F447664

General Info

Members Datasets Scaffolds Average Seq Length
455 213 454 307

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0003782|Ga0496126_0003782_8255_9361
Length 368
Sequence VQTTELSATQSLAWHTGQTSRSSSLNDFVNSTIASMLSQRERVNTMRPGHDTINADMTNQPHVLDGVAIASEIKAEVGREVTALSAKGITPGLAVILVGNVAASEIYVRSKVKTCGELGIFSEMLTPPESITTEEMLELVAKLNARDDIDGILIQLPLPKHVDTKRLLEAVSPDKDVDGFHPVNAGRLQSGQPGLAPCTPAGIIEILKRSKLPIAGQNAVVLGRSDIVGKPAALMLLNESATVTVCHSKTRDLPAVTRNADILVAAIGRPGYVTPEMVRPGAVLIDVGINRLTDAADVERFFAGDAVRAATFAKRGSVIVGDVHPAAFAISSAYTPVPGGVGALTIAMLMHNTVKAAKLRRGIPVERV

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 2.2
Rhizosphere 95.82
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10002730 3300005327 Bacteria 14695
2 Ga0070658_10009570 3300005327 Bacteria 7779
3 Ga0070658_10031055 3300005327 Bacteria 4289
4 Ga0070658_10031101 3300005327 Bacteria 4286
5 Ga0070658_10134480 3300005327 Bacteria 2062
6 Ga0070683_100000210 3300005329 Bacteria 39660
7 Ga0070683_100014043 3300005329 Bacteria 6995
8 Ga0070683_100078140 3300005329 Bacteria 3095
9 Ga0070683_100138734 3300005329 Bacteria 2303
10 Ga0068869_100014715 3300005334 Bacteria 5232
11 Ga0068868_100000046 3300005338 Bacteria 68441
12 Ga0070660_100013531 3300005339 Bacteria 5855
13 Ga0070660_100045365 3300005339 Bacteria 3364
14 Ga0070689_100253371 3300005340 Bacteria 1453
15 Ga0070661_100056322 3300005344 Bacteria 2880
16 Ga0070661_100228531 3300005344 Bacteria 1429
17 Ga0070669_100261218 3300005353 Unclassified 1382
18 Ga0070671_100003795 3300005355 Bacteria 11855
19 Ga0070671_100011009 3300005355 Bacteria 7259
20 Ga0070671_100067313 3300005355 Bacteria 2986
21 Ga0070659_100034743 3300005366 Bacteria 3922
22 Ga0070667_100001013 3300005367 Bacteria 25735
23 Ga0070714_100037725 3300005435 Bacteria 4062
24 Ga0070714_100146821 3300005435 Bacteria 2122
25 Ga0070714_100589364 3300005435 Bacteria 1067
26 Ga0070713_100003373 3300005436 Bacteria 10547
27 Ga0070713_100006568 3300005436 Bacteria 8079
28 Ga0070713_100006684 3300005436 Bacteria 8027
29 Ga0070713_100310003 3300005436 Bacteria 1455
30 Ga0070710_10008907 3300005437 Bacteria 4898
31 Ga0070710_10036338 3300005437 Bacteria 2693
32 Ga0070711_100002484 3300005439 Bacteria 10529
33 Ga0070681_10001472 3300005458 Bacteria 20780
34 Ga0070681_10145586 3300005458 Bacteria 2298
35 Ga0070698_100009571 3300005471 Bacteria 10371
36 Ga0070699_100136828 3300005518 Bacteria 2161
37 Ga0070679_100000871 3300005530 Bacteria 26220
38 Ga0070684_100003273 3300005535 Bacteria 12129
39 Ga0070684_100011614 3300005535 Bacteria 7020
40 Ga0070684_100040318 3300005535 Bacteria 4020
41 Ga0070684_100052512 3300005535 Bacteria 3545
42 Ga0070684_100112555 3300005535 Bacteria 2442
43 Ga0068853_100008309 3300005539 Bacteria 8336
44 Ga0068853_100010282 3300005539 Bacteria 7571
45 Ga0068853_100196854 3300005539 Unclassified 1833
46 Ga0070665_100011130 3300005548 Bacteria 9091
47 Ga0070665_100153255 3300005548 Bacteria 2307
48 Ga0070665_100318820 3300005548 Bacteria 1558
49 Ga0068855_100000368 3300005563 Bacteria 55842
50 Ga0068855_100005193 3300005563 Bacteria 15885
51 Ga0068855_100021426 3300005563 Bacteria 7750
52 Ga0068855_100029777 3300005563 Bacteria 6528
53 Ga0068855_100035349 3300005563 Bacteria 5952
54 Ga0068855_100071987 3300005563 Bacteria 4018
55 Ga0068855_100194711 3300005563 Bacteria 2284
56 Ga0070664_100028399 3300005564 Bacteria 4653
57 Ga0068857_100000726 3300005577 Bacteria 24578
58 Ga0068857_100004261 3300005577 Bacteria 12056
59 Ga0068857_100014619 3300005577 Bacteria 6845
60 Ga0068857_100137080 3300005577 Bacteria 2210
61 Ga0068854_100015583 3300005578 Bacteria 5040
62 Ga0068854_100080145 3300005578 Bacteria 2409
63 Ga0068856_100000660 3300005614 Bacteria 37333
64 Ga0068856_100004343 3300005614 Bacteria 14126
65 Ga0068856_100008939 3300005614 Bacteria 9743
66 Ga0068856_100053092 3300005614 Bacteria 3997
67 Ga0068856_100104923 3300005614 Bacteria 2820
68 Ga0068856_100223843 3300005614 Bacteria 1897
69 Ga0068852_100000063 3300005616 Bacteria 72990
70 Ga0068852_100003275 3300005616 Bacteria 11304
71 Ga0068852_100011022 3300005616 Bacteria 6785
72 Ga0068852_100020337 3300005616 Bacteria 5278
73 Ga0068852_100055485 3300005616 Bacteria 3420
74 Ga0068852_100081576 3300005616 Bacteria 2871
75 Ga0068852_100083646 3300005616 Unclassified 2838
76 Ga0068852_100554987 3300005616 Unclassified 1149
77 Ga0068859_100044781 3300005617 Bacteria 4446
78 Ga0068864_100000782 3300005618 Bacteria 26736
79 Ga0068851_10005484 3300005834 Bacteria 5753
80 Ga0068851_10031475 3300005834 Bacteria 2635
81 Ga0068863_100000689 3300005841 Bacteria 33976
82 Ga0068863_100016491 3300005841 Bacteria 7086
83 Ga0068858_100000792 3300005842 Bacteria 33008
84 Ga0068858_100008850 3300005842 Bacteria 9655
85 Ga0068860_100000486 3300005843 Bacteria 48996
86 Ga0070717_10000675 3300006028 Bacteria 21977
87 Ga0070717_10016123 3300006028 Bacteria 5787
88 Ga0070715_10141988 3300006163 Bacteria 1167
89 Ga0070712_100047633 3300006175 Bacteria 2968
90 Ga0070712_100085071 3300006175 Bacteria 2301
91 Ga0070712_100328402 3300006175 Bacteria 1246
92 Ga0097621_100027465 3300006237 Bacteria 4476
93 Ga0068871_100000318 3300006358 Bacteria 33510
94 Ga0097620_100044777 3300006931 Bacteria 4446
95 Ga0105240_10000187 3300009093 Bacteria 126042
96 Ga0105240_10000498 3300009093 Bacteria 72329
97 Ga0105240_10000663 3300009093 Bacteria 63262
98 Ga0105240_10003591 3300009093 Bacteria 24042
99 Ga0105240_10010389 3300009093 Bacteria 13085
100 Ga0105240_10019453 3300009093 Bacteria 9070
101 Ga0105240_10030947 3300009093 Bacteria 6949
102 Ga0105240_10103841 3300009093 Bacteria 3452
103 Ga0105240_10130044 3300009093 Bacteria 3021
104 Ga0105240_10640735 3300009093 Bacteria 1166
105 Ga0105245_10029141 3300009098 Bacteria 4874
106 Ga0105245_10242918 3300009098 Bacteria 1746
107 Ga0105247_10020854 3300009101 Bacteria 3941
108 Ga0105243_10037709 3300009148 Bacteria 3759
109 Ga0105243_10374786 3300009148 Bacteria 1314
110 Ga0105241_10000190 3300009174 Bacteria 46161
111 Ga0105241_10001787 3300009174 Bacteria 16332
112 Ga0105241_10024512 3300009174 Bacteria 4479
113 Ga0105241_10024725 3300009174 Bacteria 4461
114 Ga0105241_10037780 3300009174 Unclassified 3638
115 Ga0105241_10134391 3300009174 Bacteria 2006
116 Ga0105242_10076073 3300009176 Bacteria 2797
117 Ga0105248_10000049 3300009177 Bacteria 153741
118 Ga0105248_10007643 3300009177 Bacteria 11878
119 Ga0105248_10017142 3300009177 Bacteria 7980
120 Ga0105237_10008461 3300009545 Bacteria 11134
121 Ga0105237_10056650 3300009545 Bacteria 3923
122 Ga0105237_10110609 3300009545 Bacteria 2739
123 Ga0105238_10000445 3300009551 Bacteria 43401
124 Ga0105238_10002357 3300009551 Bacteria 18991
125 Ga0105238_10005713 3300009551 Bacteria 12294
126 Ga0105238_10006055 3300009551 Bacteria 11998
127 Ga0105238_10023691 3300009551 Bacteria 6256
128 Ga0105238_10169586 3300009551 Bacteria 2158
129 Ga0105238_10176888 3300009551 Bacteria 2111
130 Ga0105238_10254960 3300009551 Bacteria 1733
131 Ga0099796_10070131 3300010159 Bacteria 1263
132 Ga0105239_10006364 3300010375 Bacteria 13720
133 Ga0105239_10059949 3300010375 Bacteria 4176
134 Ga0105239_10101852 3300010375 Bacteria 3177
135 Ga0105239_10544937 3300010375 Bacteria 1321
136 Ga0105246_10015497 3300011119 Bacteria 4818
137 Ga0157371_10029523 3300013102 Bacteria 3963
138 Ga0157371_10100237 3300013102 Bacteria 2054
139 Ga0157371_10309009 3300013102 Bacteria 1145
140 Ga0157370_10000066 3300013104 Bacteria 113884
141 Ga0157370_10016554 3300013104 Bacteria 7459
142 Ga0157370_10024810 3300013104 Bacteria 5936
143 Ga0157370_10032013 3300013104 Bacteria 5139
144 Ga0157370_10089759 3300013104 Unclassified 2887
145 Ga0157369_10000188 3300013105 Bacteria 85789
146 Ga0157369_10010473 3300013105 Bacteria 10561
147 Ga0157369_10012172 3300013105 Bacteria 9765
148 Ga0157369_10015595 3300013105 Bacteria 8564
149 Ga0157369_10026293 3300013105 Bacteria 6457
150 Ga0157369_10048820 3300013105 Bacteria 4591
151 Ga0157369_10110948 3300013105 Bacteria 2916
152 Ga0157374_10002505 3300013296 Bacteria 15507
153 Ga0157374_10014679 3300013296 Bacteria 6857
154 Ga0157374_10021668 3300013296 Bacteria 5722
155 Ga0157374_10048261 3300013296 Bacteria 3950
156 Ga0157374_10148791 3300013296 Bacteria 2276
157 Ga0157374_10190856 3300013296 Bacteria 2004
158 Ga0157374_10492078 3300013296 Bacteria 1230
159 Ga0157378_10017980 3300013297 Bacteria 6206
160 Ga0157378_10039289 3300013297 Bacteria 4197
161 Ga0157378_10119489 3300013297 Bacteria 2427
162 Ga0163162_10048185 3300013306 Bacteria 4269
163 Ga0163162_10071698 3300013306 Bacteria 3518
164 Ga0157372_10000114 3300013307 Bacteria 85156
165 Ga0157372_10011045 3300013307 Bacteria 9610
166 Ga0157372_10022400 3300013307 Bacteria 6836
167 Ga0157372_10023245 3300013307 Bacteria 6718
168 Ga0157372_10138810 3300013307 Bacteria 2800
169 Ga0157372_10156527 3300013307 Bacteria 2632
170 Ga0157372_10158358 3300013307 Bacteria 2616
171 Ga0157372_10180626 3300013307 Bacteria 2443
172 Ga0157375_10075230 3300013308 Bacteria 3401
173 Ga0157375_10619682 3300013308 Bacteria 1240
174 Ga0163163_10000351 3300014325 Bacteria 44325
175 Ga0163163_10015596 3300014325 Bacteria 7029
176 Ga0157379_10006606 3300014968 Bacteria 10006
177 Ga0157379_10117392 3300014968 Bacteria 2393
178 Ga0157379_10265075 3300014968 Bacteria 1562
179 Ga0157376_10017756 3300014969 Bacteria 5437
180 Ga0157376_10042282 3300014969 Bacteria 3735
181 Ga0163161_10044039 3300017792 Bacteria 3214
182 Ga0213874_10088265 3300021377 Bacteria 1015
183 Ga0213875_10000132 3300021388 Bacteria 82929
184 Ga0207656_10105600 3300025321 Bacteria 1296
185 Ga0207647_10032262 3300025904 Bacteria 3368
186 Ga0207705_10020382 3300025909 Bacteria 4739
187 Ga0207705_10044884 3300025909 Unclassified 3176
188 Ga0207705_10164856 3300025909 Bacteria 1666
189 Ga0207705_10203369 3300025909 Bacteria 1501
190 Ga0207654_10001701 3300025911 Bacteria 11493
191 Ga0207654_10002664 3300025911 Bacteria 9066
192 Ga0207654_10037291 3300025911 Unclassified 2720
193 Ga0207654_10100360 3300025911 Bacteria 1782
194 Ga0207707_10002291 3300025912 Bacteria 17266
195 Ga0207695_10000052 3300025913 Bacteria 398089
196 Ga0207695_10000106 3300025913 Bacteria 253001
197 Ga0207695_10000108 3300025913 Bacteria 252306
198 Ga0207695_10000253 3300025913 Bacteria 139044
199 Ga0207695_10002288 3300025913 Bacteria 28621
200 Ga0207695_10011700 3300025913 Bacteria 10602
201 Ga0207695_10090024 3300025913 Bacteria 3084
202 Ga0207671_10000081 3300025914 Bacteria 148476
203 Ga0207671_10003498 3300025914 Bacteria 15608
204 Ga0207671_10025557 3300025914 Bacteria 4435
205 Ga0207693_10001564 3300025915 Bacteria 20202
206 Ga0207693_10017330 3300025915 Bacteria 5744
207 Ga0207693_10088895 3300025915 Bacteria 2421
208 Ga0207693_10104992 3300025915 Bacteria 2215
209 Ga0207663_10069478 3300025916 Bacteria 2266
210 Ga0207657_10018479 3300025919 Bacteria 6653
211 Ga0207657_10038398 3300025919 Bacteria 4262
212 Ga0207649_10020120 3300025920 Unclassified 3823
213 Ga0207652_10011328 3300025921 Bacteria 7186
214 Ga0207694_10000108 3300025924 Bacteria 87457
215 Ga0207694_10003205 3300025924 Bacteria 13051
216 Ga0207694_10003511 3300025924 Bacteria 12445
217 Ga0207694_10017875 3300025924 Bacteria 5359
218 Ga0207694_10058070 3300025924 Bacteria 3010
219 Ga0207694_10374730 3300025924 Bacteria 1181
220 Ga0207650_10001335 3300025925 Bacteria 17846
221 Ga0207687_10000440 3300025927 Bacteria 28259
222 Ga0207687_10003837 3300025927 Bacteria 10093
223 Ga0207700_10002098 3300025928 Bacteria 11381
224 Ga0207700_10208178 3300025928 Bacteria 1652
225 Ga0207664_10013534 3300025929 Bacteria 5860
226 Ga0207664_10022918 3300025929 Bacteria 4671
227 Ga0207644_10007102 3300025931 Bacteria 7301
228 Ga0207644_10022857 3300025931 Bacteria 4275
229 Ga0207644_10416274 3300025931 Bacteria 1100
230 Ga0207691_10036632 3300025940 Bacteria 4545
231 Ga0207711_10000033 3300025941 Bacteria 193513
232 Ga0207711_10030369 3300025941 Bacteria 4558
233 Ga0207711_10038982 3300025941 Bacteria 4040
234 Ga0207711_10066170 3300025941 Bacteria 3125
235 Ga0207711_10155661 3300025941 Bacteria 2065
236 Ga0207689_10001260 3300025942 Bacteria 24401
237 Ga0207661_10002024 3300025944 Bacteria 13979
238 Ga0207661_10011894 3300025944 Bacteria 6320
239 Ga0207661_10112566 3300025944 Bacteria 2304
240 Ga0207661_10608156 3300025944 Bacteria 1003
241 Ga0207679_10126267 3300025945 Bacteria 2045
242 Ga0207667_10000934 3300025949 Bacteria 37249
243 Ga0207667_10003667 3300025949 Bacteria 18932
244 Ga0207667_10004868 3300025949 Bacteria 16399
245 Ga0207667_10014555 3300025949 Bacteria 8961
246 Ga0207667_10026360 3300025949 Bacteria 6352
247 Ga0207667_10040548 3300025949 Bacteria 4958
248 Ga0207667_10100750 3300025949 Bacteria 2980
249 Ga0207667_10184572 3300025949 Bacteria 2141
250 Ga0207667_10346804 3300025949 Bacteria 1514
251 Ga0207640_10094912 3300025981 Bacteria 2075
252 Ga0207640_10104991 3300025981 Bacteria 1990
253 Ga0207658_10000416 3300025986 Bacteria 40419
254 Ga0207677_10000025 3300026023 Bacteria 127400
255 Ga0207703_10000963 3300026035 Bacteria 27829
256 Ga0207703_10324466 3300026035 Bacteria 1411
257 Ga0207639_10000417 3300026041 Bacteria 29519
258 Ga0207639_10006021 3300026041 Bacteria 8226
259 Ga0207639_10044164 3300026041 Bacteria 3350
260 Ga0207639_10123651 3300026041 Bacteria 2130
261 Ga0207639_10125432 3300026041 Bacteria 2117
262 Ga0207639_10151687 3300026041 Bacteria 1942
263 Ga0207678_10034418 3300026067 Bacteria 4412
264 Ga0207678_10215342 3300026067 Bacteria 1643
265 Ga0207702_10003543 3300026078 Bacteria 14210
266 Ga0207702_10030556 3300026078 Bacteria 4489
267 Ga0207702_10155437 3300026078 Bacteria 2085
268 Ga0207702_10166930 3300026078 Bacteria 2015
269 Ga0207702_10436519 3300026078 Unclassified 1268
270 Ga0207641_10006655 3300026088 Bacteria 9703
271 Ga0207641_10028425 3300026088 Bacteria 4621
272 Ga0207676_10000514 3300026095 Bacteria 32542
273 Ga0207676_10012392 3300026095 Bacteria 6109
274 Ga0207674_10000459 3300026116 Bacteria 53315
275 Ga0207674_10001149 3300026116 Bacteria 34310
276 Ga0207674_10018340 3300026116 Bacteria 7609
277 Ga0207674_10028419 3300026116 Bacteria 5903
278 Ga0207674_10158020 3300026116 Bacteria 2222
279 Ga0207674_10201062 3300026116 Bacteria 1942
280 Ga0207683_10003208 3300026121 Bacteria 14272
281 Ga0207683_10046762 3300026121 Bacteria 3789
282 Ga0207698_10000007 3300026142 Bacteria 289457
283 Ga0207698_10001699 3300026142 Bacteria 12830
284 Ga0207698_10006424 3300026142 Bacteria 7335
285 Ga0207698_10028286 3300026142 Bacteria 3994
286 Ga0207698_10060402 3300026142 Unclassified 2948
287 Ga0207698_10640596 3300026142 Unclassified 1052
288 Ga0268266_10012860 3300028379 Bacteria 7227
289 Ga0268266_10035026 3300028379 Bacteria 4270
290 Ga0268266_10084576 3300028379 Bacteria 2770
291 Ga0268265_10064204 3300028380 Bacteria 2828
292 Ga0268264_10006372 3300028381 Bacteria 9946
293 Ga0265318_10014439 3300028577 Bacteria 3315
294 Ga0265336_10000806 3300028666 Bacteria 16518
295 Ga0265336_10004363 3300028666 Bacteria 5360
296 Ga0265338_10009018 3300028800 Bacteria 11999
297 Ga0265338_10023642 3300028800 Bacteria 6308
298 Ga0265338_10023834 3300028800 Bacteria 6275
299 Ga0265330_10000852 3300031235 Bacteria 19100
300 Ga0265332_10010593 3300031238 Bacteria 4104
301 Ga0265328_10003655 3300031239 Bacteria 6777
302 Ga0265320_10029101 3300031240 Bacteria 2861
303 Ga0265325_10002033 3300031241 Bacteria 13905
304 Ga0265325_10022599 3300031241 Bacteria 3443
305 Ga0265325_10057472 3300031241 Bacteria 1984
306 Ga0265329_10016883 3300031242 Bacteria 2523
307 Ga0265340_10010451 3300031247 Bacteria 4963
308 Ga0265339_10000029 3300031249 Bacteria 139089
309 Ga0265339_10021467 3300031249 Bacteria 3756
310 Ga0265339_10029659 3300031249 Bacteria 3102
311 Ga0265339_10082381 3300031249 Bacteria 1698
312 Ga0265331_10053628 3300031250 Bacteria 1922
313 Ga0265331_10091159 3300031250 Bacteria 1408
314 Ga0265316_10002998 3300031344 Bacteria 17267
315 Ga0265316_10128561 3300031344 Bacteria 1909
316 Ga0265313_10001614 3300031595 Bacteria 20940
317 Ga0265313_10018670 3300031595 Bacteria 3886
318 Ga0265313_10065519 3300031595 Bacteria 1686
319 Ga0265314_10000139 3300031711 Bacteria 108861
320 Ga0265314_10158198 3300031711 Bacteria 1381
321 Ga0265342_10001906 3300031712 Bacteria 18762
322 Ga0265342_10002378 3300031712 Bacteria 16291
323 Ga0265342_10023354 3300031712 Bacteria 3916
324 Ga0265342_10024936 3300031712 Bacteria 3768
325 Ga0265342_10085920 3300031712 Bacteria 1809
326 Ga0265342_10120770 3300031712 Bacteria 1476
327 Ga0307510_10016280 3300033180 Bacteria 8779
328 Ga0373955_0135009 3300035172 Bacteria 1443
329 Ga0373933_0025712 3300035724 Bacteria 3378
330 Ga0373937_0002195 3300036401 Bacteria 16312
331 Ga0373937_0349359 3300036401 Bacteria 1401
332 Ga0436364_0717863 3300037853 Bacteria 145182
333 Ga0436360_0789444 3300039438 Bacteria 3640
334 Ga0436362_1069305 3300039453 Bacteria 2680
335 Ga0439448_0004925 3300042005 Bacteria 3791
336 Ga0466966_0130917 3300044684 Bacteria 1536
337 Ga0466967_0000205 3300045976 Bacteria 24844
338 Ga0495603_0039776 3300046455 Bacteria 2816
339 Ga0495629_0002846 3300046459 Bacteria 13224
340 Ga0495629_0021663 3300046459 Bacteria 4586
341 Ga0495651_0017085 3300046462 Bacteria 5622
342 Ga0495653_0118243 3300046463 Bacteria 1893
343 Ga0495650_0000037 3300046471 Bacteria 390090
344 Ga0495650_0003867 3300046471 Bacteria 10613
345 Ga0495580_0016489 3300046472 Bacteria 5542
346 Ga0495582_0003426 3300046473 Bacteria 8931
347 Ga0495582_0195162 3300046473 Bacteria 1156
348 Ga0495639_0003040 3300046475 Bacteria 7304
349 Ga0495639_0043264 3300046475 Bacteria 2034
350 Ga0495662_0019719 3300046476 Bacteria 3262
351 Ga0495664_0016467 3300046477 Bacteria 4212
352 Ga0495664_0071166 3300046477 Bacteria 2077
353 Ga0495585_0005419 3300046492 Bacteria 8048
354 Ga0495594_0000757 3300046499 Bacteria 16578
355 Ga0495594_0000857 3300046499 Bacteria 15656
356 Ga0495596_0024519 3300046500 Bacteria 2441
357 Ga0495608_0085525 3300046511 Bacteria 2044
358 Ga0495631_0036663 3300046518 Bacteria 2189
359 Ga0495631_0107708 3300046518 Bacteria 1198
360 Ga0495644_0000004 3300046523 Bacteria 158166
361 Ga0495648_0052460 3300046524 Bacteria 2477
362 Ga0495666_0096753 3300046526 Bacteria 1391
363 Ga0495642_0009760 3300046528 Bacteria 3676
364 Ga0495652_0030804 3300046529 Bacteria 4701
365 Ga0495665_0013659 3300046531 Bacteria 4387
366 Ga0495665_0037540 3300046531 Bacteria 2585
367 Ga0495640_0186559 3300046533 Bacteria 1319
368 Ga0495640_0227203 3300046533 Bacteria 1175
369 Ga0495586_0002255 3300046535 Bacteria 10494
370 Ga0495586_0102719 3300046535 Bacteria 1587
371 Ga0495587_0004453 3300046536 Bacteria 9230
372 Ga0495609_0007829 3300046538 Bacteria 5288
373 Ga0495645_0001171 3300046543 Bacteria 17849
374 Ga0495633_0008114 3300046558 Bacteria 5955
375 Ga0495667_0054230 3300046559 Bacteria 2638
376 Ga0495668_0013828 3300046616 Bacteria 4747
377 Ga0495668_0114949 3300046616 Bacteria 1472
378 Ga0495634_0009647 3300046642 Bacteria 7110
379 Ga0495611_0036149 3300046648 Bacteria 2190
380 Ga0495625_0004435 3300046660 Bacteria 13281
381 Ga0495625_0005078 3300046660 Bacteria 12177
382 Ga0495625_0011670 3300046660 Bacteria 7147
383 Ga0495625_0013991 3300046660 Bacteria 6426
384 Ga0495635_0057928 3300046663 Bacteria 2665
385 Ga0495635_0108117 3300046663 Bacteria 1900
386 Ga0495661_0026663 3300046665 Bacteria 3720
387 Ga0495588_0037486 3300046674 Bacteria 2463
388 Ga0495599_0061508 3300046678 Bacteria 2346
389 Ga0495623_0013814 3300046679 Bacteria 5234
390 Ga0495623_0037323 3300046679 Unclassified 3110
391 Ga0495646_0073393 3300046680 Bacteria 2010
392 Ga0495669_0028204 3300046684 Bacteria 2457
393 Ga0495613_0003370 3300046689 Bacteria 11940
394 Ga0495613_0005996 3300046689 Bacteria 9096
395 Ga0495613_0025076 3300046689 Bacteria 4444
396 Ga0495613_0031867 3300046689 Bacteria 3915
397 Ga0495624_0018645 3300046690 Bacteria 4640
398 Ga0495649_0031529 3300046694 Bacteria 2922
399 Ga0495649_0044136 3300046694 Bacteria 2434
400 Ga0495600_0022161 3300046809 Bacteria 4076
401 Ga0495600_0232392 3300046809 Bacteria 1177
402 Ga0495600_0248733 3300046809 Bacteria 1131
403 Ga0495581_0041532 3300047315 Bacteria 2662
404 Ga0495581_0050562 3300047315 Bacteria 2400
405 Ga0495604_0041787 3300047317 Bacteria 3595
406 Ga0495604_0071616 3300047317 Bacteria 2621
407 Ga0495672_0006175 3300047320 Bacteria 9343
408 Ga0495676_0041749 3300047321 Bacteria 3772
409 Ga0495676_0144561 3300047321 Bacteria 1700
410 Ga0495680_0072889 3300047322 Bacteria 2611
411 Ga0495683_0029751 3300047323 Bacteria 2790
412 Ga0495675_0015819 3300047444 Bacteria 4772
413 Ga0495684_0016800 3300047471 Bacteria 5639
414 Ga0495684_0073471 3300047471 Bacteria 2598
415 Ga0495684_0197615 3300047471 Bacteria 1484
416 Ga0495686_0000382 3300047472 Bacteria 70847
417 Ga0495686_0017994 3300047472 Bacteria 4751
418 Ga0495686_0031257 3300047472 Bacteria 3454
419 Ga0495602_0053125 3300048088 Bacteria 3591
420 Ga0496100_0128699 3300048903 Bacteria 1780
421 Ga0496104_0098936 3300048907 Bacteria 2792
422 Ga0496105_0008684 3300048908 Bacteria 7904
423 Ga0496106_0216362 3300048909 Unclassified 1527
424 Ga0496110_0072544 3300048913 Bacteria 3055
425 Ga0496110_0248807 3300048913 Bacteria 1618
426 Ga0496112_0036100 3300048915 Bacteria 4820
427 Ga0496114_0012496 3300048917 Bacteria 6799
428 Ga0496114_0051110 3300048917 Bacteria 3441
429 Ga0496115_0012658 3300048918 Bacteria 6357
430 Ga0496126_0003782 3300048929 Bacteria 18781
431 Ga0495682_0015562 3300049460 Bacteria 2882
432 Ga0501031_0037943 3300049568 Bacteria 3145
433 Ga0501032_0002119 3300049569 Bacteria 15644
434 Ga0501032_0180133 3300049569 Bacteria 1384
435 Ga0501033_0009365 3300049570 Bacteria 7539
436 Ga0501034_0036921 3300049571 Bacteria 4947
437 Ga0501036_0001980 3300049572 Bacteria 15885
438 Ga0501037_0053081 3300049573 Bacteria 2964
439 Ga0501038_0008810 3300049574 Bacteria 9256
440 Ga0501039_0099189 3300049575 Bacteria 2273
441 Ga0501043_0000430 3300049579 Bacteria 37723
442 Ga0501046_0000371 3300049580 Bacteria 45434
443 Ga0501047_0006342 3300049581 Bacteria 11122
444 Ga0501047_0034547 3300049581 Bacteria 4882
445 Ga0501073_0008142 3300049589 Bacteria 7777
446 Ga0501073_0034835 3300049589 Bacteria 3581
447 Ga0501080_0100175 3300049742 Bacteria 2688
448 Ga0501035_0002370 3300049822 Bacteria 18512
449 Ga0501044_0068873 3300049823 Bacteria 3603
450 Ga0501044_0350260 3300049823 Bacteria 1396
451 Ga0500651_0000061 3300053093 Bacteria 71477
452 Ga0500595_000423 3300053119 Bacteria 26615
453 Ga0500595_012007 3300053119 Bacteria 3362
454 Ga0500661_003646 3300055283 Bacteria 2892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021377 Ga0213874_10088265 Ga0213874_100882651 273
2 3300010159 Ga0099796_10070131 Ga0099796_100701312 279
3 3300005435 Ga0070714_100146821 Ga0070714_1001468213 282
4 3300005435 Ga0070714_100589364 Ga0070714_1005893641 282
5 3300005436 Ga0070713_100003373 Ga0070713_1000033733 282
6 3300005437 Ga0070710_10008907 Ga0070710_100089076 282
7 3300005437 Ga0070710_10036338 Ga0070710_100363381 282
8 3300005439 Ga0070711_100002484 Ga0070711_1000024844 282
9 3300005471 Ga0070698_100009571 Ga0070698_1000095715 282
10 3300005518 Ga0070699_100136828 Ga0070699_1001368282 282
11 3300006028 Ga0070717_10000675 Ga0070717_100006755 282
12 3300006028 Ga0070717_10016123 Ga0070717_100161235 282
13 3300006163 Ga0070715_10141988 Ga0070715_101419881 282
14 3300006175 Ga0070712_100047633 Ga0070712_1000476332 282
15 3300006175 Ga0070712_100085071 Ga0070712_1000850712 282
16 3300006175 Ga0070712_100328402 Ga0070712_1003284021 282
17 3300025915 Ga0207693_10001564 Ga0207693_1000156420 282
18 3300025915 Ga0207693_10017330 Ga0207693_100173302 282
19 3300025915 Ga0207693_10088895 Ga0207693_100888954 282
20 3300025915 Ga0207693_10104992 Ga0207693_101049922 282
21 3300025916 Ga0207663_10069478 Ga0207663_100694783 282
22 3300025929 Ga0207664_10013534 Ga0207664_100135342 282
23 3300039438 Ga0436360_0789444 Ga0436360_0789444_1311_2198 282
24 3300039453 Ga0436362_1069305 Ga0436362_1069305_1497_2384 282
25 3300021388 Ga0213875_10000132 Ga0213875_1000013276 284
26 3300026067 Ga0207678_10215342 Ga0207678_102153422 284
27 3300037853 Ga0436364_0717863 Ga0436364_0717863_52942_53835 284
28 3300047472 Ga0495686_0031257 Ga0495686_0031257_2454_3398 285
29 3300009177 Ga0105248_10000049 Ga0105248_10000049124 288
30 3300009551 Ga0105238_10023691 Ga0105238_100236912 288
31 3300025941 Ga0207711_10000033 Ga0207711_10000033160 288
32 3300048913 Ga0496110_0248807 Ga0496110_0248807_368_1369 288
33 3300025924 Ga0207694_10017875 Ga0207694_100178753 289
34 3300044684 Ga0466966_0130917 Ga0466966_0130917_529_1482 290
35 3300026035 Ga0207703_10324466 Ga0207703_103244662 291
36 3300049823 Ga0501044_0350260 Ga0501044_0350260_331_1269 293
37 3300049568 Ga0501031_0037943 Ga0501031_0037943_350_1288 295
38 3300049569 Ga0501032_0002119 Ga0501032_0002119_10631_11569 295
39 3300049570 Ga0501033_0009365 Ga0501033_0009365_6027_6965 295
40 3300049571 Ga0501034_0036921 Ga0501034_0036921_1701_2639 295
41 3300049572 Ga0501036_0001980 Ga0501036_0001980_5897_6835 295
42 3300049573 Ga0501037_0053081 Ga0501037_0053081_1594_2532 295
43 3300049574 Ga0501038_0008810 Ga0501038_0008810_2937_3875 295
44 3300049575 Ga0501039_0099189 Ga0501039_0099189_1080_2018 295
45 3300049579 Ga0501043_0000430 Ga0501043_0000430_24192_25130 295
46 3300049580 Ga0501046_0000371 Ga0501046_0000371_40567_41505 295
47 3300049581 Ga0501047_0006342 Ga0501047_0006342_5942_6880 295
48 3300049589 Ga0501073_0008142 Ga0501073_0008142_1451_2389 295
49 3300049742 Ga0501080_0100175 Ga0501080_0100175_1371_2309 295
50 3300049822 Ga0501035_0002370 Ga0501035_0002370_11548_12486 295
51 3300049823 Ga0501044_0068873 Ga0501044_0068873_866_1804 295
52 3300009148 Ga0105243_10374786 Ga0105243_103747862 296
53 3300028379 Ga0268266_10084576 Ga0268266_100845763 297
54 3300005327 Ga0070658_10009570 Ga0070658_100095705 299
55 3300005327 Ga0070658_10031101 Ga0070658_100311014 299
56 3300005329 Ga0070683_100000210 Ga0070683_1000002102 299
57 3300005329 Ga0070683_100014043 Ga0070683_1000140434 299
58 3300005329 Ga0070683_100078140 Ga0070683_1000781403 299
59 3300005329 Ga0070683_100138734 Ga0070683_1001387342 299
60 3300005334 Ga0068869_100014715 Ga0068869_1000147153 299
61 3300005338 Ga0068868_100000046 Ga0068868_10000004635 299
62 3300005339 Ga0070660_100013531 Ga0070660_1000135314 299
63 3300005353 Ga0070669_100261218 Ga0070669_1002612182 299
64 3300005355 Ga0070671_100011009 Ga0070671_1000110095 299
65 3300005355 Ga0070671_100067313 Ga0070671_1000673133 299
66 3300005367 Ga0070667_100001013 Ga0070667_1000010134 299
67 3300005436 Ga0070713_100006684 Ga0070713_1000066843 299
68 3300005436 Ga0070713_100310003 Ga0070713_1003100031 299
69 3300005458 Ga0070681_10001472 Ga0070681_1000147215 299
70 3300005530 Ga0070679_100000871 Ga0070679_10000087122 299
71 3300005535 Ga0070684_100003273 Ga0070684_10000327313 299
72 3300005535 Ga0070684_100011614 Ga0070684_1000116147 299
73 3300005535 Ga0070684_100040318 Ga0070684_1000403183 299
74 3300005535 Ga0070684_100112555 Ga0070684_1001125553 299
75 3300005539 Ga0068853_100008309 Ga0068853_1000083095 299
76 3300005539 Ga0068853_100010282 Ga0068853_1000102824 299
77 3300005539 Ga0068853_100196854 Ga0068853_1001968541 299
78 3300005548 Ga0070665_100153255 Ga0070665_1001532552 299
79 3300005548 Ga0070665_100318820 Ga0070665_1003188202 299
80 3300005563 Ga0068855_100000368 Ga0068855_10000036828 299
81 3300005563 Ga0068855_100021426 Ga0068855_1000214261 299
82 3300005563 Ga0068855_100035349 Ga0068855_1000353495 299
83 3300005563 Ga0068855_100071987 Ga0068855_1000719872 299
84 3300005563 Ga0068855_100194711 Ga0068855_1001947113 299
85 3300005564 Ga0070664_100028399 Ga0070664_1000283994 299
86 3300005577 Ga0068857_100000726 Ga0068857_1000007269 299
87 3300005577 Ga0068857_100004261 Ga0068857_1000042618 299
88 3300005577 Ga0068857_100137080 Ga0068857_1001370802 299
89 3300005578 Ga0068854_100015583 Ga0068854_1000155833 299
90 3300005578 Ga0068854_100080145 Ga0068854_1000801452 299
91 3300005614 Ga0068856_100000660 Ga0068856_10000066023 299
92 3300005614 Ga0068856_100004343 Ga0068856_10000434310 299
93 3300005614 Ga0068856_100008939 Ga0068856_1000089396 299
94 3300005614 Ga0068856_100053092 Ga0068856_1000530922 299
95 3300005614 Ga0068856_100104923 Ga0068856_1001049233 299
96 3300005614 Ga0068856_100223843 Ga0068856_1002238431 299
97 3300005616 Ga0068852_100000063 Ga0068852_10000006329 299
98 3300005616 Ga0068852_100003275 Ga0068852_1000032757 299
99 3300005616 Ga0068852_100011022 Ga0068852_1000110225 299
100 3300005616 Ga0068852_100020337 Ga0068852_1000203373 299
101 3300005616 Ga0068852_100055485 Ga0068852_1000554852 299
102 3300005616 Ga0068852_100083646 Ga0068852_1000836462 299
103 3300005617 Ga0068859_100044781 Ga0068859_1000447814 299
104 3300005618 Ga0068864_100000782 Ga0068864_1000007822 299
105 3300005834 Ga0068851_10005484 Ga0068851_100054845 299
106 3300005834 Ga0068851_10031475 Ga0068851_100314753 299
107 3300005841 Ga0068863_100000689 Ga0068863_10000068923 299
108 3300005842 Ga0068858_100000792 Ga0068858_1000007929 299
109 3300005842 Ga0068858_100008850 Ga0068858_1000088505 299
110 3300005843 Ga0068860_100000486 Ga0068860_10000048628 299
111 3300006237 Ga0097621_100027465 Ga0097621_1000274653 299
112 3300006358 Ga0068871_100000318 Ga0068871_1000003182 299
113 3300006931 Ga0097620_100044777 Ga0097620_1000447774 299
114 3300009093 Ga0105240_10000187 Ga0105240_1000018728 299
115 3300009093 Ga0105240_10000663 Ga0105240_1000066324 299
116 3300009093 Ga0105240_10003591 Ga0105240_1000359117 299
117 3300009093 Ga0105240_10010389 Ga0105240_100103895 299
118 3300009093 Ga0105240_10019453 Ga0105240_100194535 299
119 3300009093 Ga0105240_10030947 Ga0105240_100309474 299
120 3300009093 Ga0105240_10103841 Ga0105240_101038414 299
121 3300009093 Ga0105240_10130044 Ga0105240_101300443 299
122 3300009093 Ga0105240_10640735 Ga0105240_106407351 299
123 3300009098 Ga0105245_10029141 Ga0105245_100291413 299
124 3300009098 Ga0105245_10242918 Ga0105245_102429182 299
125 3300009101 Ga0105247_10020854 Ga0105247_100208543 299
126 3300009174 Ga0105241_10000190 Ga0105241_100001903 299
127 3300009174 Ga0105241_10001787 Ga0105241_100017877 299
128 3300009174 Ga0105241_10024512 Ga0105241_100245123 299
129 3300009174 Ga0105241_10024725 Ga0105241_100247252 299
130 3300009174 Ga0105241_10037780 Ga0105241_100377803 299
131 3300009174 Ga0105241_10134391 Ga0105241_101343911 299
132 3300009176 Ga0105242_10076073 Ga0105242_100760733 299
133 3300009177 Ga0105248_10007643 Ga0105248_100076437 299
134 3300009545 Ga0105237_10008461 Ga0105237_100084618 299
135 3300009545 Ga0105237_10056650 Ga0105237_100566503 299
136 3300009551 Ga0105238_10000445 Ga0105238_1000044528 299
137 3300009551 Ga0105238_10002357 Ga0105238_100023577 299
138 3300009551 Ga0105238_10005713 Ga0105238_100057132 299
139 3300009551 Ga0105238_10006055 Ga0105238_1000605510 299
140 3300009551 Ga0105238_10169586 Ga0105238_101695862 299
141 3300009551 Ga0105238_10176888 Ga0105238_101768883 299
142 3300010375 Ga0105239_10006364 Ga0105239_1000636411 299
143 3300010375 Ga0105239_10059949 Ga0105239_100599494 299
144 3300010375 Ga0105239_10101852 Ga0105239_101018522 299
145 3300011119 Ga0105246_10015497 Ga0105246_100154973 299
146 3300013102 Ga0157371_10029523 Ga0157371_100295232 299
147 3300013102 Ga0157371_10100237 Ga0157371_101002372 299
148 3300013104 Ga0157370_10000066 Ga0157370_1000006627 299
149 3300013104 Ga0157370_10032013 Ga0157370_100320133 299
150 3300013105 Ga0157369_10000188 Ga0157369_100001883 299
151 3300013105 Ga0157369_10010473 Ga0157369_100104738 299
152 3300013105 Ga0157369_10012172 Ga0157369_100121725 299
153 3300013105 Ga0157369_10015595 Ga0157369_100155959 299
154 3300013105 Ga0157369_10048820 Ga0157369_100488204 299
155 3300013105 Ga0157369_10110948 Ga0157369_101109482 299
156 3300013296 Ga0157374_10014679 Ga0157374_100146794 299
157 3300013296 Ga0157374_10021668 Ga0157374_100216683 299
158 3300013296 Ga0157374_10048261 Ga0157374_100482613 299
159 3300013296 Ga0157374_10148791 Ga0157374_101487912 299
160 3300013296 Ga0157374_10190856 Ga0157374_101908561 299
161 3300013296 Ga0157374_10492078 Ga0157374_104920781 299
162 3300013297 Ga0157378_10017980 Ga0157378_100179803 299
163 3300013297 Ga0157378_10039289 Ga0157378_100392896 299
164 3300013306 Ga0163162_10048185 Ga0163162_100481853 299
165 3300013307 Ga0157372_10000114 Ga0157372_1000011438 299
166 3300013307 Ga0157372_10011045 Ga0157372_100110456 299
167 3300013307 Ga0157372_10022400 Ga0157372_100224003 299
168 3300013307 Ga0157372_10138810 Ga0157372_101388102 299
169 3300013307 Ga0157372_10156527 Ga0157372_101565273 299
170 3300013307 Ga0157372_10180626 Ga0157372_101806263 299
171 3300013308 Ga0157375_10075230 Ga0157375_100752303 299
172 3300014325 Ga0163163_10000351 Ga0163163_100003513 299
173 3300014968 Ga0157379_10006606 Ga0157379_100066063 299
174 3300014969 Ga0157376_10042282 Ga0157376_100422822 299
175 3300017792 Ga0163161_10044039 Ga0163161_100440392 299
176 3300025321 Ga0207656_10105600 Ga0207656_101056001 299
177 3300025909 Ga0207705_10164856 Ga0207705_101648562 299
178 3300025909 Ga0207705_10203369 Ga0207705_102033692 299
179 3300025911 Ga0207654_10001701 Ga0207654_100017018 299
180 3300025911 Ga0207654_10002664 Ga0207654_1000266411 299
181 3300025911 Ga0207654_10037291 Ga0207654_100372913 299
182 3300025911 Ga0207654_10100360 Ga0207654_101003602 299
183 3300025912 Ga0207707_10002291 Ga0207707_1000229115 299
184 3300025913 Ga0207695_10000052 Ga0207695_10000052226 299
185 3300025913 Ga0207695_10000108 Ga0207695_1000010894 299
186 3300025913 Ga0207695_10000253 Ga0207695_1000025324 299
187 3300025913 Ga0207695_10002288 Ga0207695_100022886 299
188 3300025913 Ga0207695_10011700 Ga0207695_100117004 299
189 3300025913 Ga0207695_10090024 Ga0207695_100900241 299
190 3300025914 Ga0207671_10000081 Ga0207671_1000008188 299
191 3300025914 Ga0207671_10003498 Ga0207671_100034984 299
192 3300025914 Ga0207671_10025557 Ga0207671_100255574 299
193 3300025920 Ga0207649_10020120 Ga0207649_100201203 299
194 3300025921 Ga0207652_10011328 Ga0207652_100113284 299
195 3300025924 Ga0207694_10000108 Ga0207694_1000010827 299
196 3300025924 Ga0207694_10003205 Ga0207694_100032054 299
197 3300025924 Ga0207694_10003511 Ga0207694_1000351112 299
198 3300025924 Ga0207694_10058070 Ga0207694_100580703 299
199 3300025924 Ga0207694_10374730 Ga0207694_103747301 299
200 3300025925 Ga0207650_10001335 Ga0207650_100013352 299
201 3300025927 Ga0207687_10000440 Ga0207687_1000044021 299
202 3300025927 Ga0207687_10003837 Ga0207687_100038378 299
203 3300025928 Ga0207700_10002098 Ga0207700_100020989 299
204 3300025928 Ga0207700_10208178 Ga0207700_102081782 299
205 3300025931 Ga0207644_10007102 Ga0207644_100071023 299
206 3300025931 Ga0207644_10416274 Ga0207644_104162741 299
207 3300025940 Ga0207691_10036632 Ga0207691_100366322 299
208 3300025941 Ga0207711_10030369 Ga0207711_100303693 299
209 3300025941 Ga0207711_10066170 Ga0207711_100661702 299
210 3300025941 Ga0207711_10155661 Ga0207711_101556611 299
211 3300025942 Ga0207689_10001260 Ga0207689_1000126017 299
212 3300025944 Ga0207661_10002024 Ga0207661_100020242 299
213 3300025944 Ga0207661_10011894 Ga0207661_100118942 299
214 3300025944 Ga0207661_10112566 Ga0207661_101125662 299
215 3300025944 Ga0207661_10608156 Ga0207661_106081561 299
216 3300025945 Ga0207679_10126267 Ga0207679_101262672 299
217 3300025949 Ga0207667_10000934 Ga0207667_100009345 299
218 3300025949 Ga0207667_10004868 Ga0207667_100048682 299
219 3300025949 Ga0207667_10014555 Ga0207667_100145553 299
220 3300025949 Ga0207667_10040548 Ga0207667_100405483 299
221 3300025949 Ga0207667_10100750 Ga0207667_101007504 299
222 3300025981 Ga0207640_10094912 Ga0207640_100949121 299
223 3300025986 Ga0207658_10000416 Ga0207658_1000041633 299
224 3300026023 Ga0207677_10000025 Ga0207677_1000002528 299
225 3300026035 Ga0207703_10000963 Ga0207703_1000096321 299
226 3300026041 Ga0207639_10000417 Ga0207639_1000041722 299
227 3300026041 Ga0207639_10006021 Ga0207639_100060212 299
228 3300026041 Ga0207639_10044164 Ga0207639_100441642 299
229 3300026041 Ga0207639_10123651 Ga0207639_101236512 299
230 3300026041 Ga0207639_10125432 Ga0207639_101254322 299
231 3300026041 Ga0207639_10151687 Ga0207639_101516872 299
232 3300026078 Ga0207702_10003543 Ga0207702_100035437 299
233 3300026078 Ga0207702_10030556 Ga0207702_100305563 299
234 3300026078 Ga0207702_10155437 Ga0207702_101554372 299
235 3300026078 Ga0207702_10166930 Ga0207702_101669302 299
236 3300026078 Ga0207702_10436519 Ga0207702_104365192 299
237 3300026088 Ga0207641_10006655 Ga0207641_100066557 299
238 3300026095 Ga0207676_10000514 Ga0207676_1000051421 299
239 3300026116 Ga0207674_10000459 Ga0207674_100004599 299
240 3300026116 Ga0207674_10001149 Ga0207674_100011494 299
241 3300026116 Ga0207674_10028419 Ga0207674_100284193 299
242 3300026116 Ga0207674_10158020 Ga0207674_101580202 299
243 3300026116 Ga0207674_10201062 Ga0207674_102010623 299
244 3300026121 Ga0207683_10003208 Ga0207683_100032087 299
245 3300026142 Ga0207698_10000007 Ga0207698_10000007225 299
246 3300026142 Ga0207698_10001699 Ga0207698_100016995 299
247 3300026142 Ga0207698_10006424 Ga0207698_100064243 299
248 3300026142 Ga0207698_10060402 Ga0207698_100604023 299
249 3300026142 Ga0207698_10640596 Ga0207698_106405961 299
250 3300028379 Ga0268266_10035026 Ga0268266_100350262 299
251 3300028380 Ga0268265_10064204 Ga0268265_100642043 299
252 3300028381 Ga0268264_10006372 Ga0268264_1000637210 299
253 3300028577 Ga0265318_10014439 Ga0265318_100144392 299
254 3300028666 Ga0265336_10000806 Ga0265336_1000080611 299
255 3300028666 Ga0265336_10004363 Ga0265336_100043634 299
256 3300028800 Ga0265338_10009018 Ga0265338_100090188 299
257 3300028800 Ga0265338_10023642 Ga0265338_100236427 299
258 3300028800 Ga0265338_10023834 Ga0265338_100238343 299
259 3300031235 Ga0265330_10000852 Ga0265330_1000085223 299
260 3300031238 Ga0265332_10010593 Ga0265332_100105934 299
261 3300031239 Ga0265328_10003655 Ga0265328_100036556 299
262 3300031240 Ga0265320_10029101 Ga0265320_100291013 299
263 3300031241 Ga0265325_10002033 Ga0265325_100020333 299
264 3300031241 Ga0265325_10022599 Ga0265325_100225994 299
265 3300031241 Ga0265325_10057472 Ga0265325_100574722 299
266 3300031242 Ga0265329_10016883 Ga0265329_100168832 299
267 3300031247 Ga0265340_10010451 Ga0265340_100104513 299
268 3300031249 Ga0265339_10000029 Ga0265339_10000029112 299
269 3300031249 Ga0265339_10021467 Ga0265339_100214672 299
270 3300031249 Ga0265339_10029659 Ga0265339_100296593 299
271 3300031249 Ga0265339_10082381 Ga0265339_100823812 299
272 3300031250 Ga0265331_10091159 Ga0265331_100911592 299
273 3300031344 Ga0265316_10002998 Ga0265316_1000299819 299
274 3300031595 Ga0265313_10001614 Ga0265313_100016148 299
275 3300031595 Ga0265313_10018670 Ga0265313_100186703 299
276 3300031711 Ga0265314_10000139 Ga0265314_1000013975 299
277 3300031711 Ga0265314_10158198 Ga0265314_101581981 299
278 3300031712 Ga0265342_10001906 Ga0265342_1000190614 299
279 3300031712 Ga0265342_10002378 Ga0265342_1000237820 299
280 3300031712 Ga0265342_10023354 Ga0265342_100233543 299
281 3300031712 Ga0265342_10024936 Ga0265342_100249361 299
282 3300031712 Ga0265342_10120770 Ga0265342_101207701 299
283 3300045976 Ga0466967_0000205 Ga0466967_0000205_2508_3422 299
284 3300046475 Ga0495639_0043264 Ga0495639_0043264_360_1274 299
285 3300046531 Ga0495665_0037540 Ga0495665_0037540_100_1014 299
286 3300046535 Ga0495586_0102719 Ga0495586_0102719_236_1150 299
287 3300046536 Ga0495587_0004453 Ga0495587_0004453_5127_6041 299
288 3300046543 Ga0495645_0001171 Ga0495645_0001171_9043_9957 299
289 3300046663 Ga0495635_0108117 Ga0495635_0108117_169_1083 299
290 3300046679 Ga0495623_0037323 Ga0495623_0037323_1314_2228 299
291 3300046680 Ga0495646_0073393 Ga0495646_0073393_1043_1957 299
292 3300046689 Ga0495613_0025076 Ga0495613_0025076_346_1260 299
293 3300046809 Ga0495600_0248733 Ga0495600_0248733_106_1020 299
294 3300047471 Ga0495684_0016800 Ga0495684_0016800_3750_4664 299
295 3300048088 Ga0495602_0053125 Ga0495602_0053125_2086_3000 299
296 3300048903 Ga0496100_0128699 Ga0496100_0128699_493_1407 299
297 3300048907 Ga0496104_0098936 Ga0496104_0098936_923_1837 299
298 3300048908 Ga0496105_0008684 Ga0496105_0008684_1390_2304 299
299 3300048909 Ga0496106_0216362 Ga0496106_0216362_229_1143 299
300 3300048917 Ga0496114_0012496 Ga0496114_0012496_5321_6235 299
301 3300048918 Ga0496115_0012658 Ga0496115_0012658_43_957 299
302 3300049460 Ga0495682_0015562 Ga0495682_0015562_1836_2750 299
303 iso_pu_bacteria 2884215851 2884218956 299
304 3300005340 Ga0070689_100253371 Ga0070689_1002533712 300
305 3300005436 Ga0070713_100006568 Ga0070713_1000065683 300
306 3300031250 Ga0265331_10053628 Ga0265331_100536282 300
307 3300031344 Ga0265316_10128561 Ga0265316_101285611 300
308 3300031595 Ga0265313_10065519 Ga0265313_100655192 300
309 3300031712 Ga0265342_10085920 Ga0265342_100859202 300
310 3300013308 Ga0157375_10619682 Ga0157375_106196821 301
311 3300005327 Ga0070658_10031055 Ga0070658_100310553 302
312 3300005339 Ga0070660_100045365 Ga0070660_1000453652 302
313 3300005344 Ga0070661_100228531 Ga0070661_1002285311 302
314 3300005366 Ga0070659_100034743 Ga0070659_1000347433 302
315 3300005435 Ga0070714_100037725 Ga0070714_1000377254 302
316 3300005563 Ga0068855_100005193 Ga0068855_1000051933 302
317 3300005616 Ga0068852_100081576 Ga0068852_1000815763 302
318 3300005616 Ga0068852_100554987 Ga0068852_1005549871 302
319 3300009093 Ga0105240_10000498 Ga0105240_1000049815 302
320 3300009148 Ga0105243_10037709 Ga0105243_100377094 302
321 3300013104 Ga0157370_10016554 Ga0157370_100165544 302
322 3300013105 Ga0157369_10026293 Ga0157369_100262934 302
323 3300013297 Ga0157378_10119489 Ga0157378_101194892 302
324 3300014968 Ga0157379_10265075 Ga0157379_102650752 302
325 3300025913 Ga0207695_10000106 Ga0207695_1000010623 302
326 3300025919 Ga0207657_10038398 Ga0207657_100383983 302
327 3300025929 Ga0207664_10022918 Ga0207664_100229183 302
328 3300025949 Ga0207667_10003667 Ga0207667_1000366710 302
329 3300025949 Ga0207667_10184572 Ga0207667_101845723 302
330 3300025981 Ga0207640_10104991 Ga0207640_101049912 302
331 3300026142 Ga0207698_10028286 Ga0207698_100282864 302
332 3300028379 Ga0268266_10012860 Ga0268266_100128605 302
333 3300035172 Ga0373955_0135009 Ga0373955_0135009_287_1222 302
334 3300035724 Ga0373933_0025712 Ga0373933_0025712_1897_2874 302
335 3300036401 Ga0373937_0002195 Ga0373937_0002195_11232_12209 302
336 3300036401 Ga0373937_0349359 Ga0373937_0349359_52_1029 302
337 3300046471 Ga0495650_0003867 Ga0495650_0003867_7171_8106 302
338 3300046660 Ga0495625_0005078 Ga0495625_0005078_7718_8653 302
339 3300046689 Ga0495613_0031867 Ga0495613_0031867_2207_3184 302
340 3300046694 Ga0495649_0031529 Ga0495649_0031529_951_1880 302
341 3300047320 Ga0495672_0006175 Ga0495672_0006175_2082_3017 302
342 3300048913 Ga0496110_0072544 Ga0496110_0072544_949_1896 302
343 3300005327 Ga0070658_10002730 Ga0070658_1000273016 303
344 3300005327 Ga0070658_10134480 Ga0070658_101344802 303
345 3300005344 Ga0070661_100056322 Ga0070661_1000563222 303
346 3300005355 Ga0070671_100003795 Ga0070671_1000037956 303
347 3300005458 Ga0070681_10145586 Ga0070681_101455862 303
348 3300005535 Ga0070684_100052512 Ga0070684_1000525123 303
349 3300005548 Ga0070665_100011130 Ga0070665_1000111308 303
350 3300005563 Ga0068855_100029777 Ga0068855_1000297774 303
351 3300005577 Ga0068857_100014619 Ga0068857_1000146196 303
352 3300005841 Ga0068863_100016491 Ga0068863_1000164912 303
353 3300009177 Ga0105248_10017142 Ga0105248_100171424 303
354 3300009545 Ga0105237_10110609 Ga0105237_101106092 303
355 3300009551 Ga0105238_10254960 Ga0105238_102549602 303
356 3300010375 Ga0105239_10544937 Ga0105239_105449371 303
357 3300013102 Ga0157371_10309009 Ga0157371_103090092 303
358 3300013104 Ga0157370_10024810 Ga0157370_100248104 303
359 3300013104 Ga0157370_10089759 Ga0157370_100897593 303
360 3300013296 Ga0157374_10002505 Ga0157374_100025055 303
361 3300013306 Ga0163162_10071698 Ga0163162_100716983 303
362 3300013307 Ga0157372_10023245 Ga0157372_100232456 303
363 3300013307 Ga0157372_10158358 Ga0157372_101583582 303
364 3300014325 Ga0163163_10015596 Ga0163163_100155963 303
365 3300014968 Ga0157379_10117392 Ga0157379_101173922 303
366 3300014969 Ga0157376_10017756 Ga0157376_100177563 303
367 3300025904 Ga0207647_10032262 Ga0207647_100322623 303
368 3300025909 Ga0207705_10020382 Ga0207705_100203824 303
369 3300025909 Ga0207705_10044884 Ga0207705_100448843 303
370 3300025919 Ga0207657_10018479 Ga0207657_100184796 303
371 3300025931 Ga0207644_10022857 Ga0207644_100228573 303
372 3300025941 Ga0207711_10038982 Ga0207711_100389824 303
373 3300025949 Ga0207667_10026360 Ga0207667_100263602 303
374 3300025949 Ga0207667_10346804 Ga0207667_103468042 303
375 3300026067 Ga0207678_10034418 Ga0207678_100344183 303
376 3300026088 Ga0207641_10028425 Ga0207641_100284254 303
377 3300026095 Ga0207676_10012392 Ga0207676_100123922 303
378 3300026116 Ga0207674_10018340 Ga0207674_100183402 303
379 3300026121 Ga0207683_10046762 Ga0207683_100467624 303
380 3300033180 Ga0307510_10016280 Ga0307510_100162807 303
381 3300042005 Ga0439448_0004925 Ga0439448_0004925_1848_2774 303
382 3300046455 Ga0495603_0039776 Ga0495603_0039776_514_1452 303
383 3300046459 Ga0495629_0002846 Ga0495629_0002846_12032_12970 303
384 3300046459 Ga0495629_0021663 Ga0495629_0021663_2127_3065 303
385 3300046462 Ga0495651_0017085 Ga0495651_0017085_977_1915 303
386 3300046463 Ga0495653_0118243 Ga0495653_0118243_198_1136 303
387 3300046471 Ga0495650_0000037 Ga0495650_0000037_158126_159064 303
388 3300046472 Ga0495580_0016489 Ga0495580_0016489_783_1721 303
389 3300046473 Ga0495582_0003426 Ga0495582_0003426_6801_7739 303
390 3300046473 Ga0495582_0195162 Ga0495582_0195162_37_975 303
391 3300046475 Ga0495639_0003040 Ga0495639_0003040_1636_2574 303
392 3300046476 Ga0495662_0019719 Ga0495662_0019719_266_1204 303
393 3300046477 Ga0495664_0016467 Ga0495664_0016467_1536_2474 303
394 3300046477 Ga0495664_0071166 Ga0495664_0071166_906_1994 303
395 3300046492 Ga0495585_0005419 Ga0495585_0005419_421_1359 303
396 3300046499 Ga0495594_0000757 Ga0495594_0000757_7454_8392 303
397 3300046499 Ga0495594_0000857 Ga0495594_0000857_14653_15591 303
398 3300046500 Ga0495596_0024519 Ga0495596_0024519_1360_2298 303
399 3300046511 Ga0495608_0085525 Ga0495608_0085525_436_1374 303
400 3300046518 Ga0495631_0036663 Ga0495631_0036663_1235_2173 303
401 3300046518 Ga0495631_0107708 Ga0495631_0107708_87_1025 303
402 3300046523 Ga0495644_0000004 Ga0495644_0000004_142024_142962 303
403 3300046524 Ga0495648_0052460 Ga0495648_0052460_852_1790 303
404 3300046526 Ga0495666_0096753 Ga0495666_0096753_360_1298 303
405 3300046528 Ga0495642_0009760 Ga0495642_0009760_2238_3176 303
406 3300046529 Ga0495652_0030804 Ga0495652_0030804_948_1886 303
407 3300046531 Ga0495665_0013659 Ga0495665_0013659_3116_4054 303
408 3300046533 Ga0495640_0186559 Ga0495640_0186559_290_1228 303
409 3300046533 Ga0495640_0227203 Ga0495640_0227203_107_1045 303
410 3300046535 Ga0495586_0002255 Ga0495586_0002255_2511_3449 303
411 3300046538 Ga0495609_0007829 Ga0495609_0007829_2714_3652 303
412 3300046558 Ga0495633_0008114 Ga0495633_0008114_878_1816 303
413 3300046559 Ga0495667_0054230 Ga0495667_0054230_1651_2589 303
414 3300046616 Ga0495668_0013828 Ga0495668_0013828_560_1498 303
415 3300046616 Ga0495668_0114949 Ga0495668_0114949_363_1301 303
416 3300046642 Ga0495634_0009647 Ga0495634_0009647_2215_3153 303
417 3300046648 Ga0495611_0036149 Ga0495611_0036149_391_1329 303
418 3300046660 Ga0495625_0004435 Ga0495625_0004435_8115_9053 303
419 3300046660 Ga0495625_0011670 Ga0495625_0011670_5642_6580 303
420 3300046660 Ga0495625_0013991 Ga0495625_0013991_729_1667 303
421 3300046663 Ga0495635_0057928 Ga0495635_0057928_985_1923 303
422 3300046665 Ga0495661_0026663 Ga0495661_0026663_691_1629 303
423 3300046674 Ga0495588_0037486 Ga0495588_0037486_105_1043 303
424 3300046678 Ga0495599_0061508 Ga0495599_0061508_647_1585 303
425 3300046679 Ga0495623_0013814 Ga0495623_0013814_3706_4644 303
426 3300046684 Ga0495669_0028204 Ga0495669_0028204_1414_2352 303
427 3300046689 Ga0495613_0003370 Ga0495613_0003370_94_1032 303
428 3300046689 Ga0495613_0005996 Ga0495613_0005996_5925_6863 303
429 3300046690 Ga0495624_0018645 Ga0495624_0018645_426_1364 303
430 3300046694 Ga0495649_0044136 Ga0495649_0044136_598_1536 303
431 3300046809 Ga0495600_0022161 Ga0495600_0022161_3031_3969 303
432 3300046809 Ga0495600_0232392 Ga0495600_0232392_97_1035 303
433 3300047315 Ga0495581_0041532 Ga0495581_0041532_650_1588 303
434 3300047315 Ga0495581_0050562 Ga0495581_0050562_92_1030 303
435 3300047317 Ga0495604_0041787 Ga0495604_0041787_1263_2306 303
436 3300047317 Ga0495604_0071616 Ga0495604_0071616_660_1598 303
437 3300047321 Ga0495676_0041749 Ga0495676_0041749_2803_3741 303
438 3300047321 Ga0495676_0144561 Ga0495676_0144561_607_1545 303
439 3300047322 Ga0495680_0072889 Ga0495680_0072889_992_1930 303
440 3300047323 Ga0495683_0029751 Ga0495683_0029751_1365_2303 303
441 3300047444 Ga0495675_0015819 Ga0495675_0015819_1593_2531 303
442 3300047471 Ga0495684_0073471 Ga0495684_0073471_937_1875 303
443 3300047471 Ga0495684_0197615 Ga0495684_0197615_120_1058 303
444 3300047472 Ga0495686_0000382 Ga0495686_0000382_63437_64366 303
445 3300047472 Ga0495686_0017994 Ga0495686_0017994_3158_4096 303
446 3300048915 Ga0496112_0036100 Ga0496112_0036100_57_995 303
447 3300048917 Ga0496114_0051110 Ga0496114_0051110_529_1617 303
448 3300048929 Ga0496126_0003782 Ga0496126_0003782_8255_9361 303
449 3300049569 Ga0501032_0180133 Ga0501032_0180133_346_1323 303
450 3300049581 Ga0501047_0034547 Ga0501047_0034547_1139_2116 303
451 3300049589 Ga0501073_0034835 Ga0501073_0034835_282_1259 303
452 3300053093 Ga0500651_0000061 Ga0500651_0000061_69821_70759 303
453 3300053119 Ga0500595_000423 Ga0500595_000423_13929_14867 303
454 3300053119 Ga0500595_012007 Ga0500595_012007_662_1600 303
455 3300055283 Ga0500661_003646 Ga0500661_003646_465_1403 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

64

178

0.99

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

181

361

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6de8-assembly1.cif.gz_A crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni 0.9538 5 299
6v6y-assembly1.cif.gz_A-2 crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) 0.9484 4 300
6ape-assembly1.cif.gz_A crystal structure of bifunctional protein fold from helicobacter pylori 0.9474 5 302
6de8-assembly1.cif.gz_A crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni 0.9438 5 299
4a5o-assembly2.cif.gz_D crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) 0.943 5 297
ID Description Score Start End Superfamily
af_K7KDB4_41_138_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9678 136 231 3.40.50.720
af_P9WG81_104_273_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9634 101 290 3.40.50.10860
af_Q54RI8_148_271_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9603 137 280 3.40.50.720
4a5oB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9601 33 110 3.40.50.10860
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9573 33 111 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A378W428-F1-model_v4 Bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9914 79 205 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-X1JX42-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9897 112 218 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-Q71IF6-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.989 146 232 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-A0A833NLB1-F1-model_v4 deleted 0.988 92 229
AF-A0A2E6S7S0-F1-model_v4 Bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase 0.9861 8 176 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999

Feature Viewer

pLDDT pTM Quality
90.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map