ga0307411_10015604 3300032005 Bacteria 4273
166 Ga0439438_001347 3300041405 Bacteria 10868
167 Ga0439438_001764 3300041405 Bacteria 9503
168 Ga0439438_008239 3300041405 Bacteria 3479
169 Ga0439438_051863 3300041405 Bacteria 1041
170 Ga0439447_001622 3300041407 Bacteria 8250
171 Ga0439447_002268 3300041407 Bacteria 7058
172 Ga0439447_005403 3300041407 Bacteria 4257
173 Ga0439466_0000391 3300041411 Bacteria 16755
174 Ga0439466_0001462 3300041411 Bacteria 9220
175 Ga0439466_0008341 3300041411 Bacteria 3905
176 Ga0439448_0025702 3300042005 Bacteria 1848
177 Ga0439432_000763 3300042006 Bacteria 12060
178 Ga0439452_000569 3300042010 Bacteria 19274
179 Ga0439452_001503 3300042010 Bacteria 9450
180 Ga0439452_010793 3300042010 Bacteria 2643
181 Ga0439456_002051 3300042013 Bacteria 4051
182 Ga0439456_002545 3300042013 Bacteria 3669
183 Ga0439456_008354 3300042013 Bacteria 2136
184 Ga0439456_092560 3300042013 Bacteria 680
185 Ga0439463_002470 3300042016 Bacteria 4695
186 Ga0439463_006080 3300042016 Bacteria 2997
187 Ga0450911_001697 3300042115 Bacteria 4846
188 Ga0450911_002743 3300042115 Bacteria 3336
189 Ga0450894_003642 3300042131 Bacteria 2013
190 Ga0450902_008466 3300042137 Bacteria 1608
191 Ga0450902_027390 3300042137 Bacteria 955
192 Ga0450903_020694 3300042138 Bacteria 1017
193 Ga0450903_045542 3300042138 Bacteria 646
194 Ga0439446_0002699 3300042156 Bacteria 4292
195 Ga0450909_000873 3300042185 Bacteria 4112
196 Ga0450909_074064 3300042185 Bacteria 547
197 Ga0439434_0000365 3300042435 Bacteria 12934
198 Ga0450918_044327 3300042531 Bacteria 802
199 Ga0495617_127126 3300046452 Bacteria 819
200 Ga0495627_000467 3300046453 Bacteria 34894
201 Ga0495627_002108 3300046453 Bacteria 10068
202 Ga0495590_0079593 3300046457 Bacteria 1154
203 Ga0495591_000666 3300046458 Bacteria 25355
204 Ga0495591_008637 3300046458 Bacteria 4150
205 Ga0495591_011726 3300046458 Bacteria 3299
206 Ga0495638_0003162 3300046460 Bacteria 13029
207 Ga0495638_0030903 3300046460 Bacteria 3443
208 Ga0495638_0052824 3300046460 Bacteria 2530
209 Ga0495638_0058114 3300046460 Bacteria 2397
210 Ga0495638_0154088 3300046460 Bacteria 1331
211 Ga0495650_0018374 3300046471 Bacteria 3475
212 Ga0495605_0020174 3300046474 Bacteria 3544
213 Ga0495584_0001880 3300046491 Bacteria 12122
214 Ga0495584_0012956 3300046491 Bacteria 4257
215 Ga0495584_0038118 3300046491 Bacteria 2430
216 Ga0495584_0051504 3300046491 Bacteria 2073
217 Ga0495585_0000483 3300046492 Bacteria 37827
218 Ga0495585_0044719 3300046492 Bacteria 2473
219 Ga0495607_0001819 3300046501 Bacteria 18202
220 Ga0495607_0009662 3300046501 Bacteria 6517
221 Ga0495607_0021437 3300046501 Bacteria 4066
222 Ga0495607_0244014 3300046501 Bacteria 867
223 Ga0495583_0010364 3300046506 Bacteria 5442
224 Ga0495583_0014753 3300046506 Bacteria 4289
225 Ga0495583_0018751 3300046506 Bacteria 3633
226 Ga0495606_0005631 3300046507 Bacteria 11879
227 Ga0495606_0007774 3300046507 Bacteria 9487
228 Ga0495606_0021423 3300046507 Bacteria 4734
229 Ga0495606_0030668 3300046507 Bacteria 3752
230 Ga0495606_0105814 3300046507 Bacteria 1705
231 Ga0495610_0015756 3300046512 Bacteria 4379
232 Ga0495610_0017476 3300046512 Bacteria 4087
233 Ga0495610_0026237 3300046512 Bacteria 3113
234 Ga0495610_0055444 3300046512 Bacteria 1910
235 Ga0495610_0075579 3300046512 Bacteria 1559
236 Ga0495610_0277475 3300046512 Bacteria 654
237 Ga0495610_0353745 3300046512 Bacteria 552
238 Ga0495616_0004120 3300046513 Bacteria 9223
239 Ga0495616_0014408 3300046513 Bacteria 4425
240 Ga0495616_0023159 3300046513 Bacteria 3344
241 Ga0495620_0002749 3300046515 Bacteria 10133
242 Ga0495620_0085002 3300046515 Bacteria 1275
243 Ga0495631_0145638 3300046518 Bacteria 1017
244 Ga0495632_0003425 3300046519 Bacteria 11272
245 Ga0495632_0014966 3300046519 Bacteria 4367
246 Ga0495632_0028453 3300046519 Bacteria 2916
247 Ga0495632_0044809 3300046519 Bacteria 2206
248 Ga0495632_0055173 3300046519 Bacteria 1945
249 Ga0495632_0136616 3300046519 Bacteria 1139
250 Ga0495637_0002915 3300046520 Bacteria 9239
251 Ga0495637_0018083 3300046520 Bacteria 3273
252 Ga0495637_0018101 3300046520 Bacteria 3271
253 Ga0495637_0030551 3300046520 Bacteria 2389
254 Ga0495637_0039196 3300046520 Bacteria 2046
255 Ga0495637_0162679 3300046520 Bacteria 836
256 Ga0495643_0003865 3300046522 Bacteria 10783
257 Ga0495643_0093201 3300046522 Bacteria 1551
258 Ga0495644_0000924 3300046523 Bacteria 12207
259 Ga0495644_0002594 3300046523 Bacteria 7183
260 Ga0495648_0003534 3300046524 Bacteria 13690
261 Ga0495648_0106956 3300046524 Bacteria 1530
262 Ga0495654_0003565 3300046530 Bacteria 9487
263 Ga0495654_0005093 3300046530 Bacteria 7684
264 Ga0495654_0013132 3300046530 Bacteria 4435
265 Ga0495654_0013394 3300046530 Bacteria 4389
266 Ga0495654_0015808 3300046530 Bacteria 4002
267 Ga0495654_0016771 3300046530 Bacteria 3861
268 Ga0495654_0167113 3300046530 Bacteria 961
269 Ga0495609_0156532 3300046538 Bacteria 968
270 Ga0495609_0215312 3300046538 Bacteria 799
271 Ga0495597_0011515 3300046542 Bacteria 4287
272 Ga0495597_0017506 3300046542 Bacteria 3370
273 Ga0495597_0027176 3300046542 Bacteria 2624
274 Ga0495597_0041041 3300046542 Bacteria 2068
275 Ga0495597_0147803 3300046542 Bacteria 965
276 Ga0495622_0010993 3300046557 Bacteria 4176
277 Ga0495656_0081957 3300046615 Bacteria 1458
278 Ga0495611_0009856 3300046648 Bacteria 4041
279 Ga0495611_0271353 3300046648 Bacteria 784
280 Ga0495625_0022388 3300046660 Bacteria 4845
281 Ga0495661_0000365 3300046665 Bacteria 49049
282 Ga0495661_0032057 3300046665 Bacteria 3325
283 Ga0495661_0032712 3300046665 Bacteria 3286
284 Ga0495588_0011390 3300046674 Bacteria 4171
285 Ga0495613_0675061 3300046689 Bacteria 682
286 Ga0495670_0001679 3300046691 Bacteria 10868
287 Ga0495671_0003338 3300046692 Bacteria 9908
288 Ga0495671_0014640 3300046692 Bacteria 4216
289 Ga0495671_0015347 3300046692 Bacteria 4107
290 Ga0495671_0038181 3300046692 Bacteria 2427
291 Ga0495649_0004193 3300046694 Bacteria 9462
292 Ga0495649_0011786 3300046694 Bacteria 5114
293 Ga0495649_0012755 3300046694 Bacteria 4873
294 Ga0495649_0015299 3300046694 Bacteria 4368
295 Ga0495649_0031885 3300046694 Bacteria 2905
296 Ga0495589_0007865 3300046794 Bacteria 5581
297 Ga0495660_0011127 3300046810 Bacteria 5224
298 Ga0495660_0041056 3300046810 Bacteria 2563
299 Ga0495660_0085724 3300046810 Bacteria 1645
300 Ga0495660_0212976 3300046810 Bacteria 915
301 Ga0495660_0232199 3300046810 Bacteria 864
302 Ga0495672_0002852 3300047320 Bacteria 15358
303 Ga0495672_0007647 3300047320 Bacteria 8107
304 Ga0495672_0014007 3300047320 Bacteria 5510
305 Ga0495672_0018238 3300047320 Bacteria 4669
306 Ga0495672_0032589 3300047320 Bacteria 3239
307 Ga0495672_0039812 3300047320 Bacteria 2855
308 Ga0495672_0055617 3300047320 Bacteria 2308
309 Ga0495672_0087274 3300047320 Bacteria 1723
310 Ga0495683_0004317 3300047323 Bacteria 8102
311 Ga0495683_0065376 3300047323 Bacteria 1794
312 Ga0495679_005662 3300047446 Bacteria 5510
313 Ga0495679_007320 3300047446 Bacteria 4615
314 Ga0495679_008074 3300047446 Bacteria 4315
315 Ga0495679_011536 3300047446 Bacteria 3403
316 Ga0495679_204694 3300047446 Bacteria 518
317 Ga0495673_0003847 3300047469 Bacteria 9686
318 Ga0495673_0013686 3300047469 Bacteria 4249
319 Ga0495673_0027627 3300047469 Bacteria 2697
320 Ga0495681_0006559 3300047470 Bacteria 7624
321 Ga0495681_0014525 3300047470 Bacteria 4506
322 Ga0495681_0015689 3300047470 Bacteria 4277
323 Ga0495681_0015814 3300047470 Bacteria 4257
324 Ga0495681_0032314 3300047470 Bacteria 2636
325 Ga0495681_0036702 3300047470 Bacteria 2421
326 Ga0495681_0053307 3300047470 Bacteria 1894
327 Ga0495681_0064008 3300047470 Bacteria 1686
328 Ga0495686_0185254 3300047472 Bacteria 1203
329 Ga0495626_0003170 3300048091 Bacteria 10718
330 Ga0495626_0177573 3300048091 Bacteria 884
331 Ga0495626_0307398 3300048091 Bacteria 625
332 Ga0496102_0244725 3300048905 Bacteria 1691
333 Ga0496110_0204336 3300048913 Bacteria 1795
334 Ga0496110_0285174 3300048913 Bacteria 1504
335 Ga0496111_0572168 3300048914 Bacteria 828
336 Ga0496117_0000500 3300048920 Bacteria 64714
337 Ga0496117_0027921 3300048920 Bacteria 4379
338 Ga0496117_0032557 3300048920 Bacteria 3959
339 Ga0496117_0053427 3300048920 Bacteria 2838
340 Ga0496118_0026015 3300048921 Bacteria 4998
341 Ga0496118_0033080 3300048921 Bacteria 4249
342 Ga0496118_0033533 3300048921 Bacteria 4210
343 Ga0496119_0006068 3300048922 Bacteria 11322
344 Ga0496119_0023050 3300048922 Bacteria 4431
345 Ga0496119_0130542 3300048922 Bacteria 1370
346 Ga0496120_0011715 3300048923 Bacteria 6012
347 Ga0496120_0017968 3300048923 Bacteria 4568
348 Ga0496120_0020652 3300048923 Bacteria 4177
349 Ga0496120_0058118 3300048923 Bacteria 2173
350 Ga0496121_0038904 3300048924 Bacteria 4201
351 Ga0496121_0039238 3300048924 Bacteria 4177
352 Ga0496122_0025472 3300048925 Bacteria 5135
353 Ga0496122_0033137 3300048925 Bacteria 4256
354 Ga0496122_0044131 3300048925 Bacteria 3483
355 Ga0496122_0061193 3300048925 Bacteria 2765
356 Ga0496122_0084975 3300048925 Bacteria 2186
357 Ga0496122_0099363 3300048925 Bacteria 1951
358 Ga0496122_0461547 3300048925 Bacteria 627
359 Ga0496122_0610675 3300048925 Bacteria 508
360 Ga0496123_0012739 3300048926 Bacteria 7132
361 Ga0496123_0027766 3300048926 Bacteria 4207
362 Ga0496123_0065250 3300048926 Bacteria 2315
363 Ga0496123_0078682 3300048926 Bacteria 2018
364 Ga0496123_0078972 3300048926 Bacteria 2013
365 Ga0496124_0002106 3300048927 Bacteria 26863
366 Ga0496124_0002611 3300048927 Bacteria 23246
367 Ga0496124_0031144 3300048927 Bacteria 4725
368 Ga0496124_0034177 3300048927 Bacteria 4465
369 Ga0496124_0038507 3300048927 Bacteria 4151
370 Ga0496124_0039969 3300048927 Bacteria 4060
371 Ga0496124_0040002 3300048927 Bacteria 4058
372 Ga0496124_0062715 3300048927 Bacteria 3109
373 Ga0496125_0000451 3300048928 Bacteria 74695
374 Ga0496125_0009743 3300048928 Bacteria 9806
375 Ga0496125_0035552 3300048928 Bacteria 4366
376 Ga0496125_0037522 3300048928 Bacteria 4210
377 Ga0496125_0052431 3300048928 Bacteria 3354
378 Ga0496125_0071934 3300048928 Bacteria 2698
379 Ga0496125_0220237 3300048928 Bacteria 1223
380 Ga0496125_0679709 3300048928 Bacteria 550
381 Ga0496126_0018503 3300048929 Bacteria 6898
382 Ga0496126_0023848 3300048929 Bacteria 5922
383 Ga0496126_0036547 3300048929 Bacteria 4591
384 Ga0496126_0055256 3300048929 Bacteria 3593
385 Ga0496126_0131380 3300048929 Bacteria 2163
386 Ga0495678_003080 3300049459 Bacteria 10575
387 Ga0495678_003337 3300049459 Bacteria 9997
388 Ga0495678_006713 3300049459 Bacteria 6072
389 Ga0495678_014867 3300049459 Bacteria 3605
390 Ga0495678_181779 3300049459 Bacteria 659
391 Ga0495682_0000205 3300049460 Bacteria 47503
392 Ga0495682_0071230 3300049460 Bacteria 1251
393 Ga0501290_002542 3300049513 Bacteria 2347
394 nmdc:mga03683_17020_c1 3300050489 Bacteria 2744
395 nmdc:mga00v17_28824_c1 3300050491 Bacteria 3254
396 nmdc:mga00v17_492576_c1 3300050491 Bacteria 795
397 nmdc:mga08x19_249965_c1 3300050514 Bacteria 1224
398 nmdc:mga08x19_62421_c1 3300050514 Bacteria 2416
399 Ga0500568_0092336 3300053139 Bacteria 1141
400 Ga0500634_0043673 3300053161 Bacteria 2428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0004120 Ga0495616_0004120_7858_8226 94
2 3300014497 Ga0182008_10098460 Ga0182008_100984602 97
3 3300015261 Ga0182006_1007715 Ga0182006_10077152 97
4 3300015265 Ga0182005_1075210 Ga0182005_10752102 97
5 3300006051 Ga0075364_10033752 Ga0075364_100337522 99
6 3300050491 nmdc:mga00v17_28824_c1 nmdc:mga00v17_28824_c1_2264_2608 99
7 3300009036 Ga0105244_10034168 Ga0105244_100341682 100
8 3300009176 Ga0105242_10032299 Ga0105242_100322992 100
9 3300009545 Ga0105237_10000944 Ga0105237_1000094430 100
10 3300013104 Ga0157370_10042291 Ga0157370_100422915 100
11 3300013308 Ga0157375_10029682 Ga0157375_100296823 100
12 3300025728 Ga0207655_1068992 Ga0207655_10689922 100
13 3300025914 Ga0207671_10000035 Ga0207671_1000003549 100
14 3300025934 Ga0207686_10072263 Ga0207686_100722632 100
15 3300048925 Ga0496122_0099363 Ga0496122_0099363_1436_1753 101
16 3300048926 Ga0496123_0078972 Ga0496123_0078972_879_1196 101
17 3300014497 Ga0182008_10022376 Ga0182008_100223764 102
18 3300015262 Ga0182007_10151164 Ga0182007_101511642 102
19 3300015265 Ga0182005_1142836 Ga0182005_11428362 102
20 3300048927 Ga0496124_0038507 Ga0496124_0038507_2920_3270 102
21 3300048929 Ga0496126_0036547 Ga0496126_0036547_1673_2035 102
22 3300046460 Ga0495638_0052824 Ga0495638_0052824_16_363 103
23 3300046501 Ga0495607_0001819 Ga0495607_0001819_2603_2950 103
24 3300046519 Ga0495632_0028453 Ga0495632_0028453_2280_2627 103
25 3300046520 Ga0495637_0162679 Ga0495637_0162679_18_365 103
26 3300046542 Ga0495597_0041041 Ga0495597_0041041_1136_1483 103
27 3300046648 Ga0495611_0271353 Ga0495611_0271353_352_699 103
28 3300047470 Ga0495681_0036702 Ga0495681_0036702_946_1293 103
29 3300047472 Ga0495686_0185254 Ga0495686_0185254_236_583 103
30 3300048091 Ga0495626_0307398 Ga0495626_0307398_160_522 103
31 3300049459 Ga0495678_003337 Ga0495678_003337_2808_3170 103
32 3300046522 Ga0495643_0003865 Ga0495643_0003865_8640_8987 104
33 3300046542 Ga0495597_0017506 Ga0495597_0017506_2107_2454 104
34 3300046694 Ga0495649_0015299 Ga0495649_0015299_1453_1800 104
35 3300047469 Ga0495673_0003847 Ga0495673_0003847_6734_7102 105
36 3300015262 Ga0182007_10025393 Ga0182007_100253932 106
37 3300009011 Ga0105251_10005008 Ga0105251_100050087 108
38 3300009092 Ga0105250_10016804 Ga0105250_100168044 108
39 3300025711 Ga0207696_1014164 Ga0207696_10141642 108
40 3300025735 Ga0207713_1016219 Ga0207713_10162193 108
41 3300048920 Ga0496117_0000500 Ga0496117_0000500_15547_15909 108
42 3300048922 Ga0496119_0006068 Ga0496119_0006068_8267_8629 108
43 3300048923 Ga0496120_0011715 Ga0496120_0011715_2500_2862 108
44 3300048925 Ga0496122_0033137 Ga0496122_0033137_1360_1722 108
45 3300048926 Ga0496123_0012739 Ga0496123_0012739_103_465 108
46 3300048927 Ga0496124_0002106 Ga0496124_0002106_3158_3520 108
47 3300048929 Ga0496126_0055256 Ga0496126_0055256_819_1181 108
48 iso_pu_bacteria 2597489888 2597865138 109
49 iso_pu_bacteria 2643221571 2643874264 109
50 iso_pu_bacteria 2643221713 2644621971 109
51 iso_pu_bacteria 2738543015 2739261049 109
52 iso_pu_bacteria 2765235841 2765582772 109
53 iso_pu_bacteria 8056137416 8056141432 109
54 iso_pu_bacteria 2597489889 2597870997 110
55 iso_pu_bacteria 2600255296 2601689605 110
56 iso_pu_bacteria 2619619299 2621298306 110
57 iso_pu_bacteria 2721755607 2723249891 110
58 iso_pu_bacteria 2816332298 2817492549 110
59 iso_pu_bacteria 2908446538 2908451046 110
60 iso_pu_bacteria 2929189879 2929193678 110
61 iso_pu_bacteria 2947233263 2947238977 110
62 iso_pu_bacteria 8056131705 8056135907 110
63 iso_pu_bacteria 8056148874 8056153232 110
64 3300009011 Ga0105251_10066987 Ga0105251_100669873 111
65 3300025728 Ga0207655_1019861 Ga0207655_10198612 111
66 3300025735 Ga0207713_1105679 Ga0207713_11056792 111
67 3300046810 Ga0495660_0085724 Ga0495660_0085724_170_520 111
68 3300048925 Ga0496122_0610675 Ga0496122_0610675_53_403 111
69 3300049460 Ga0495682_0000205 Ga0495682_0000205_29417_29761 111
70 iso_pu_bacteria 2511231017 2511334422 111
71 iso_pu_bacteria 2946027586 2946032144 111
72 3300047470 Ga0495681_0006559 Ga0495681_0006559_2524_2865 112
73 iso_pu_bacteria 2511231015 2511322006 112
74 iso_pu_bacteria 2599185167 2599400269 112
75 iso_pu_bacteria 2599185179 2599451400 112
76 iso_pu_bacteria 2599185189 2599508715 112
77 iso_pu_bacteria 2599185190 2599512574 112
78 iso_pu_bacteria 2599185191 2599519923 112
79 iso_pu_bacteria 2599185288 2599878479 112
80 iso_pu_bacteria 2599185290 2599891250 112
81 iso_pu_bacteria 2599185303 2599947682 112
82 iso_pu_bacteria 2643221650 2644281771 112
83 iso_pu_bacteria 2675903420 2677899921 112
84 iso_pu_bacteria 2675903515 2678262463 112
85 iso_pu_bacteria 2738541265 2738671309 112
86 iso_pu_bacteria 2738541282 2738749703 112
87 iso_pu_bacteria 2738541294 2738808436 112
88 iso_pu_bacteria 2738541303 2738858743 112
89 iso_pu_bacteria 2738541309 2738895796 112
90 iso_pu_bacteria 2744054620 2745008807 112
91 iso_pu_bacteria 2808606385 2808977846 112
92 iso_pu_bacteria 2808606388 2808993326 112
93 iso_pu_bacteria 2834028612 2834031858 112
94 iso_pu_bacteria 2842826826 2842827637 112
95 iso_pu_bacteria 2842837860 2842841254 112
96 iso_pu_bacteria 2852612431 2852613083 112
97 iso_pu_bacteria 2852667396 2852669182 112
98 iso_pu_bacteria 2860867994 2860871641 112
99 iso_pu_bacteria 2913036834 2913038436 112
100 iso_pu_bacteria 2923586266 2923587444 112
101 iso_pu_bacteria 2931390751 2931395002 112
102 iso_pu_bacteria 2945928738 2945932305 112
103 iso_pu_bacteria 2945961074 2945965235 112
104 iso_pu_bacteria 2946006987 2946008494 112
105 iso_pu_bacteria 8054285046 8054290514 112
106 iso_pu_bacteria 8054347763 8054350738 112
107 iso_pu_bacteria 8054503363 8054507510 112
108 iso_pu_bacteria 8055817908 8055822452 112
109 iso_pu_bacteria 8056161164 8056162116 112
110 iso_pu_bacteria 8056177738 8056181073 112
111 3300002704 JGI25155J39150_1003435 JGI25155J39150_10034352 113
112 3300003751 Ga0055538_1000086 Ga0055538_100008639 113
113 3300003752 Ga0055539_1000128 Ga0055539_100012839 113
114 3300003756 Ga0055533_1000185 Ga0055533_100018511 113
115 3300003758 Ga0055532_1000188 Ga0055532_100018845 113
116 3300003759 Ga0055525_1000195 Ga0055525_100019534 113
117 3300003761 Ga0055535_1003404 Ga0055535_10034042 113
118 3300003791 Ga0055530_10005528 Ga0055530_100055285 113
119 3300003841 Ga0055541_1000120 Ga0055541_100012011 113
120 3300006058 Ga0075432_10013837 Ga0075432_100138375 113
121 3300006058 Ga0075432_10200368 Ga0075432_102003682 113
122 3300009011 Ga0105251_10000630 Ga0105251_100006306 113
123 3300009011 Ga0105251_10069835 Ga0105251_100698352 113
124 3300025206 Ga0209435_100199 Ga0209435_10019910 113
125 3300025224 Ga0209784_100017 Ga0209784_100017206 113
126 3300025225 Ga0209566_100014 Ga0209566_100014206 113
127 3300025226 Ga0209674_100028 Ga0209674_100028206 113
128 3300025229 Ga0209147_100038 Ga0209147_10003861 113
129 3300025230 Ga0209563_100032 Ga0209563_100032206 113
130 3300025242 Ga0209258_100409 Ga0209258_10040944 113
131 3300025246 Ga0209646_1000469 Ga0209646_100046912 113
132 3300025253 Ga0209677_100018 Ga0209677_100018206 113
133 3300025256 Ga0209759_1040392 Ga0209759_10403922 113
134 3300025292 Ga0209676_1003009 Ga0209676_10030095 113
135 3300025298 Ga0209050_1001829 Ga0209050_100182913 113
136 3300025303 Ga0209051_1004624 Ga0209051_10046245 113
137 3300025735 Ga0207713_1006718 Ga0207713_10067184 113
138 3300027907 Ga0207428_10004544 Ga0207428_100045446 113
139 3300046460 Ga0495638_0003162 Ga0495638_0003162_2545_2889 113
140 3300046460 Ga0495638_0030903 Ga0495638_0030903_1418_1762 113
141 3300046471 Ga0495650_0018374 Ga0495650_0018374_2722_3066 113
142 3300046491 Ga0495584_0012956 Ga0495584_0012956_1408_1752 113
143 3300046492 Ga0495585_0000483 Ga0495585_0000483_10112_10456 113
144 3300046501 Ga0495607_0021437 Ga0495607_0021437_1505_1849 113
145 3300046515 Ga0495620_0085002 Ga0495620_0085002_670_1014 113
146 3300046523 Ga0495644_0000924 Ga0495644_0000924_3552_3896 113
147 3300046524 Ga0495648_0003534 Ga0495648_0003534_10599_10943 113
148 3300046538 Ga0495609_0156532 Ga0495609_0156532_228_572 113
149 3300046648 Ga0495611_0009856 Ga0495611_0009856_174_518 113
150 3300046692 Ga0495671_0003338 Ga0495671_0003338_2517_2861 113
151 3300046810 Ga0495660_0212976 Ga0495660_0212976_418_762 113
152 3300047320 Ga0495672_0002852 Ga0495672_0002852_8099_8443 113
153 3300047320 Ga0495672_0007647 Ga0495672_0007647_4969_5313 113
154 3300047320 Ga0495672_0055617 Ga0495672_0055617_1525_1869 113
155 3300047323 Ga0495683_0004317 Ga0495683_0004317_2681_3025 113
156 3300047470 Ga0495681_0064008 Ga0495681_0064008_1125_1469 113
157 3300048914 Ga0496111_0572168 Ga0496111_0572168_264_617 113
158 3300048927 Ga0496124_0002611 Ga0496124_0002611_3338_3691 113
159 3300048928 Ga0496125_0679709 Ga0496125_0679709_53_406 113
160 3300048929 Ga0496126_0018503 Ga0496126_0018503_5190_5543 113
161 3300005331 Ga0070670_100000415 Ga0070670_10000041523 114
162 3300025925 Ga0207650_10000181 Ga0207650_1000018129 114
163 3300046519 Ga0495632_0014966 Ga0495632_0014966_1473_1817 114
164 3300005288 Ga0065714_10122267 Ga0065714_101222672 115
165 3300006058 Ga0075432_10028165 Ga0075432_100281652 115
166 3300006914 Ga0075436_100145937 Ga0075436_1001459372 115
167 3300013105 Ga0157369_10646810 Ga0157369_106468102 115
168 3300014497 Ga0182008_10064537 Ga0182008_100645372 115
169 3300041405 Ga0439438_001347 Ga0439438_001347_2738_3085 115
170 3300041405 Ga0439438_001764 Ga0439438_001764_2461_2808 115
171 3300041407 Ga0439447_002268 Ga0439447_002268_2429_2776 115
172 3300041407 Ga0439447_005403 Ga0439447_005403_1349_1696 115
173 3300041411 Ga0439466_0000391 Ga0439466_0000391_9786_10133 115
174 3300041411 Ga0439466_0008341 Ga0439466_0008341_1130_1477 115
175 3300042006 Ga0439432_000763 Ga0439432_000763_2794_3141 115
176 3300042010 Ga0439452_001503 Ga0439452_001503_2427_2774 115
177 3300042010 Ga0439452_010793 Ga0439452_010793_1099_1446 115
178 3300042013 Ga0439456_002051 Ga0439456_002051_2453_2800 115
179 3300042013 Ga0439456_092560 Ga0439456_092560_245_592 115
180 3300042137 Ga0450902_008466 Ga0450902_008466_1105_1452 115
181 3300042138 Ga0450903_045542 Ga0450903_045542_44_391 115
182 3300042156 Ga0439446_0002699 Ga0439446_0002699_2894_3241 115
183 3300042185 Ga0450909_000873 Ga0450909_000873_2397_2744 115
184 3300042185 Ga0450909_074064 Ga0450909_074064_149_496 115
185 3300042435 Ga0439434_0000365 Ga0439434_0000365_9838_10185 115
186 3300042531 Ga0450918_044327 Ga0450918_044327_175_522 115
187 3300046453 Ga0495627_002108 Ga0495627_002108_6868_7215 115
188 3300046457 Ga0495590_0079593 Ga0495590_0079593_172_519 115
189 3300046458 Ga0495591_011726 Ga0495591_011726_382_729 115
190 3300046460 Ga0495638_0058114 Ga0495638_0058114_963_1310 115
191 3300046460 Ga0495638_0154088 Ga0495638_0154088_661_1008 115
192 3300046474 Ga0495605_0020174 Ga0495605_0020174_929_1276 115
193 3300046491 Ga0495584_0001880 Ga0495584_0001880_2599_2946 115
194 3300046491 Ga0495584_0038118 Ga0495584_0038118_17_364 115
195 3300046491 Ga0495584_0051504 Ga0495584_0051504_300_647 115
196 3300046492 Ga0495585_0044719 Ga0495585_0044719_1208_1555 115
197 3300046506 Ga0495583_0010364 Ga0495583_0010364_3307_3654 115
198 3300046506 Ga0495583_0014753 Ga0495583_0014753_2564_2911 115
199 3300046512 Ga0495610_0015756 Ga0495610_0015756_2585_2932 115
200 3300046512 Ga0495610_0353745 Ga0495610_0353745_46_393 115
201 3300046513 Ga0495616_0014408 Ga0495616_0014408_3310_3657 115
202 3300046513 Ga0495616_0023159 Ga0495616_0023159_1172_1519 115
203 3300046518 Ga0495631_0145638 Ga0495631_0145638_379_741 115
204 3300046519 Ga0495632_0044809 Ga0495632_0044809_1676_2023 115
205 3300046519 Ga0495632_0055173 Ga0495632_0055173_985_1332 115
206 3300046520 Ga0495637_0002915 Ga0495637_0002915_6526_6873 115
207 3300046520 Ga0495637_0030551 Ga0495637_0030551_1124_1471 115
208 3300046520 Ga0495637_0039196 Ga0495637_0039196_955_1302 115
209 3300046522 Ga0495643_0093201 Ga0495643_0093201_307_654 115
210 3300046523 Ga0495644_0002594 Ga0495644_0002594_4222_4569 115
211 3300046524 Ga0495648_0106956 Ga0495648_0106956_918_1265 115
212 3300046530 Ga0495654_0013132 Ga0495654_0013132_1608_1955 115
213 3300046530 Ga0495654_0013394 Ga0495654_0013394_1335_1682 115
214 3300046530 Ga0495654_0167113 Ga0495654_0167113_192_539 115
215 3300046538 Ga0495609_0215312 Ga0495609_0215312_206_553 115
216 3300046542 Ga0495597_0011515 Ga0495597_0011515_2332_2679 115
217 3300046542 Ga0495597_0027176 Ga0495597_0027176_1088_1435 115
218 3300046557 Ga0495622_0010993 Ga0495622_0010993_1263_1610 115
219 3300046615 Ga0495656_0081957 Ga0495656_0081957_718_1065 115
220 3300046660 Ga0495625_0022388 Ga0495625_0022388_1150_1497 115
221 3300046665 Ga0495661_0032057 Ga0495661_0032057_1924_2271 115
222 3300046674 Ga0495588_0011390 Ga0495588_0011390_2567_2914 115
223 3300046689 Ga0495613_0675061 Ga0495613_0675061_142_489 115
224 3300046691 Ga0495670_0001679 Ga0495670_0001679_3303_3650 115
225 3300046692 Ga0495671_0014640 Ga0495671_0014640_1389_1736 115
226 3300046692 Ga0495671_0015347 Ga0495671_0015347_1321_1668 115
227 3300046692 Ga0495671_0038181 Ga0495671_0038181_1658_2005 115
228 3300046694 Ga0495649_0011786 Ga0495649_0011786_1382_1729 115
229 3300046694 Ga0495649_0031885 Ga0495649_0031885_2525_2872 115
230 3300046810 Ga0495660_0011127 Ga0495660_0011127_2470_2817 115
231 3300047320 Ga0495672_0014007 Ga0495672_0014007_2376_2723 115
232 3300047320 Ga0495672_0032589 Ga0495672_0032589_2857_3204 115
233 3300047320 Ga0495672_0039812 Ga0495672_0039812_1721_2068 115
234 3300047323 Ga0495683_0065376 Ga0495683_0065376_315_662 115
235 3300047446 Ga0495679_204694 Ga0495679_204694_71_418 115
236 3300047469 Ga0495673_0013686 Ga0495673_0013686_1336_1683 115
237 3300047469 Ga0495673_0027627 Ga0495673_0027627_36_383 115
238 3300047470 Ga0495681_0014525 Ga0495681_0014525_2696_3043 115
239 3300047470 Ga0495681_0015814 Ga0495681_0015814_3552_3899 115
240 3300047470 Ga0495681_0053307 Ga0495681_0053307_1345_1692 115
241 3300048091 Ga0495626_0003170 Ga0495626_0003170_2588_2935 115
242 3300048091 Ga0495626_0177573 Ga0495626_0177573_429_776 115
243 3300048913 Ga0496110_0204336 Ga0496110_0204336_324_671 115
244 3300049459 Ga0495678_003080 Ga0495678_003080_8994_9341 115
245 3300049459 Ga0495678_006713 Ga0495678_006713_816_1163 115
246 3300049459 Ga0495678_181779 Ga0495678_181779_216_578 115
247 3300049460 Ga0495682_0071230 Ga0495682_0071230_609_956 115
248 3300050514 nmdc:mga08x19_249965_c1 nmdc:mga08x19_249965_c1_68_415 115
249 3300053139 Ga0500568_0092336 Ga0500568_0092336_94_441 115
250 2162886007 SwRhRL2b_contig_2441698 SwRhRL2b_0668.00004730 116
251 3300005288 Ga0065714_10067663 Ga0065714_100676635 116
252 3300005288 Ga0065714_10067776 Ga0065714_100677765 116
253 3300005288 Ga0065714_10072024 Ga0065714_100720244 116
254 3300005288 Ga0065714_10153175 Ga0065714_101531752 116
255 3300005289 Ga0065704_10007903 Ga0065704_100079032 116
256 3300005290 Ga0065712_10084822 Ga0065712_100848222 116
257 3300005331 Ga0070670_100002735 Ga0070670_1000027359 116
258 3300005344 Ga0070661_100000008 Ga0070661_10000000832 116
259 3300005353 Ga0070669_100000847 Ga0070669_10000084723 116
260 3300005356 Ga0070674_101015742 Ga0070674_1010157422 116
261 3300005457 Ga0070662_100001088 Ga0070662_1000010885 116
262 3300005539 Ga0068853_100161510 Ga0068853_1001615102 116
263 3300005548 Ga0070665_100790309 Ga0070665_1007903091 116
264 3300005564 Ga0070664_100000466 Ga0070664_10000046633 116
265 3300005564 Ga0070664_101209741 Ga0070664_1012097411 116
266 3300005578 Ga0068854_100088319 Ga0068854_1000883192 116
267 3300005834 Ga0068851_10000028 Ga0068851_1000002882 116
268 3300006051 Ga0075364_10298357 Ga0075364_102983572 116
269 3300006058 Ga0075432_10054549 Ga0075432_100545492 116
270 3300006177 Ga0075362_10016844 Ga0075362_100168442 116
271 3300009011 Ga0105251_10004900 Ga0105251_100049008 116
272 3300009011 Ga0105251_10005989 Ga0105251_100059897 116
273 3300009011 Ga0105251_10109974 Ga0105251_101099742 116
274 3300009036 Ga0105244_10000558 Ga0105244_1000055824 116
275 3300009036 Ga0105244_10013296 Ga0105244_100132966 116
276 3300009036 Ga0105244_10014649 Ga0105244_100146492 116
277 3300009036 Ga0105244_10048675 Ga0105244_100486752 116
278 3300009036 Ga0105244_10336445 Ga0105244_103364451 116
279 3300009092 Ga0105250_10000478 Ga0105250_1000047819 116
280 3300009092 Ga0105250_10014770 Ga0105250_100147702 116
281 3300009092 Ga0105250_10253010 Ga0105250_102530102 116
282 3300009148 Ga0105243_10011479 Ga0105243_100114795 116
283 3300009148 Ga0105243_10057017 Ga0105243_100570172 116
284 3300009148 Ga0105243_10221848 Ga0105243_102218482 116
285 3300009176 Ga0105242_10510889 Ga0105242_105108892 116
286 3300009177 Ga0105248_10020194 Ga0105248_100201945 116
287 3300009545 Ga0105237_10099914 Ga0105237_100999142 116
288 3300011119 Ga0105246_10000349 Ga0105246_1000034913 116
289 3300011119 Ga0105246_10002364 Ga0105246_100023647 116
290 3300012483 Ga0157337_1034864 Ga0157337_10348642 116
291 3300013100 Ga0157373_10023042 Ga0157373_100230422 116
292 3300013100 Ga0157373_10026396 Ga0157373_100263964 116
293 3300013100 Ga0157373_10064552 Ga0157373_100645522 116
294 3300013100 Ga0157373_10268868 Ga0157373_102688682 116
295 3300013100 Ga0157373_10885820 Ga0157373_108858201 116
296 3300013102 Ga0157371_10042414 Ga0157371_100424142 116
297 3300013102 Ga0157371_10307928 Ga0157371_103079282 116
298 3300013102 Ga0157371_10314218 Ga0157371_103142182 116
299 3300013104 Ga0157370_10046954 Ga0157370_100469542 116
300 3300013104 Ga0157370_10302885 Ga0157370_103028852 116
301 3300013104 Ga0157370_10425341 Ga0157370_104253412 116
302 3300013104 Ga0157370_10892366 Ga0157370_108923662 116
303 3300013105 Ga0157369_10071758 Ga0157369_100717582 116
304 3300013105 Ga0157369_10224987 Ga0157369_102249872 116
305 3300013105 Ga0157369_10339072 Ga0157369_103390722 116
306 3300013306 Ga0163162_10008959 Ga0163162_100089596 116
307 3300013306 Ga0163162_10059257 Ga0163162_100592572 116
308 3300013306 Ga0163162_10093183 Ga0163162_100931832 116
309 3300013308 Ga0157375_10003543 Ga0157375_100035435 116
310 3300013308 Ga0157375_10007213 Ga0157375_100072134 116
311 3300013308 Ga0157375_10047497 Ga0157375_100474974 116
312 3300014497 Ga0182008_10012660 Ga0182008_100126602 116
313 3300014497 Ga0182008_10019951 Ga0182008_100199512 116
314 3300014497 Ga0182008_10023691 Ga0182008_100236912 116
315 3300015261 Ga0182006_1004238 Ga0182006_10042385 116
316 3300015261 Ga0182006_1026490 Ga0182006_10264902 116
317 3300015261 Ga0182006_1065027 Ga0182006_10650272 116
318 3300015262 Ga0182007_10002191 Ga0182007_100021916 116
319 3300015265 Ga0182005_1025767 Ga0182005_10257672 116
320 3300017792 Ga0163161_10004730 Ga0163161_100047306 116
321 3300017792 Ga0163161_10023345 Ga0163161_100233454 116
322 3300017792 Ga0163161_10024319 Ga0163161_100243195 116
323 3300017792 Ga0163161_10036123 Ga0163161_100361232 116
324 3300017792 Ga0163161_10045676 Ga0163161_100456763 116
325 3300017792 Ga0163161_10078052 Ga0163161_100780522 116
326 3300017792 Ga0163161_10095852 Ga0163161_100958522 116
327 3300025321 Ga0207656_10000095 Ga0207656_1000009522 116
328 3300025711 Ga0207696_1000043 Ga0207696_1000043143 116
329 3300025711 Ga0207696_1033119 Ga0207696_10331192 116
330 3300025728 Ga0207655_1000095 Ga0207655_100009549 116
331 3300025728 Ga0207655_1004602 Ga0207655_10046024 116
332 3300025728 Ga0207655_1005173 Ga0207655_10051736 116
333 3300025735 Ga0207713_1001453 Ga0207713_10014537 116
334 3300025735 Ga0207713_1003068 Ga0207713_100306810 116
335 3300025914 Ga0207671_10258116 Ga0207671_102581162 116
336 3300025920 Ga0207649_10000017 Ga0207649_10000017128 116
337 3300025923 Ga0207681_10056734 Ga0207681_100567342 116
338 3300025925 Ga0207650_10000180 Ga0207650_1000018045 116
339 3300025933 Ga0207706_10001223 Ga0207706_100012239 116
340 3300025935 Ga0207709_10138847 Ga0207709_101388472 116
341 3300025941 Ga0207711_10114631 Ga0207711_101146312 116
342 3300025945 Ga0207679_10000005 Ga0207679_10000005127 116
343 3300025981 Ga0207640_10188094 Ga0207640_101880942 116
344 3300026041 Ga0207639_10003532 Ga0207639_100035322 116
345 3300027907 Ga0207428_10763126 Ga0207428_107631262 116
346 3300028379 Ga0268266_10374959 Ga0268266_103749592 116
347 3300031507 Ga0307509_10089061 Ga0307509_100890615 116
348 3300031548 Ga0307408_100004438 Ga0307408_1000044384 116
349 3300031731 Ga0307405_10024760 Ga0307405_100247605 116
350 3300031731 Ga0307405_10198156 Ga0307405_101981562 116
351 3300031901 Ga0307406_10230769 Ga0307406_102307692 116
352 3300031903 Ga0307407_10207362 Ga0307407_102073622 116
353 3300031911 Ga0307412_10007691 Ga0307412_100076911 116
354 3300031911 Ga0307412_10087634 Ga0307412_100876342 116
355 3300032004 Ga0307414_10039786 Ga0307414_100397862 116
356 3300032005 Ga0307411_10015604 Ga0307411_100156042 116
357 3300041405 Ga0439438_008239 Ga0439438_008239_1763_2113 116
358 3300041405 Ga0439438_051863 Ga0439438_051863_352_702 116
359 3300041407 Ga0439447_001622 Ga0439447_001622_5542_5895 116
360 3300041411 Ga0439466_0001462 Ga0439466_0001462_6665_7018 116
361 3300042005 Ga0439448_0025702 Ga0439448_0025702_649_1005 116
362 3300042010 Ga0439452_000569 Ga0439452_000569_9813_10163 116
363 3300042013 Ga0439456_002545 Ga0439456_002545_930_1286 116
364 3300042013 Ga0439456_008354 Ga0439456_008354_1411_1761 116
365 3300042016 Ga0439463_002470 Ga0439463_002470_2144_2500 116
366 3300042016 Ga0439463_006080 Ga0439463_006080_2221_2571 116
367 3300042115 Ga0450911_001697 Ga0450911_001697_2544_2894 116
368 3300042115 Ga0450911_002743 Ga0450911_002743_2559_2909 116
369 3300042131 Ga0450894_003642 Ga0450894_003642_1558_1911 116
370 3300042137 Ga0450902_027390 Ga0450902_027390_259_612 116
371 3300042138 Ga0450903_020694 Ga0450903_020694_195_548 116
372 3300046452 Ga0495617_127126 Ga0495617_127126_259_618 116
373 3300046453 Ga0495627_000467 Ga0495627_000467_2875_3234 116
374 3300046458 Ga0495591_000666 Ga0495591_000666_2900_3262 116
375 3300046458 Ga0495591_008637 Ga0495591_008637_2518_2868 116
376 3300046501 Ga0495607_0009662 Ga0495607_0009662_3426_3788 116
377 3300046501 Ga0495607_0244014 Ga0495607_0244014_183_545 116
378 3300046506 Ga0495583_0018751 Ga0495583_0018751_3092_3442 116
379 3300046507 Ga0495606_0005631 Ga0495606_0005631_3272_3631 116
380 3300046507 Ga0495606_0007774 Ga0495606_0007774_6725_7075 116
381 3300046507 Ga0495606_0021423 Ga0495606_0021423_2793_3152 116
382 3300046507 Ga0495606_0030668 Ga0495606_0030668_1585_1944 116
383 3300046507 Ga0495606_0105814 Ga0495606_0105814_1056_1406 116
384 3300046512 Ga0495610_0017476 Ga0495610_0017476_2530_2880 116
385 3300046512 Ga0495610_0026237 Ga0495610_0026237_1664_2014 116
386 3300046512 Ga0495610_0055444 Ga0495610_0055444_1488_1838 116
387 3300046512 Ga0495610_0075579 Ga0495610_0075579_826_1185 116
388 3300046512 Ga0495610_0277475 Ga0495610_0277475_188_538 116
389 3300046515 Ga0495620_0002749 Ga0495620_0002749_2952_3314 116
390 3300046519 Ga0495632_0003425 Ga0495632_0003425_2932_3291 116
391 3300046519 Ga0495632_0136616 Ga0495632_0136616_736_1086 116
392 3300046520 Ga0495637_0018083 Ga0495637_0018083_574_924 116
393 3300046520 Ga0495637_0018101 Ga0495637_0018101_801_1151 116
394 3300046530 Ga0495654_0003565 Ga0495654_0003565_2413_2763 116
395 3300046530 Ga0495654_0005093 Ga0495654_0005093_7144_7494 116
396 3300046530 Ga0495654_0015808 Ga0495654_0015808_2582_2932 116
397 3300046530 Ga0495654_0016771 Ga0495654_0016771_1658_2017 116
398 3300046542 Ga0495597_0147803 Ga0495597_0147803_234_584 116
399 3300046665 Ga0495661_0000365 Ga0495661_0000365_33554_33916 116
400 3300046665 Ga0495661_0032712 Ga0495661_0032712_163_513 116
401 3300046694 Ga0495649_0004193 Ga0495649_0004193_2413_2763 116
402 3300046694 Ga0495649_0012755 Ga0495649_0012755_1795_2145 116
403 3300046794 Ga0495589_0007865 Ga0495589_0007865_3222_3584 116
404 3300046810 Ga0495660_0041056 Ga0495660_0041056_543_893 116
405 3300046810 Ga0495660_0232199 Ga0495660_0232199_428_796 116
406 3300047320 Ga0495672_0018238 Ga0495672_0018238_2465_2824 116
407 3300047320 Ga0495672_0087274 Ga0495672_0087274_82_432 116
408 3300047446 Ga0495679_005662 Ga0495679_005662_3135_3497 116
409 3300047446 Ga0495679_007320 Ga0495679_007320_2930_3280 116
410 3300047446 Ga0495679_008074 Ga0495679_008074_2719_3069 116
411 3300047446 Ga0495679_011536 Ga0495679_011536_208_558 116
412 3300047470 Ga0495681_0015689 Ga0495681_0015689_1768_2127 116
413 3300047470 Ga0495681_0032314 Ga0495681_0032314_1467_1826 116
414 3300048905 Ga0496102_0244725 Ga0496102_0244725_813_1163 116
415 3300048913 Ga0496110_0285174 Ga0496110_0285174_620_970 116
416 3300048920 Ga0496117_0027921 Ga0496117_0027921_1234_1584 116
417 3300048920 Ga0496117_0032557 Ga0496117_0032557_2337_2687 116
418 3300048920 Ga0496117_0053427 Ga0496117_0053427_567_917 116
419 3300048921 Ga0496118_0026015 Ga0496118_0026015_1298_1648 116
420 3300048921 Ga0496118_0033080 Ga0496118_0033080_2949_3299 116
421 3300048921 Ga0496118_0033533 Ga0496118_0033533_2422_2772 116
422 3300048922 Ga0496119_0023050 Ga0496119_0023050_2798_3148 116
423 3300048922 Ga0496119_0130542 Ga0496119_0130542_855_1208 116
424 3300048923 Ga0496120_0017968 Ga0496120_0017968_2833_3183 116
425 3300048923 Ga0496120_0020652 Ga0496120_0020652_2725_3075 116
426 3300048923 Ga0496120_0058118 Ga0496120_0058118_170_523 116
427 3300048924 Ga0496121_0038904 Ga0496121_0038904_2744_3094 116
428 3300048924 Ga0496121_0039238 Ga0496121_0039238_1390_1740 116
429 3300048925 Ga0496122_0025472 Ga0496122_0025472_2552_2911 116
430 3300048925 Ga0496122_0044131 Ga0496122_0044131_675_1025 116
431 3300048925 Ga0496122_0061193 Ga0496122_0061193_1060_1410 116
432 3300048925 Ga0496122_0084975 Ga0496122_0084975_167_520 116
433 3300048925 Ga0496122_0461547 Ga0496122_0461547_125_475 116
434 3300048926 Ga0496123_0027766 Ga0496123_0027766_2628_2978 116
435 3300048926 Ga0496123_0065250 Ga0496123_0065250_1802_2155 116
436 3300048926 Ga0496123_0078682 Ga0496123_0078682_606_956 116
437 3300048927 Ga0496124_0031144 Ga0496124_0031144_3062_3412 116
438 3300048927 Ga0496124_0034177 Ga0496124_0034177_2740_3090 116
439 3300048927 Ga0496124_0039969 Ga0496124_0039969_1100_1450 116
440 3300048927 Ga0496124_0040002 Ga0496124_0040002_1095_1448 116
441 3300048927 Ga0496124_0062715 Ga0496124_0062715_1291_1641 116
442 3300048928 Ga0496125_0000451 Ga0496125_0000451_58574_58936 116
443 3300048928 Ga0496125_0009743 Ga0496125_0009743_2793_3152 116
444 3300048928 Ga0496125_0035552 Ga0496125_0035552_2618_2968 116
445 3300048928 Ga0496125_0037522 Ga0496125_0037522_567_917 116
446 3300048928 Ga0496125_0052431 Ga0496125_0052431_1519_1869 116
447 3300048928 Ga0496125_0071934 Ga0496125_0071934_173_523 116
448 3300048928 Ga0496125_0220237 Ga0496125_0220237_174_527 116
449 3300048929 Ga0496126_0023848 Ga0496126_0023848_1103_1453 116
450 3300048929 Ga0496126_0131380 Ga0496126_0131380_175_528 116
451 3300049459 Ga0495678_014867 Ga0495678_014867_1653_2003 116
452 3300049513 Ga0501290_002542 Ga0501290_002542_1163_1513 116
453 3300050489 nmdc:mga03683_17020_c1 nmdc:mga03683_17020_c1_1128_1478 116
454 3300050491 nmdc:mga00v17_492576_c1 nmdc:mga00v17_492576_c1_164_514 116
455 3300050514 nmdc:mga08x19_62421_c1 nmdc:mga08x19_62421_c1_1224_1574 116
456 3300053161 Ga0500634_0043673 Ga0500634_0043673_184_534 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03646

FlaG

FlaG protein

17

117

0.88

Feature Viewer

pLDDT pTM Quality
62.2 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map