F447738

General Info

Members Datasets Scaffolds Average Seq Length
456 310 912 149

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10060129|Ga0081539_100601293
Length 161
Sequence MKTFAALISGTLFGVGLTVSGMINPAKVLGFLDVAGDWDPTLAFVMGGALLVTGPIMPVILRQSRPLLASAFDLPKKTTLDAPLLGGAALFGVGWGLSGFCPGPAVAALVPALLGGLPAVFIFTGSMAAGMFLHGLLTRIPSRNASRHSPAGSSISSEARF

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
254 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
257 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
258 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
259 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
260 2791355261 Rhizobium sp. J15 Isolate Nodule
261 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
262 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
263 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
264 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
265 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
266 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
267 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
268 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
269 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
270 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
271 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
272 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
273 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
274 2904456579 Variovorax sp. 2002 Isolate Unclassified
275 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
276 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
277 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
278 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
279 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
280 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
281 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
282 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
283 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
284 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
285 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
286 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
287 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
288 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
289 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
290 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
291 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
292 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
293 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
294 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
295 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
296 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
297 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
298 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
299 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
300 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
301 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
302 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
303 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
304 3004167301 Mesorhizobium loti 582 Isolate Unclassified
305 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
306 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
307 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
308 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
309 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
310 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.94
Metatranscriptomes 0
Isolates 12.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 3.73
Nodule 9.43
Rhizoplane 3.95
Rhizosphere 80.04
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10060129 3300005985 Bacteria 2088
2 MBSR1b_contig_11794179 2162886012 Bacteria 1459
3 JGI25165J46597_1000070 3300003214 Bacteria 193557
4 Ga0070658_10390053 3300005327 Bacteria 1195
5 Ga0070676_10138878 3300005328 Bacteria 1545
6 Ga0070690_100004380 3300005330 Bacteria 7832
7 Ga0070670_100103994 3300005331 Bacteria 2446
8 Ga0070677_10003018 3300005333 Bacteria 5405
9 Ga0068869_100423431 3300005334 Unclassified 1099
10 Ga0070666_10003711 3300005335 Bacteria 9254
11 Ga0070666_10014662 3300005335 Bacteria 4991
12 Ga0070680_100006490 3300005336 Bacteria 8898
13 Ga0070680_101266070 3300005336 Bacteria 638
14 Ga0068868_100001498 3300005338 Bacteria 16117
15 Ga0068868_100115504 3300005338 Bacteria 2185
16 Ga0068868_100606400 3300005338 Bacteria 970
17 Ga0070660_100671003 3300005339 Bacteria 868
18 Ga0070689_100396814 3300005340 Bacteria 1165
19 Ga0070687_100053175 3300005343 Bacteria 2105
20 Ga0070661_100502702 3300005344 Bacteria 970
21 Ga0070692_10040012 3300005345 Bacteria 2396
22 Ga0070692_10093675 3300005345 Bacteria 1636
23 Ga0070669_100021033 3300005353 Bacteria 4662
24 Ga0070669_100478360 3300005353 Bacteria 1030
25 Ga0070671_100042789 3300005355 Bacteria 3766
26 Ga0070671_100099832 3300005355 Bacteria 2435
27 Ga0070674_100006180 3300005356 Bacteria 6964
28 Ga0070674_100051969 3300005356 Bacteria 2825
29 Ga0070673_100000141 3300005364 Bacteria 34034
30 Ga0070688_100016128 3300005365 Bacteria 4264
31 Ga0070688_100242224 3300005365 Bacteria 1280
32 Ga0070659_100033848 3300005366 Bacteria 3972
33 Ga0070659_100966962 3300005366 Bacteria 746
34 Ga0070667_100019444 3300005367 Bacteria 5635
35 Ga0070709_10022177 3300005434 Bacteria 3711
36 Ga0070709_10025325 3300005434 Bacteria 3504
37 Ga0070709_10616597 3300005434 Bacteria 837
38 Ga0070714_100003194 3300005435 Bacteria 12186
39 Ga0070713_100000533 3300005436 Bacteria 24163
40 Ga0070713_100002051 3300005436 Bacteria 13020
41 Ga0070713_100638761 3300005436 Bacteria 1013
42 Ga0070710_10002594 3300005437 Bacteria 8585
43 Ga0070710_10063114 3300005437 Bacteria 2116
44 Ga0070710_10231970 3300005437 Bacteria 1179
45 Ga0070701_10005047 3300005438 Bacteria 5417
46 Ga0070701_10028078 3300005438 Bacteria 2764
47 Ga0070711_100000912 3300005439 Bacteria 15563
48 Ga0070700_100073493 3300005441 Bacteria 2189
49 Ga0070708_100442555 3300005445 Bacteria 1226
50 Ga0070708_100804822 3300005445 Bacteria 883
51 Ga0070663_100079980 3300005455 Bacteria 2400
52 Ga0070678_100006433 3300005456 Bacteria 6897
53 Ga0070678_100041554 3300005456 Bacteria 3260
54 Ga0070678_100671857 3300005456 Bacteria 931
55 Ga0070662_100067475 3300005457 Bacteria 2627
56 Ga0070662_100439245 3300005457 Bacteria 1082
57 Ga0070685_10001333 3300005466 Bacteria 12961
58 Ga0070706_100629128 3300005467 Bacteria 997
59 Ga0070707_100068910 3300005468 Bacteria 3405
60 Ga0070707_101846433 3300005468 Bacteria 572
61 Ga0070698_100608312 3300005471 Bacteria 1033
62 Ga0070698_101148884 3300005471 Bacteria 725
63 Ga0070699_100008609 3300005518 Bacteria 8841
64 Ga0070679_100261064 3300005530 Bacteria 1687
65 Ga0070684_100471994 3300005535 Bacteria 1161
66 Ga0070697_100065132 3300005536 Bacteria 2977
67 Ga0068853_100471164 3300005539 Bacteria 1183
68 Ga0070672_100040208 3300005543 Bacteria 3586
69 Ga0070686_100004064 3300005544 Bacteria 8047
70 Ga0070686_100841362 3300005544 Bacteria 742
71 Ga0070695_100711386 3300005545 Unclassified 798
72 Ga0070696_100009467 3300005546 Bacteria 6525
73 Ga0070696_100128272 3300005546 Bacteria 1843
74 Ga0070696_100312322 3300005546 Bacteria 1207
75 Ga0070696_101097874 3300005546 Bacteria 669
76 Ga0070693_100003778 3300005547 Bacteria 7087
77 Ga0070693_100504795 3300005547 Bacteria 858
78 Ga0070665_100005150 3300005548 Bacteria 13534
79 Ga0070704_100016501 3300005549 Bacteria 4668
80 Ga0070704_100874656 3300005549 Bacteria 807
81 Ga0068855_101223878 3300005563 Bacteria 780
82 Ga0070664_101647319 3300005564 Bacteria 608
83 Ga0068854_100097541 3300005578 Bacteria 2198
84 Ga0068856_100088408 3300005614 Bacteria 3081
85 Ga0068856_100509534 3300005614 Bacteria 1224
86 Ga0070702_100040187 3300005615 Bacteria 2615
87 Ga0070702_100079229 3300005615 Bacteria 1963
88 Ga0068852_100965178 3300005616 Bacteria 870
89 Ga0068859_100000299 3300005617 Bacteria 49331
90 Ga0068859_100025188 3300005617 Bacteria 5970
91 Ga0068864_100000917 3300005618 Bacteria 24719
92 Ga0068864_100026074 3300005618 Bacteria 4927
93 Ga0068864_100947487 3300005618 Bacteria 852
94 Ga0068866_10001234 3300005718 Bacteria 11081
95 Ga0068866_10363915 3300005718 Bacteria 923
96 Ga0068870_10013042 3300005840 Bacteria 3895
97 Ga0068870_10183335 3300005840 Bacteria 1258
98 Ga0068863_100000513 3300005841 Bacteria 39390
99 Ga0068863_100841190 3300005841 Bacteria 916
100 Ga0068858_100001759 3300005842 Bacteria 22087
101 Ga0068858_100043130 3300005842 Bacteria 4183
102 Ga0068858_100072345 3300005842 Bacteria 3199
103 Ga0068858_100152920 3300005842 Bacteria 2170
104 Ga0068860_100005306 3300005843 Bacteria 13087
105 Ga0068860_100031188 3300005843 Bacteria 5125
106 Ga0068860_100081110 3300005843 Bacteria 3085
107 Ga0068860_100529355 3300005843 Bacteria 1179
108 Ga0068862_101287059 3300005844 Bacteria 732
109 Ga0081539_10005158 3300005985 Bacteria 13590
110 Ga0075365_10379645 3300006038 Bacteria 997
111 Ga0075368_10090616 3300006042 Bacteria 1250
112 Ga0075363_100127902 3300006048 Bacteria 1423
113 Ga0070715_10003507 3300006163 Bacteria 5003
114 Ga0070715_11062269 3300006163 Bacteria 508
115 Ga0070716_100040828 3300006173 Bacteria 2583
116 Ga0070716_100077746 3300006173 Bacteria 1970
117 Ga0070712_100003032 3300006175 Bacteria 10390
118 Ga0070712_100290020 3300006175 Bacteria 1321
119 Ga0075367_10052242 3300006178 Bacteria 2418
120 Ga0097621_100023491 3300006237 Bacteria 4801
121 Ga0097621_100026400 3300006237 Bacteria 4555
122 Ga0097621_100173595 3300006237 Bacteria 1859
123 Ga0075370_10131862 3300006353 Bacteria 1458
124 Ga0068871_100028994 3300006358 Bacteria 4344
125 Ga0068871_100069296 3300006358 Bacteria 2896
126 Ga0068871_100186757 3300006358 Bacteria 1784
127 Ga0068871_100945866 3300006358 Bacteria 800
128 Ga0075431_100000333 3300006847 Bacteria 37182
129 Ga0075434_101725168 3300006871 Bacteria 634
130 Ga0075434_101978970 3300006871 Bacteria 588
131 Ga0075429_100219092 3300006880 Bacteria 1667
132 Ga0068865_100061681 3300006881 Bacteria 2629
133 Ga0068865_100064082 3300006881 Bacteria 2586
134 Ga0075436_100262102 3300006914 Bacteria 1233
135 Ga0097620_100000299 3300006931 Bacteria 49331
136 Ga0097620_100025188 3300006931 Bacteria 5970
137 Ga0075435_100100976 3300007076 Bacteria 2390
138 Ga0105244_10016131 3300009036 Bacteria 4263
139 Ga0105244_10072123 3300009036 Bacteria 1721
140 Ga0105240_10048262 3300009093 Bacteria 5382
141 Ga0105240_10488061 3300009093 Bacteria 1372
142 Ga0111539_11391147 3300009094 Bacteria 814
143 Ga0105245_10002409 3300009098 Bacteria 16918
144 Ga0105245_10007930 3300009098 Bacteria 9285
145 Ga0105245_10038591 3300009098 Bacteria 4249
146 Ga0105245_10091362 3300009098 Bacteria 2802
147 Ga0105245_10261827 3300009098 Bacteria 1683
148 Ga0105247_10079109 3300009101 Bacteria 2069
149 Ga0105243_11210224 3300009148 Bacteria 769
150 Ga0105243_11586214 3300009148 Bacteria 681
151 Ga0105241_10010904 3300009174 Bacteria 6667
152 Ga0105241_10352543 3300009174 Bacteria 1278
153 Ga0105242_10012398 3300009176 Bacteria 6561
154 Ga0105242_10077020 3300009176 Bacteria 2782
155 Ga0105248_10001779 3300009177 Bacteria 23972
156 Ga0105248_10007974 3300009177 Bacteria 11638
157 Ga0105248_10914041 3300009177 Bacteria 991
158 Ga0105237_10118095 3300009545 Bacteria 2646
159 Ga0105237_10138084 3300009545 Bacteria 2432
160 Ga0105237_10189322 3300009545 Bacteria 2058
161 Ga0105238_10418502 3300009551 Bacteria 1334
162 Ga0105238_10932496 3300009551 Bacteria 887
163 Ga0105249_10083752 3300009553 Bacteria 2969
164 Ga0105239_10116302 3300010375 Bacteria 2967
165 Ga0105239_12973673 3300010375 Bacteria 553
166 Ga0157373_10024107 3300013100 Bacteria 4410
167 Ga0157371_10013046 3300013102 Bacteria 6327
168 Ga0157371_10393892 3300013102 Bacteria 1013
169 Ga0157370_10048118 3300013104 Bacteria 4086
170 Ga0157369_10002960 3300013105 Bacteria 20309
171 Ga0157369_10333365 3300013105 Bacteria 1576
172 Ga0157374_10000367 3300013296 Bacteria 41665
173 Ga0157374_10178769 3300013296 Bacteria 2072
174 Ga0157378_10007545 3300013297 Bacteria 9497
175 Ga0157378_10023026 3300013297 Bacteria 5483
176 Ga0163162_10002679 3300013306 Bacteria 16876
177 Ga0163162_10046754 3300013306 Bacteria 4338
178 Ga0163162_10048659 3300013306 Bacteria 4249
179 Ga0163162_10056115 3300013306 Bacteria 3967
180 Ga0157372_10700577 3300013307 Bacteria 1178
181 Ga0157375_10002256 3300013308 Bacteria 16675
182 Ga0163163_10000659 3300014325 Bacteria 29554
183 Ga0157380_10008402 3300014326 Bacteria 7368
184 Ga0157377_10070635 3300014745 Bacteria 2017
185 Ga0157377_11467598 3300014745 Bacteria 541
186 Ga0157379_10002074 3300014968 Bacteria 16644
187 Ga0157376_10004012 3300014969 Bacteria 10185
188 Ga0163161_10075007 3300017792 Bacteria 2481
189 Ga0163161_10109854 3300017792 Bacteria 2060
190 Ga0209233_1000131 3300025261 Bacteria 205257
191 Ga0209564_1000007 3300025295 Bacteria 1028582
192 Ga0207697_10066660 3300025315 Bacteria 1504
193 Ga0207655_1015671 3300025728 Bacteria 4198
194 Ga0207682_10001077 3300025893 Bacteria 12595
195 Ga0207642_10002278 3300025899 Bacteria 5974
196 Ga0207642_10054858 3300025899 Bacteria 1820
197 Ga0207710_10207143 3300025900 Bacteria 970
198 Ga0207688_10013893 3300025901 Bacteria 4376
199 Ga0207680_10007531 3300025903 Bacteria 5316
200 Ga0207680_10054544 3300025903 Bacteria 2405
201 Ga0207680_10500866 3300025903 Bacteria 865
202 Ga0207685_10022327 3300025905 Bacteria 2137
203 Ga0207685_10173011 3300025905 Bacteria 995
204 Ga0207699_10020694 3300025906 Bacteria 3532
205 Ga0207699_10283619 3300025906 Bacteria 1152
206 Ga0207699_11000515 3300025906 Bacteria 618
207 Ga0207645_10813378 3300025907 Bacteria 635
208 Ga0207643_10078071 3300025908 Bacteria 1915
209 Ga0207643_10185078 3300025908 Bacteria 1262
210 Ga0207705_10115089 3300025909 Bacteria 1990
211 Ga0207707_10119318 3300025912 Bacteria 2305
212 Ga0207707_10395418 3300025912 Bacteria 1187
213 Ga0207707_10744300 3300025912 Bacteria 820
214 Ga0207695_10429210 3300025913 Bacteria 1205
215 Ga0207695_10924918 3300025913 Bacteria 752
216 Ga0207671_10048136 3300025914 Bacteria 3155
217 Ga0207671_10745635 3300025914 Bacteria 778
218 Ga0207671_10853669 3300025914 Bacteria 721
219 Ga0207693_10002513 3300025915 Bacteria 15951
220 Ga0207693_10019645 3300025915 Bacteria 5373
221 Ga0207663_10346647 3300025916 Bacteria 1123
222 Ga0207660_10703264 3300025917 Bacteria 824
223 Ga0207662_10049911 3300025918 Bacteria 2484
224 Ga0207657_10001502 3300025919 Bacteria 24947
225 Ga0207649_10343903 3300025920 Bacteria 1102
226 Ga0207681_10036028 3300025923 Bacteria 3262
227 Ga0207681_10265461 3300025923 Bacteria 1345
228 Ga0207694_10173729 3300025924 Bacteria 1745
229 Ga0207650_10075842 3300025925 Bacteria 2539
230 Ga0207650_10244085 3300025925 Bacteria 1452
231 Ga0207659_10010801 3300025926 Bacteria 5747
232 Ga0207659_10011450 3300025926 Bacteria 5605
233 Ga0207687_10001314 3300025927 Bacteria 16986
234 Ga0207687_10024015 3300025927 Bacteria 4068
235 Ga0207700_10001090 3300025928 Bacteria 15648
236 Ga0207700_10016879 3300025928 Bacteria 4862
237 Ga0207664_10000571 3300025929 Bacteria 25842
238 Ga0207644_10002333 3300025931 Bacteria 12265
239 Ga0207644_10011509 3300025931 Bacteria 5856
240 Ga0207706_10010403 3300025933 Bacteria 8497
241 Ga0207706_10309129 3300025933 Bacteria 1377
242 Ga0207686_10000336 3300025934 Bacteria 33877
243 Ga0207686_10040651 3300025934 Bacteria 2829
244 Ga0207709_10803866 3300025935 Bacteria 759
245 Ga0207670_10523382 3300025936 Bacteria 966
246 Ga0207669_10032162 3300025937 Bacteria 2942
247 Ga0207669_10044342 3300025937 Bacteria 2612
248 Ga0207704_10027613 3300025938 Bacteria 3135
249 Ga0207704_10069581 3300025938 Bacteria 2225
250 Ga0207704_10378704 3300025938 Bacteria 1110
251 Ga0207665_10044976 3300025939 Bacteria 2955
252 Ga0207665_10167956 3300025939 Bacteria 1582
253 Ga0207691_10081934 3300025940 Bacteria 2899
254 Ga0207691_10128369 3300025940 Bacteria 2241
255 Ga0207711_10000320 3300025941 Bacteria 51464
256 Ga0207711_10003474 3300025941 Bacteria 13639
257 Ga0207711_10757391 3300025941 Bacteria 905
258 Ga0207711_11382925 3300025941 Bacteria 646
259 Ga0207689_10026497 3300025942 Bacteria 4854
260 Ga0207689_10085434 3300025942 Bacteria 2594
261 Ga0207667_10429987 3300025949 Bacteria 1343
262 Ga0207651_10000253 3300025960 Bacteria 23074
263 Ga0207651_10532492 3300025960 Bacteria 1019
264 Ga0207651_10569305 3300025960 Bacteria 987
265 Ga0207712_10534916 3300025961 Bacteria 1006
266 Ga0207668_10117128 3300025972 Bacteria 2010
267 Ga0207640_10028780 3300025981 Bacteria 3402
268 Ga0207640_10285098 3300025981 Bacteria 1299
269 Ga0207640_11389078 3300025981 Bacteria 629
270 Ga0207658_10021266 3300025986 Bacteria 4501
271 Ga0207658_10101635 3300025986 Bacteria 2253
272 Ga0207677_10000312 3300026023 Bacteria 35589
273 Ga0207677_10054946 3300026023 Bacteria 2720
274 Ga0207677_10083069 3300026023 Bacteria 2304
275 Ga0207703_10000377 3300026035 Bacteria 47621
276 Ga0207703_10012655 3300026035 Bacteria 6579
277 Ga0207703_10051895 3300026035 Bacteria 3327
278 Ga0207678_10130939 3300026067 Bacteria 2140
279 Ga0207708_10024872 3300026075 Bacteria 4532
280 Ga0207702_10173699 3300026078 Bacteria 1978
281 Ga0207702_10353075 3300026078 Bacteria 1407
282 Ga0207641_10001642 3300026088 Bacteria 21808
283 Ga0207641_10681881 3300026088 Bacteria 1011
284 Ga0207641_10823722 3300026088 Bacteria 919
285 Ga0207648_10025639 3300026089 Bacteria 5249
286 Ga0207648_10538945 3300026089 Bacteria 1071
287 Ga0207676_10000822 3300026095 Bacteria 24205
288 Ga0207676_10266762 3300026095 Bacteria 1548
289 Ga0207675_102147923 3300026118 Bacteria 574
290 Ga0207683_10000582 3300026121 Bacteria 33703
291 Ga0207683_10008037 3300026121 Bacteria 9021
292 Ga0207698_10103450 3300026142 Bacteria 2367
293 Ga0209813_10039331 3300027866 Bacteria 1433
294 Ga0268266_10004055 3300028379 Bacteria 14160
295 Ga0268266_10320424 3300028379 Bacteria 1451
296 Ga0268265_10184161 3300028380 Bacteria 1797
297 Ga0268265_10582727 3300028380 Bacteria 1066
298 Ga0268264_10002693 3300028381 Bacteria 15509
299 Ga0268264_10047454 3300028381 Bacteria 3571
300 Ga0307517_10230796 3300028786 Bacteria 1111
301 Ga0316176_1197825 3300030732 Bacteria 1269
302 Ga0307405_11817756 3300031731 Bacteria 542
303 Ga0307406_10331280 3300031901 Bacteria 1182
304 Ga0307416_102639888 3300032002 Bacteria 600
305 Ga0307416_103345482 3300032002 Bacteria 537
306 Ga0307415_102342703 3300032126 Unclassified 524
307 Ga0373923_0000795 3300035111 Bacteria 8229
308 Ga0373953_0009957 3300035117 Bacteria 3294
309 Ga0373954_0001058 3300035118 Bacteria 10958
310 Ga0373956_0003180 3300035119 Bacteria 6637
311 Ga0373957_0005513 3300035120 Bacteria 3924
312 Ga0373943_0002367 3300035170 Bacteria 8553
313 Ga0373946_0007799 3300035171 Bacteria 3929
314 Ga0373955_0003846 3300035172 Bacteria 6616
315 Ga0373924_0025405 3300035410 Bacteria 2342
316 Ga0373927_0353135 3300035695 Bacteria 969
317 Ga0373933_0001941 3300035724 Bacteria 11935
318 Ga0373947_0048725 3300035725 Bacteria 2542
319 Ga0373925_0032652 3300037068 Bacteria 3832
320 Ga0395899_0000103 3300037312 Bacteria 147274
321 Ga0395899_0043916 3300037312 Bacteria 3331
322 Ga0395900_0000093 3300037418 Bacteria 166505
323 Ga0395900_0018459 3300037418 Bacteria 7113
324 Ga0395900_0089640 3300037418 Bacteria 3161
325 Ga0395898_0000053 3300037466 Bacteria 279600
326 Ga0395898_0046435 3300037466 Bacteria 4266
327 Ga0395905_0000031 3300037471 Bacteria 286757
328 Ga0395905_0014450 3300037471 Bacteria 7537
329 Ga0395905_0107795 3300037471 Bacteria 2615
330 Ga0395905_0146289 3300037471 Bacteria 2223
331 Ga0395901_0027064 3300038443 Bacteria 5890
332 Ga0395901_0028009 3300038443 Bacteria 5794
333 Ga0395901_0051549 3300038443 Bacteria 4279
334 Ga0451576_0011745 3300045051 Bacteria 9918
335 Ga0495627_020429 3300046453 Bacteria 2207
336 Ga0495590_0000139 3300046457 Bacteria 43517
337 Ga0495580_0178307 3300046472 Bacteria 1467
338 Ga0495664_0129505 3300046477 Bacteria 1527
339 Ga0495664_0355129 3300046477 Bacteria 882
340 Ga0495606_0028924 3300046507 Bacteria 3900
341 Ga0495628_0236381 3300046516 Bacteria 1368
342 Ga0495628_0377412 3300046516 Bacteria 1039
343 Ga0495586_0076513 3300046535 Bacteria 1834
344 Ga0495587_0249832 3300046536 Bacteria 997
345 Ga0495645_0002935 3300046543 Bacteria 11556
346 Ga0495633_0023024 3300046558 Bacteria 3089
347 Ga0495667_0059127 3300046559 Bacteria 2516
348 Ga0495668_0065982 3300046616 Bacteria 1992
349 Ga0495661_0257593 3300046665 Bacteria 888
350 Ga0495599_0135066 3300046678 Bacteria 1531
351 Ga0495623_0644892 3300046679 Bacteria 546
352 Ga0495646_0058932 3300046680 Bacteria 2295
353 Ga0495671_0262878 3300046692 Bacteria 832
354 Ga0495674_0507448 3300047319 Bacteria 964
355 Ga0495684_0013062 3300047471 Bacteria 6411
356 Ga0496100_0029708 3300048903 Bacteria 3384
357 Ga0496101_0129393 3300048904 Bacteria 1916
358 Ga0496102_0169392 3300048905 Bacteria 2056
359 Ga0496103_0283128 3300048906 Bacteria 1066
360 Ga0496104_0008325 3300048907 Bacteria 9211
361 Ga0496105_0012613 3300048908 Bacteria 6693
362 Ga0496106_0428589 3300048909 Bacteria 1063
363 Ga0496106_0457709 3300048909 Bacteria 1025
364 Ga0496107_0022338 3300048910 Bacteria 4471
365 Ga0496107_0626806 3300048910 Bacteria 794
366 Ga0496109_0281126 3300048912 Bacteria 1568
367 Ga0496109_0663217 3300048912 Bacteria 980
368 Ga0496112_0002221 3300048915 Bacteria 15486
369 Ga0496112_0045338 3300048915 Bacteria 4310
370 Ga0496114_0535487 3300048917 Unclassified 1035
371 Ga0496114_1047222 3300048917 Bacteria 700
372 Ga0496115_0082939 3300048918 Bacteria 2613
373 Ga0496117_0209774 3300048920 Bacteria 1093
374 Ga0496118_0367730 3300048921 Bacteria 760
375 Ga0496123_0519268 3300048926 Bacteria 517
376 Ga0496125_0747635 3300048928 Viruses 513
377 Ga0501033_0334571 3300049570 Bacteria 1062
378 Ga0501034_0104807 3300049571 Bacteria 2821
379 Ga0501038_0306268 3300049574 Bacteria 1246
380 Ga0501039_0234750 3300049575 Bacteria 1442
381 Ga0501047_0108158 3300049581 Bacteria 2662
382 Ga0501080_0228073 3300049742 Bacteria 1703
383 Ga0501035_0029760 3300049822 Bacteria 4980
384 Ga0501045_0264412 3300049824 Bacteria 1281
385 nmdc:mga03n38_14533_c1 3300050490 Bacteria 3020
386 nmdc:mga06z11_219865_c1 3300050494 Bacteria 1110
387 nmdc:mga04h51_106593_c1 3300050495 Bacteria 1028
388 nmdc:mga07m45_98604_c1 3300050496 Bacteria 1678
389 nmdc:mga09592_65848_c1 3300050508 Bacteria 3070
390 nmdc:mga06r32_1439_c1 3300050510 Bacteria 21495
391 nmdc:mga08y16_998088_c1 3300050511 Bacteria 817
392 nmdc:mga0n895_298550_c1 3300050512 Bacteria 1633
393 nmdc:mga0rr50_641771_c1 3300050513 Bacteria 906
394 nmdc:mga08x19_584585_c1 3300050514 Bacteria 791
395 Ga0495601_0117588 3300053077 Bacteria 1725
396 Ga0495601_0174531 3300053077 Bacteria 1405
397 Ga0495612_0296868 3300053078 Bacteria 724
398 Ga0500643_012203 3300053087 Bacteria 3086
399 Ga0500643_111769 3300053087 Bacteria 738
400 Ga0500634_0000167 3300053161 Bacteria 21979
401 Ga0500645_002005 3300053730 Bacteria 9552
402 2599937378 2599185301 Bacteria 6161860
403 2643986639 2643221595 Bacteria 6565519
404 2644157574 2643221627 Bacteria 6761570
405 2756677851 2756170246 Bacteria 7451806
406 2793330655 2791355261 Bacteria 6661293
407 2844005992 2844002411 Bacteria 7168230
408 2856324614 2856320880 Bacteria 7263508
409 2857355286 2857349434 Bacteria 7926032
410 2869281390 2869278585 Bacteria 7077053
411 2874140944 2874139085 Bacteria 7021506
412 2874170411 2874168670 Bacteria 8062617
413 2878742723 2878738818 Bacteria 7136951
414 2881162104 2881161766 Bacteria 7127907
415 2885310942 2885305155 Bacteria 7348390
416 2885327679 2885326080 Bacteria 7134805
417 2888357279 2888350351 Bacteria 7372807
418 2889012231 2889010040 Bacteria 6749192
419 2889022874 2889016732 Bacteria 6700763
420 2904459076 2904456579 Bacteria 6819253
421 2906355389 2906354277 Bacteria 6991324
422 2922138121 2922130491 Bacteria 7173936
423 2922191949 2922185730 Bacteria 7113964
424 2924719650 2924718760 Bacteria 6331356
425 2924780523 2924776078 Bacteria 7492003
426 2937844271 2937843397 Bacteria 5256375
427 2937883050 2937877337 Bacteria 7246526
428 2937973800 2937972304 Bacteria 7532020
429 2958037352 2958034702 Bacteria 6989922
430 2958047064 2958041894 Bacteria 13082850
431 2958090176 2958084443 Bacteria 7312792
432 2958097188 2958092219 Bacteria 6861151
433 2958103431 2958100919 Bacteria 6800575
434 2958148458 2958144490 Bacteria 6677056
435 2965124365 2965119406 Bacteria 6956431
436 2968019807 2968016561 Bacteria 7022047
437 2970473128 2970469710 Bacteria 6969209
438 2970531359 2970524798 Bacteria 6840927
439 2970595994 2970593180 Bacteria 7073582
440 2977948832 2977942078 Bacteria 7570577
441 2977975091 2977971508 Bacteria 7472917
442 2979711545 2979710463 Bacteria 6785254
443 2979746782 2979742915 Bacteria 7301278
444 2984502730 2984499530 Bacteria 5020881
445 2987640419 2987636660 Bacteria 8088555
446 2987656209 2987652177 Bacteria 6969023
447 2996341004 2996336353 Bacteria 5511628
448 2996351748 2996348954 Bacteria 7239054
449 3000139017 3000135777 Bacteria 6891109
450 3004170678 3004167301 Bacteria 8330599
451 3004208617 3004203850 Bacteria 7307914
452 3004278448 3004275668 Bacteria 7114440
453 3004297107 3004289098 Bacteria 6135450
454 3005422514 3005416602 Bacteria 7064308
455 8005320138 8005314921 Bacteria 7072929
456 8054566613 8054563764 Bacteria 5592885
457 Ga0081539_10060129
458 MBSR1b_contig_11794179
459 JGI25165J46597_1000070
460 Ga0070658_10390053
461 Ga0070676_10138878
462 Ga0070690_100004380
463 Ga0070670_100103994
464 Ga0070677_10003018
465 Ga0068869_100423431
466 Ga0070666_10003711
467 Ga0070666_10014662
468 Ga0070680_100006490
469 Ga0070680_101266070
470 Ga0068868_100001498
471 Ga0068868_100115504
472 Ga0068868_100606400
473 Ga0070660_100671003
474 Ga0070689_100396814
475 Ga0070687_100053175
476 Ga0070661_100502702
477 Ga0070692_10040012
478 Ga0070692_10093675
479 Ga0070669_100021033
480 Ga0070669_100478360
481 Ga0070671_100042789
482 Ga0070671_100099832
483 Ga0070674_100006180
484 Ga0070674_100051969
485 Ga0070673_100000141
486 Ga0070688_100016128
487 Ga0070688_100242224
488 Ga0070659_100033848
489 Ga0070659_100966962
490 Ga0070667_100019444
491 Ga0070709_10022177
492 Ga0070709_10025325
493 Ga0070709_10616597
494 Ga0070714_100003194
495 Ga0070713_100000533
496 Ga0070713_100002051
497 Ga0070713_100638761
498 Ga0070710_10002594
499 Ga0070710_10063114
500 Ga0070710_10231970
501 Ga0070701_10005047
502 Ga0070701_10028078
503 Ga0070711_100000912
504 Ga0070700_100073493
505 Ga0070708_100442555
506 Ga0070708_100804822
507 Ga0070663_100079980
508 Ga0070678_100006433
509 Ga0070678_100041554
510 Ga0070678_100671857
511 Ga0070662_100067475
512 Ga0070662_100439245
513 Ga0070685_10001333
514 Ga0070706_100629128
515 Ga0070707_100068910
516 Ga0070707_101846433
517 Ga0070698_100608312
518 Ga0070698_101148884
519 Ga0070699_100008609
520 Ga0070679_100261064
521 Ga0070684_100471994
522 Ga0070697_100065132
523 Ga0068853_100471164
524 Ga0070672_100040208
525 Ga0070686_100004064
526 Ga0070686_100841362
527 Ga0070695_100711386
528 Ga0070696_100009467
529 Ga0070696_100128272
530 Ga0070696_100312322
531 Ga0070696_101097874
532 Ga0070693_100003778
533 Ga0070693_100504795
534 Ga0070665_100005150
535 Ga0070704_100016501
536 Ga0070704_100874656
537 Ga0068855_101223878
538 Ga0070664_101647319
539 Ga0068854_100097541
540 Ga0068856_100088408
541 Ga0068856_100509534
542 Ga0070702_100040187
543 Ga0070702_100079229
544 Ga0068852_100965178
545 Ga0068859_100000299
546 Ga0068859_100025188
547 Ga0068864_100000917
548 Ga0068864_100026074
549 Ga0068864_100947487
550 Ga0068866_10001234
551 Ga0068866_10363915
552 Ga0068870_10013042
553 Ga0068870_10183335
554 Ga0068863_100000513
555 Ga0068863_100841190
556 Ga0068858_100001759
557 Ga0068858_100043130
558 Ga0068858_100072345
559 Ga0068858_100152920
560 Ga0068860_100005306
561 Ga0068860_100031188
562 Ga0068860_100081110
563 Ga0068860_100529355
564 Ga0068862_101287059
565 Ga0081539_10005158
566 Ga0075365_10379645
567 Ga0075368_10090616
568 Ga0075363_100127902
569 Ga0070715_10003507
570 Ga0070715_11062269
571 Ga0070716_100040828
572 Ga0070716_100077746
573 Ga0070712_100003032
574 Ga0070712_100290020
575 Ga0075367_10052242
576 Ga0097621_100023491
577 Ga0097621_100026400
578 Ga0097621_100173595
579 Ga0075370_10131862
580 Ga0068871_100028994
581 Ga0068871_100069296
582 Ga0068871_100186757
583 Ga0068871_100945866
584 Ga0075431_100000333
585 Ga0075434_101725168
586 Ga0075434_101978970
587 Ga0075429_100219092
588 Ga0068865_100061681
589 Ga0068865_100064082
590 Ga0075436_100262102
591 Ga0097620_100000299
592 Ga0097620_100025188
593 Ga0075435_100100976
594 Ga0105244_10016131
595 Ga0105244_10072123
596 Ga0105240_10048262
597 Ga0105240_10488061
598 Ga0111539_11391147
599 Ga0105245_10002409
600 Ga0105245_10007930
601 Ga0105245_10038591
602 Ga0105245_10091362
603 Ga0105245_10261827
604 Ga0105247_10079109
605 Ga0105243_11210224
606 Ga0105243_11586214
607 Ga0105241_10010904
608 Ga0105241_10352543
609 Ga0105242_10012398
610 Ga0105242_10077020
611 Ga0105248_10001779
612 Ga0105248_10007974
613 Ga0105248_10914041
614 Ga0105237_10118095
615 Ga0105237_10138084
616 Ga0105237_10189322
617 Ga0105238_10418502
618 Ga0105238_10932496
619 Ga0105249_10083752
620 Ga0105239_10116302
621 Ga0105239_12973673
622 Ga0157373_10024107
623 Ga0157371_10013046
624 Ga0157371_10393892
625 Ga0157370_10048118
626 Ga0157369_10002960
627 Ga0157369_10333365
628 Ga0157374_10000367
629 Ga0157374_10178769
630 Ga0157378_10007545
631 Ga0157378_10023026
632 Ga0163162_10002679
633 Ga0163162_10046754
634 Ga0163162_10048659
635 Ga0163162_10056115
636 Ga0157372_10700577
637 Ga0157375_10002256
638 Ga0163163_10000659
639 Ga0157380_10008402
640 Ga0157377_10070635
641 Ga0157377_11467598
642 Ga0157379_10002074
643 Ga0157376_10004012
644 Ga0163161_10075007
645 Ga0163161_10109854
646 Ga0209233_1000131
647 Ga0209564_1000007
648 Ga0207697_10066660
649 Ga0207655_1015671
650 Ga0207682_10001077
651 Ga0207642_10002278
652 Ga0207642_10054858
653 Ga0207710_10207143
654 Ga0207688_10013893
655 Ga0207680_10007531
656 Ga0207680_10054544
657 Ga0207680_10500866
658 Ga0207685_10022327
659 Ga0207685_10173011
660 Ga0207699_10020694
661 Ga0207699_10283619
662 Ga0207699_11000515
663 Ga0207645_10813378
664 Ga0207643_10078071
665 Ga0207643_10185078
666 Ga0207705_10115089
667 Ga0207707_10119318
668 Ga0207707_10395418
669 Ga0207707_10744300
670 Ga0207695_10429210
671 Ga0207695_10924918
672 Ga0207671_10048136
673 Ga0207671_10745635
674 Ga0207671_10853669
675 Ga0207693_10002513
676 Ga0207693_10019645
677 Ga0207663_10346647
678 Ga0207660_10703264
679 Ga0207662_10049911
680 Ga0207657_10001502
681 Ga0207649_10343903
682 Ga0207681_10036028
683 Ga0207681_10265461
684 Ga0207694_10173729
685 Ga0207650_10075842
686 Ga0207650_10244085
687 Ga0207659_10010801
688 Ga0207659_10011450
689 Ga0207687_10001314
690 Ga0207687_10024015
691 Ga0207700_10001090
692 Ga0207700_10016879
693 Ga0207664_10000571
694 Ga0207644_10002333
695 Ga0207644_10011509
696 Ga0207706_10010403
697 Ga0207706_10309129
698 Ga0207686_10000336
699 Ga0207686_10040651
700 Ga0207709_10803866
701 Ga0207670_10523382
702 Ga0207669_10032162
703 Ga0207669_10044342
704 Ga0207704_10027613
705 Ga0207704_10069581
706 Ga0207704_10378704
707 Ga0207665_10044976
708 Ga0207665_10167956
709 Ga0207691_10081934
710 Ga0207691_10128369
711 Ga0207711_10000320
712 Ga0207711_10003474
713 Ga0207711_10757391
714 Ga0207711_11382925
715 Ga0207689_10026497
716 Ga0207689_10085434
717 Ga0207667_10429987
718 Ga0207651_10000253
719 Ga0207651_10532492
720 Ga0207651_10569305
721 Ga0207712_10534916
722 Ga0207668_10117128
723 Ga0207640_10028780
724 Ga0207640_10285098
725 Ga0207640_11389078
726 Ga0207658_10021266
727 Ga0207658_10101635
728 Ga0207677_10000312
729 Ga0207677_10054946
730 Ga0207677_10083069
731 Ga0207703_10000377
732 Ga0207703_10012655
733 Ga0207703_10051895
734 Ga0207678_10130939
735 Ga0207708_10024872
736 Ga0207702_10173699
737 Ga0207702_10353075
738 Ga0207641_10001642
739 Ga0207641_10681881
740 Ga0207641_10823722
741 Ga0207648_10025639
742 Ga0207648_10538945
743 Ga0207676_10000822
744 Ga0207676_10266762
745 Ga0207675_102147923
746 Ga0207683_10000582
747 Ga0207683_10008037
748 Ga0207698_10103450
749 Ga0209813_10039331
750 Ga0268266_10004055
751 Ga0268266_10320424
752 Ga0268265_10184161
753 Ga0268265_10582727
754 Ga0268264_10002693
755 Ga0268264_10047454
756 Ga0307517_10230796
757 Ga0316176_1197825
758 Ga0307405_11817756
759 Ga0307406_10331280
760 Ga0307416_102639888
761 Ga0307416_103345482
762 Ga0307415_102342703
763 Ga0373923_0000795
764 Ga0373953_0009957
765 Ga0373954_0001058
766 Ga0373956_0003180
767 Ga0373957_0005513
768 Ga0373943_0002367
769 Ga0373946_0007799
770 Ga0373955_0003846
771 Ga0373924_0025405
772 Ga0373927_0353135
773 Ga0373933_0001941
774 Ga0373947_0048725
775 Ga0373925_0032652
776 Ga0395899_0000103
777 Ga0395899_0043916
778 Ga0395900_0000093
779 Ga0395900_0018459
780 Ga0395900_0089640
781 Ga0395898_0000053
782 Ga0395898_0046435
783 Ga0395905_0000031
784 Ga0395905_0014450
785 Ga0395905_0107795
786 Ga0395905_0146289
787 Ga0395901_0027064
788 Ga0395901_0028009
789 Ga0395901_0051549
790 Ga0451576_0011745
791 Ga0495627_020429
792 Ga0495590_0000139
793 Ga0495580_0178307
794 Ga0495664_0129505
795 Ga0495664_0355129
796 Ga0495606_0028924
797 Ga0495628_0236381
798 Ga0495628_0377412
799 Ga0495586_0076513
800 Ga0495587_0249832
801 Ga0495645_0002935
802 Ga0495633_0023024
803 Ga0495667_0059127
804 Ga0495668_0065982
805 Ga0495661_0257593
806 Ga0495599_0135066
807 Ga0495623_0644892
808 Ga0495646_0058932
809 Ga0495671_0262878
810 Ga0495674_0507448
811 Ga0495684_0013062
812 Ga0496100_0029708
813 Ga0496101_0129393
814 Ga0496102_0169392
815 Ga0496103_0283128
816 Ga0496104_0008325
817 Ga0496105_0012613
818 Ga0496106_0428589
819 Ga0496106_0457709
820 Ga0496107_0022338
821 Ga0496107_0626806
822 Ga0496109_0281126
823 Ga0496109_0663217
824 Ga0496112_0002221
825 Ga0496112_0045338
826 Ga0496114_0535487
827 Ga0496114_1047222
828 Ga0496115_0082939
829 Ga0496117_0209774
830 Ga0496118_0367730
831 Ga0496123_0519268
832 Ga0496125_0747635
833 Ga0501033_0334571
834 Ga0501034_0104807
835 Ga0501038_0306268
836 Ga0501039_0234750
837 Ga0501047_0108158
838 Ga0501080_0228073
839 Ga0501035_0029760
840 Ga0501045_0264412
841 nmdc:mga03n38_14533_c1
842 nmdc:mga06z11_219865_c1
843 nmdc:mga04h51_106593_c1
844 nmdc:mga07m45_98604_c1
845 nmdc:mga09592_65848_c1
846 nmdc:mga06r32_1439_c1
847 nmdc:mga08y16_998088_c1
848 nmdc:mga0n895_298550_c1
849 nmdc:mga0rr50_641771_c1
850 nmdc:mga08x19_584585_c1
851 Ga0495601_0117588
852 Ga0495601_0174531
853 Ga0495612_0296868
854 Ga0500643_012203
855 Ga0500643_111769
856 Ga0500634_0000167
857 Ga0500645_002005
858 2599937378
859 2643986639
860 2644157574
861 2756677851
862 2793330655
863 2844005992
864 2856324614
865 2857355286
866 2869281390
867 2874140944
868 2874170411
869 2878742723
870 2881162104
871 2885310942
872 2885327679
873 2888357279
874 2889012231
875 2889022874
876 2904459076
877 2906355389
878 2922138121
879 2922191949
880 2924719650
881 2924780523
882 2937844271
883 2937883050
884 2937973800
885 2958037352
886 2958047064
887 2958090176
888 2958097188
889 2958103431
890 2958148458
891 2965124365
892 2968019807
893 2970473128
894 2970531359
895 2970595994
896 2977948832
897 2977975091
898 2979711545
899 2979746782
900 2984502730
901 2987640419
902 2987656209
903 2996341004
904 2996351748
905 3000139017
906 3004170678
907 3004208617
908 3004278448
909 3004297107
910 3005422514
911 8005320138
912 8054566613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20398

DUF6691

Family of unknown function (DUF6691)

1

146

0.93

Map