F447644

General Info

Members Datasets Scaffolds Average Seq Length
455 159 442 355

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0000277|Ga0495585_0000277_24071_25264
Length 397
Sequence LAPQALERALTDKAFRPLAAALRGAVECLSFQSQVPPMSEYVLTRVANGTGVITLDRPKALNSLSLDMVRSLTGVLLSWRDDPSVAAVVITSTSEKALCAGGDIRFFHEAGHAAPTGGSALLEDFFTEEYALNHLIHFYPKPYIALMDGVVMGGGMGIAQGGPGCGLRIVTDRTKMAMPEVNIGLFPDVGGSHFLSHAPGRLGDYLGLTGLTIGAADALYVGLADVFVPGAQLPALKALFDTTPGAQLAQAIRDFGAQFTGQVGASELQAQRALVDRHFGAGSVDAVMQSLGGDASAFAQKALAAMRQRSPLMMCVTREMLVRGASLDVADCLRMERSLVRRNFEHGEVLEGVRALVIDKDNAPKWNPPAIEQVTPDMVARFFEPVWPAWAHPLRHL

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541300 Massilia sp. GV016 Isolate Unclassified
9 2738543018 Massilia sp. GV045 Isolate Unclassified
10 2738543030 Massilia sp. GV097 Isolate Unclassified
11 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
12 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
13 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
38 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
39 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
41 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
55 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
56 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
57 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
76 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
79 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
87 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
90 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
95 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
108 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
111 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
112 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
122 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
156 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.07
Nodule 0.44
Rhizoplane 2.42
Rhizosphere 78.68
Stem 0
Stem Tuber 0
Unclassified 4.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001693 3300002739 Bacteria 3780
2 JGI25152J39213_1000641 3300002773 Bacteria 18513
3 JGI25150J39212_1003457 3300002774 Bacteria 3692
4 JGI25159J45721_1002616 3300002987 Bacteria 6736
5 JGI25159J45721_1002963 3300002987 Bacteria 6177
6 JGI25161J50226_1001549 3300003374 Bacteria 6744
7 Ga0055526_1004432 3300003771 Bacteria 8438
8 Ga0055526_1011899 3300003771 Bacteria 3859
9 Ga0055526_1023229 3300003771 Bacteria 2076
10 Ga0055537_1000038 3300003773 Bacteria 92762
11 Ga0055537_1005582 3300003773 Bacteria 3348
12 Ga0055524_1000024 3300003775 Bacteria 217953
13 Ga0055524_1007172 3300003775 Bacteria 4769
14 Ga0055524_1008299 3300003775 Bacteria 4325
15 Ga0055524_1011583 3300003775 Bacteria 3440
16 Ga0055534_1000893 3300003784 Bacteria 13525
17 Ga0055528_1000252 3300003790 Bacteria 45454
18 Ga0055528_1002464 3300003790 Bacteria 9901
19 Ga0055530_10003976 3300003791 Bacteria 7980
20 Ga0055530_10007657 3300003791 Bacteria 4500
21 Ga0055530_10008022 3300003791 Bacteria 4309
22 Ga0058692_1011371 3300003856 Bacteria 2156
23 Ga0055543_1001901 3300004625 Bacteria 7531
24 Ga0055543_1002088 3300004625 Bacteria 6956
25 Ga0065165_1000379 3300005262 Bacteria 72513
26 Ga0065165_1000936 3300005262 Bacteria 37330
27 Ga0065165_1005606 3300005262 Bacteria 6956
28 Ga0070658_10093776 3300005327 Bacteria 2476
29 Ga0070660_100080492 3300005339 Bacteria 2556
30 Ga0070659_100088112 3300005366 Bacteria 2485
31 Ga0068855_100034686 3300005563 Bacteria 6014
32 Ga0099826_10000010 3300006948 Bacteria 314346
33 Ga0105241_10030573 3300009174 Bacteria 4027
34 Ga0157373_10059000 3300013100 Bacteria 2719
35 Ga0157373_10068338 3300013100 Bacteria 2511
36 Ga0157371_10076662 3300013102 Bacteria 2367
37 Ga0157372_10309450 3300013307 Bacteria 1838
38 Ga0182006_1013381 3300015261 Bacteria 3562
39 Ga0209436_101767 3300025208 Bacteria 7092
40 Ga0209436_108396 3300025208 Bacteria 2061
41 Ga0207425_1000021 3300025245 Bacteria 367537
42 Ga0207425_1000610 3300025245 Bacteria 20639
43 Ga0209148_1001902 3300025254 Bacteria 8554
44 Ga0209129_1000020 3300025258 Bacteria 457053
45 Ga0209129_1002800 3300025258 Bacteria 8109
46 Ga0209565_1000123 3300025263 Bacteria 111069
47 Ga0209565_1001251 3300025263 Bacteria 11862
48 Ga0209565_1004009 3300025263 Bacteria 4594
49 Ga0209565_1007178 3300025263 Bacteria 3032
50 Ga0209673_1000040 3300025273 Bacteria 312633
51 Ga0209673_1004967 3300025273 Bacteria 6900
52 Ga0209130_1000589 3300025284 Bacteria 35424
53 Ga0209130_1001191 3300025284 Bacteria 18532
54 Ga0209130_1002435 3300025284 Bacteria 9332
55 Ga0209130_1003248 3300025284 Bacteria 7128
56 Ga0209675_1000117 3300025291 Bacteria 111087
57 Ga0209675_1002849 3300025291 Bacteria 8597
58 Ga0209675_1022099 3300025291 Bacteria 1679
59 Ga0209564_1000063 3300025295 Bacteria 318515
60 Ga0209564_1000121 3300025295 Bacteria 204081
61 Ga0209564_1009604 3300025295 Bacteria 4579
62 Ga0209564_1026837 3300025295 Bacteria 1890
63 Ga0209564_1028809 3300025295 Bacteria 1764
64 Ga0209758_1000077 3300025297 Bacteria 268195
65 Ga0209050_1000050 3300025298 Bacteria 362578
66 Ga0209050_1005628 3300025298 Bacteria 7771
67 Ga0209050_1006410 3300025298 Bacteria 6974
68 Ga0209256_1000054 3300025299 Bacteria 298431
69 Ga0209256_1000288 3300025299 Bacteria 88470
70 Ga0209256_1001035 3300025299 Bacteria 32598
71 Ga0209256_1001215 3300025299 Bacteria 28711
72 Ga0209256_1001444 3300025299 Bacteria 24546
73 Ga0209256_1001903 3300025299 Bacteria 19094
74 Ga0207426_1003614 3300025302 Bacteria 8201
75 Ga0209257_1000075 3300025304 Bacteria 324855
76 Ga0209257_1005792 3300025304 Bacteria 8410
77 Ga0207654_10004037 3300025911 Bacteria 7389
78 Ga0207657_10043844 3300025919 Bacteria 3937
79 Ga0207674_10053744 3300026116 Bacteria 4104
80 Ga0209282_1000009 3300027666 Bacteria 233366
81 Ga0316177_1201609 3300030731 Bacteria 1418
82 Ga0316180_1042733 3300030736 Bacteria 2544
83 Ga0316182_1051692 3300030745 Bacteria 3087
84 Ga0307408_100005252 3300031548 Bacteria 8681
85 Ga0307408_100005442 3300031548 Bacteria 8524
86 Ga0307408_100008917 3300031548 Bacteria 6627
87 Ga0307408_100009798 3300031548 Bacteria 6315
88 Ga0307408_100053182 3300031548 Bacteria 2923
89 Ga0307518_10109853 3300031838 Bacteria 1965
90 Ga0307416_100027729 3300032002 Bacteria 4199
91 Ga0395899_0000386 3300037312 Bacteria 52584
92 Ga0395899_0024756 3300037312 Bacteria 4536
93 Ga0395899_0112862 3300037312 Bacteria 1952
94 Ga0395900_0020957 3300037418 Bacteria 6680
95 Ga0395900_0176101 3300037418 Bacteria 2175
96 Ga0395898_0153961 3300037466 Bacteria 2199
97 Ga0395898_0429993 3300037466 Bacteria 1258
98 Ga0395901_0000187 3300038443 Bacteria 79696
99 Ga0395901_0248089 3300038443 Bacteria 1855
100 Ga0450904_000164 3300042139 Bacteria 14610
101 Ga0466972_0002853 3300044658 Bacteria 8556
102 Ga0466966_0013549 3300044684 Bacteria 5396
103 Ga0466961_0027461 3300044693 Bacteria 3660
104 Ga0466961_0133032 3300044693 Bacteria 1558
105 Ga0466964_0001019 3300044706 Bacteria 9316
106 Ga0466964_0004353 3300044706 Bacteria 5219
107 Ga0466968_0001262 3300044735 Bacteria 9004
108 Ga0466957_0032760 3300044842 Bacteria 3113
109 Ga0466959_0016924 3300045049 Bacteria 5336
110 Ga0466959_0021567 3300045049 Bacteria 4753
111 Ga0466958_0050469 3300045836 Bacteria 2518
112 Ga0466958_0069612 3300045836 Bacteria 2152
113 Ga0466967_0041803 3300045976 Bacteria 3956
114 Ga0495617_000027 3300046452 Bacteria 157385
115 Ga0495617_000520 3300046452 Bacteria 19994
116 Ga0495617_004774 3300046452 Bacteria 4892
117 Ga0495627_000277 3300046453 Bacteria 51556
118 Ga0495627_012341 3300046453 Bacteria 3036
119 Ga0495603_0057102 3300046455 Bacteria 2309
120 Ga0495590_0000053 3300046457 Bacteria 103329
121 Ga0495590_0003691 3300046457 Bacteria 6227
122 Ga0495591_005142 3300046458 Bacteria 6133
123 Ga0495638_0001941 3300046460 Bacteria 17738
124 Ga0495638_0003356 3300046460 Bacteria 12629
125 Ga0495638_0050384 3300046460 Bacteria 2600
126 Ga0495638_0191061 3300046460 Bacteria 1162
127 Ga0495653_0071491 3300046463 Bacteria 2593
128 Ga0495650_0000582 3300046471 Bacteria 51082
129 Ga0495650_0001065 3300046471 Bacteria 30418
130 Ga0495580_0117793 3300046472 Bacteria 1844
131 Ga0495582_0003170 3300046473 Bacteria 9235
132 Ga0495605_0000135 3300046474 Bacteria 95104
133 Ga0495605_0000287 3300046474 Bacteria 55659
134 Ga0495605_0000641 3300046474 Bacteria 26838
135 Ga0495605_0005533 3300046474 Bacteria 7351
136 Ga0495605_0024823 3300046474 Bacteria 3131
137 Ga0495605_0035558 3300046474 Bacteria 2517
138 Ga0495605_0054566 3300046474 Bacteria 1935
139 Ga0495605_0058529 3300046474 Bacteria 1852
140 Ga0495584_0000005 3300046491 Bacteria 306957
141 Ga0495584_0000713 3300046491 Bacteria 21919
142 Ga0495584_0001109 3300046491 Bacteria 16710
143 Ga0495584_0001404 3300046491 Bacteria 14491
144 Ga0495584_0002149 3300046491 Bacteria 11257
145 Ga0495584_0018502 3300046491 Bacteria 3541
146 Ga0495584_0039278 3300046491 Bacteria 2391
147 Ga0495585_0000238 3300046492 Bacteria 57003
148 Ga0495585_0000277 3300046492 Bacteria 51354
149 Ga0495585_0000466 3300046492 Bacteria 38653
150 Ga0495585_0003000 3300046492 Bacteria 11653
151 Ga0495585_0006816 3300046492 Bacteria 7048
152 Ga0495585_0016793 3300046492 Bacteria 4240
153 Ga0495585_0016898 3300046492 Bacteria 4226
154 Ga0495585_0020798 3300046492 Bacteria 3771
155 Ga0495585_0026650 3300046492 Bacteria 3301
156 Ga0495585_0031507 3300046492 Bacteria 3009
157 Ga0495585_0043400 3300046492 Bacteria 2515
158 Ga0495585_0092212 3300046492 Bacteria 1630
159 Ga0495585_0093578 3300046492 Bacteria 1616
160 Ga0495594_0023879 3300046499 Bacteria 3279
161 Ga0495594_0075051 3300046499 Bacteria 1884
162 Ga0495594_0115018 3300046499 Bacteria 1518
163 Ga0495596_0005840 3300046500 Bacteria 5758
164 Ga0495596_0006438 3300046500 Bacteria 5402
165 Ga0495596_0006730 3300046500 Bacteria 5256
166 Ga0495596_0011976 3300046500 Bacteria 3722
167 Ga0495596_0012988 3300046500 Bacteria 3547
168 Ga0495596_0019850 3300046500 Bacteria 2756
169 Ga0495596_0022231 3300046500 Bacteria 2582
170 Ga0495607_0002410 3300046501 Bacteria 15261
171 Ga0495607_0008196 3300046501 Bacteria 7156
172 Ga0495607_0022758 3300046501 Bacteria 3931
173 Ga0495607_0032987 3300046501 Bacteria 3154
174 Ga0495607_0044572 3300046501 Bacteria 2614
175 Ga0495607_0128506 3300046501 Bacteria 1321
176 Ga0495583_0000158 3300046506 Bacteria 113645
177 Ga0495583_0000947 3300046506 Bacteria 33746
178 Ga0495583_0001239 3300046506 Bacteria 27114
179 Ga0495583_0002767 3300046506 Bacteria 14470
180 Ga0495583_0002934 3300046506 Bacteria 13746
181 Ga0495583_0008019 3300046506 Bacteria 6518
182 Ga0495583_0065863 3300046506 Bacteria 1604
183 Ga0495583_0072883 3300046506 Bacteria 1506
184 Ga0495606_0018673 3300046507 Bacteria 5189
185 Ga0495606_0034246 3300046507 Bacteria 3488
186 Ga0495606_0035287 3300046507 Bacteria 3420
187 Ga0495606_0053930 3300046507 Bacteria 2606
188 Ga0495606_0062031 3300046507 Bacteria 2388
189 Ga0495606_0130509 3300046507 Bacteria 1494
190 Ga0495606_0145921 3300046507 Bacteria 1393
191 Ga0495610_0046779 3300046512 Bacteria 2133
192 Ga0495616_0000570 3300046513 Bacteria 27850
193 Ga0495616_0002996 3300046513 Bacteria 10961
194 Ga0495616_0004027 3300046513 Bacteria 9336
195 Ga0495616_0004627 3300046513 Bacteria 8635
196 Ga0495616_0011210 3300046513 Bacteria 5146
197 Ga0495616_0014542 3300046513 Bacteria 4402
198 Ga0495616_0025166 3300046513 Bacteria 3184
199 Ga0495616_0037886 3300046513 Bacteria 2477
200 Ga0495616_0046004 3300046513 Bacteria 2205
201 Ga0495616_0046360 3300046513 Bacteria 2194
202 Ga0495631_0004324 3300046518 Bacteria 7576
203 Ga0495631_0005565 3300046518 Bacteria 6585
204 Ga0495631_0018196 3300046518 Bacteria 3311
205 Ga0495631_0040682 3300046518 Bacteria 2059
206 Ga0495631_0048387 3300046518 Bacteria 1864
207 Ga0495631_0057854 3300046518 Bacteria 1686
208 Ga0495631_0059792 3300046518 Bacteria 1654
209 Ga0495632_0000177 3300046519 Bacteria 65209
210 Ga0495632_0001980 3300046519 Bacteria 16262
211 Ga0495632_0012833 3300046519 Bacteria 4808
212 Ga0495632_0024887 3300046519 Bacteria 3173
213 Ga0495632_0035840 3300046519 Bacteria 2527
214 Ga0495632_0067244 3300046519 Bacteria 1728
215 Ga0495637_0000053 3300046520 Bacteria 99739
216 Ga0495637_0013000 3300046520 Bacteria 3965
217 Ga0495643_0000455 3300046522 Bacteria 52002
218 Ga0495643_0003928 3300046522 Bacteria 10651
219 Ga0495643_0047261 3300046522 Bacteria 2331
220 Ga0495643_0048487 3300046522 Bacteria 2295
221 Ga0495644_0001533 3300046523 Bacteria 9433
222 Ga0495644_0003815 3300046523 Bacteria 5927
223 Ga0495644_0004370 3300046523 Bacteria 5551
224 Ga0495644_0004996 3300046523 Bacteria 5194
225 Ga0495644_0011868 3300046523 Bacteria 3351
226 Ga0495644_0059921 3300046523 Bacteria 1431
227 Ga0495648_0000183 3300046524 Bacteria 72118
228 Ga0495648_0005653 3300046524 Bacteria 10349
229 Ga0495648_0010486 3300046524 Bacteria 7055
230 Ga0495648_0026746 3300046524 Bacteria 3877
231 Ga0495648_0031199 3300046524 Bacteria 3512
232 Ga0495648_0048376 3300046524 Bacteria 2618
233 Ga0495666_0003885 3300046526 Bacteria 7556
234 Ga0495642_0000137 3300046528 Bacteria 42614
235 Ga0495642_0001360 3300046528 Bacteria 10926
236 Ga0495642_0007504 3300046528 Bacteria 4176
237 Ga0495642_0010279 3300046528 Bacteria 3584
238 Ga0495642_0010955 3300046528 Bacteria 3475
239 Ga0495642_0013241 3300046528 Bacteria 3187
240 Ga0495642_0037164 3300046528 Bacteria 1969
241 Ga0495652_0005568 3300046529 Bacteria 11846
242 Ga0495654_0049968 3300046530 Bacteria 2045
243 Ga0495665_0002132 3300046531 Bacteria 10704
244 Ga0495587_0027307 3300046536 Bacteria 3476
245 Ga0495609_0000007 3300046538 Bacteria 398812
246 Ga0495609_0000314 3300046538 Bacteria 43536
247 Ga0495609_0001446 3300046538 Bacteria 15772
248 Ga0495609_0001612 3300046538 Bacteria 14740
249 Ga0495609_0017230 3300046538 Bacteria 3356
250 Ga0495609_0020007 3300046538 Bacteria 3094
251 Ga0495609_0029983 3300046538 Bacteria 2475
252 Ga0495609_0036459 3300046538 Bacteria 2220
253 Ga0495597_0000348 3300046542 Bacteria 41331
254 Ga0495597_0001926 3300046542 Bacteria 14027
255 Ga0495597_0003123 3300046542 Bacteria 9943
256 Ga0495597_0008174 3300046542 Bacteria 5261
257 Ga0495597_0010744 3300046542 Bacteria 4462
258 Ga0495597_0027043 3300046542 Bacteria 2632
259 Ga0495645_0155793 3300046543 Bacteria 1583
260 Ga0495622_0007554 3300046557 Bacteria 5047
261 Ga0495622_0010646 3300046557 Bacteria 4243
262 Ga0495622_0073385 3300046557 Bacteria 1578
263 Ga0495633_0002729 3300046558 Bacteria 12238
264 Ga0495633_0013399 3300046558 Bacteria 4323
265 Ga0495633_0015359 3300046558 Bacteria 3973
266 Ga0495633_0016967 3300046558 Bacteria 3735
267 Ga0495633_0051892 3300046558 Bacteria 1932
268 Ga0495633_0075561 3300046558 Bacteria 1569
269 Ga0495656_0002616 3300046615 Bacteria 6008
270 Ga0495668_0000343 3300046616 Bacteria 61962
271 Ga0495668_0001879 3300046616 Bacteria 18822
272 Ga0495668_0004966 3300046616 Bacteria 9215
273 Ga0495668_0007683 3300046616 Bacteria 6854
274 Ga0495668_0013849 3300046616 Bacteria 4742
275 Ga0495668_0030978 3300046616 Bacteria 3015
276 Ga0495668_0039385 3300046616 Bacteria 2638
277 Ga0495668_0039806 3300046616 Bacteria 2624
278 Ga0495611_0000672 3300046648 Bacteria 19487
279 Ga0495611_0001589 3300046648 Bacteria 11097
280 Ga0495611_0002765 3300046648 Bacteria 7868
281 Ga0495611_0050619 3300046648 Bacteria 1871
282 Ga0495611_0113587 3300046648 Bacteria 1261
283 Ga0495625_0005443 3300046660 Bacteria 11608
284 Ga0495625_0031580 3300046660 Bacteria 3936
285 Ga0495625_0032894 3300046660 Bacteria 3839
286 Ga0495625_0038476 3300046660 Bacteria 3501
287 Ga0495625_0118824 3300046660 Bacteria 1801
288 Ga0495659_0000884 3300046664 Bacteria 10658
289 Ga0495659_0005704 3300046664 Bacteria 3923
290 Ga0495661_0000776 3300046665 Bacteria 30561
291 Ga0495661_0001219 3300046665 Bacteria 22320
292 Ga0495661_0003931 3300046665 Bacteria 10852
293 Ga0495661_0008282 3300046665 Bacteria 7203
294 Ga0495661_0009782 3300046665 Bacteria 6562
295 Ga0495661_0013782 3300046665 Bacteria 5424
296 Ga0495661_0037270 3300046665 Bacteria 3036
297 Ga0495661_0063076 3300046665 Bacteria 2192
298 Ga0495588_0006779 3300046674 Bacteria 5180
299 Ga0495588_0037028 3300046674 Bacteria 2477
300 Ga0495588_0095420 3300046674 Bacteria 1559
301 Ga0495588_0109252 3300046674 Bacteria 1456
302 Ga0495623_0004426 3300046679 Bacteria 9232
303 Ga0495623_0017214 3300046679 Bacteria 4668
304 Ga0495669_0000791 3300046684 Bacteria 13518
305 Ga0495669_0006772 3300046684 Bacteria 4794
306 Ga0495669_0009699 3300046684 Bacteria 4063
307 Ga0495669_0013540 3300046684 Bacteria 3477
308 Ga0495669_0018036 3300046684 Bacteria 3032
309 Ga0495669_0052652 3300046684 Bacteria 1829
310 Ga0495670_0001736 3300046691 Bacteria 10729
311 Ga0495670_0026159 3300046691 Bacteria 2888
312 Ga0495670_0043690 3300046691 Bacteria 2236
313 Ga0495670_0058978 3300046691 Bacteria 1926
314 Ga0495671_0000266 3300046692 Bacteria 44137
315 Ga0495671_0005577 3300046692 Bacteria 7351
316 Ga0495671_0006429 3300046692 Bacteria 6783
317 Ga0495671_0014791 3300046692 Bacteria 4192
318 Ga0495671_0018176 3300046692 Bacteria 3733
319 Ga0495671_0063461 3300046692 Bacteria 1819
320 Ga0495671_0097638 3300046692 Bacteria 1436
321 Ga0495649_0000291 3300046694 Bacteria 44106
322 Ga0495649_0005902 3300046694 Bacteria 7682
323 Ga0495649_0013486 3300046694 Bacteria 4714
324 Ga0495649_0024334 3300046694 Bacteria 3377
325 Ga0495589_0000081 3300046794 Bacteria 88067
326 Ga0495589_0000563 3300046794 Bacteria 25676
327 Ga0495589_0002907 3300046794 Bacteria 9460
328 Ga0495589_0004246 3300046794 Bacteria 7661
329 Ga0495589_0018943 3300046794 Bacteria 3530
330 Ga0495589_0025590 3300046794 Bacteria 2994
331 Ga0495589_0041872 3300046794 Bacteria 2284
332 Ga0495589_0071610 3300046794 Bacteria 1693
333 Ga0495660_0000101 3300046810 Bacteria 91466
334 Ga0495660_0001122 3300046810 Bacteria 19111
335 Ga0495660_0003901 3300046810 Bacteria 9114
336 Ga0495660_0011928 3300046810 Bacteria 5041
337 Ga0495660_0012779 3300046810 Bacteria 4871
338 Ga0495660_0033149 3300046810 Bacteria 2898
339 Ga0495660_0039672 3300046810 Bacteria 2614
340 Ga0495660_0040828 3300046810 Bacteria 2570
341 Ga0495660_0069143 3300046810 Bacteria 1877
342 Ga0495581_0014218 3300047315 Bacteria 4614
343 Ga0495604_0088211 3300047317 Bacteria 2308
344 Ga0495636_0012251 3300047318 Bacteria 3395
345 Ga0495672_0000135 3300047320 Bacteria 110114
346 Ga0495672_0000297 3300047320 Bacteria 68017
347 Ga0495672_0000340 3300047320 Bacteria 59814
348 Ga0495672_0000348 3300047320 Bacteria 59143
349 Ga0495672_0001282 3300047320 Bacteria 25048
350 Ga0495672_0025879 3300047320 Bacteria 3751
351 Ga0495672_0048989 3300047320 Bacteria 2503
352 Ga0495676_0026273 3300047321 Bacteria 5015
353 Ga0495676_0035926 3300047321 Bacteria 4142
354 Ga0495680_0011600 3300047322 Bacteria 7790
355 Ga0495683_0001107 3300047323 Bacteria 18628
356 Ga0495683_0001476 3300047323 Bacteria 15354
357 Ga0495683_0002376 3300047323 Bacteria 11407
358 Ga0495683_0010353 3300047323 Bacteria 4931
359 Ga0495683_0010875 3300047323 Bacteria 4798
360 Ga0495683_0039365 3300047323 Bacteria 2389
361 Ga0495683_0073531 3300047323 Bacteria 1676
362 Ga0495683_0091305 3300047323 Bacteria 1475
363 Ga0495683_0093446 3300047323 Bacteria 1454
364 Ga0495687_000030 3300047443 Bacteria 279992
365 Ga0495687_000120 3300047443 Bacteria 120987
366 Ga0495687_000374 3300047443 Bacteria 55800
367 Ga0495687_000814 3300047443 Bacteria 33460
368 Ga0495687_000938 3300047443 Bacteria 30149
369 Ga0495687_002025 3300047443 Bacteria 17139
370 Ga0495687_014646 3300047443 Bacteria 4023
371 Ga0495687_077357 3300047443 Bacteria 1314
372 Ga0495677_0000045 3300047445 Bacteria 73995
373 Ga0495677_0001774 3300047445 Bacteria 8640
374 Ga0495677_0007829 3300047445 Bacteria 3979
375 Ga0495677_0014132 3300047445 Bacteria 2907
376 Ga0495677_0028047 3300047445 Bacteria 2043
377 Ga0495679_004750 3300047446 Bacteria 6161
378 Ga0495679_008420 3300047446 Bacteria 4193
379 Ga0495685_000125 3300047447 Bacteria 26465
380 Ga0495673_0003046 3300047469 Bacteria 11278
381 Ga0495673_0013400 3300047469 Bacteria 4308
382 Ga0495681_0001259 3300047470 Bacteria 19226
383 Ga0495681_0004464 3300047470 Bacteria 9542
384 Ga0495681_0035239 3300047470 Bacteria 2486
385 Ga0495681_0073101 3300047470 Bacteria 1549
386 Ga0495681_0088441 3300047470 Bacteria 1371
387 Ga0495681_0129651 3300047470 Bacteria 1074
388 Ga0495686_0000793 3300047472 Bacteria 41237
389 Ga0495686_0000802 3300047472 Bacteria 40756
390 Ga0495686_0002181 3300047472 Bacteria 19042
391 Ga0495686_0010020 3300047472 Bacteria 6770
392 Ga0495602_0006123 3300048088 Bacteria 12613
393 Ga0495626_0000105 3300048091 Bacteria 109725
394 Ga0495626_0000347 3300048091 Bacteria 48706
395 Ga0495626_0001251 3300048091 Bacteria 20847
396 Ga0495626_0001781 3300048091 Bacteria 16311
397 Ga0495626_0002285 3300048091 Bacteria 13626
398 Ga0495626_0004184 3300048091 Bacteria 8952
399 Ga0495626_0006236 3300048091 Bacteria 6810
400 Ga0495626_0008043 3300048091 Bacteria 5822
401 Ga0495626_0008092 3300048091 Bacteria 5800
402 Ga0495626_0015723 3300048091 Bacteria 3866
403 Ga0495626_0016839 3300048091 Bacteria 3704
404 Ga0495626_0026544 3300048091 Bacteria 2822
405 Ga0495626_0032588 3300048091 Bacteria 2501
406 Ga0495626_0035537 3300048091 Bacteria 2378
407 Ga0495626_0046603 3300048091 Bacteria 2019
408 Ga0495626_0055804 3300048091 Bacteria 1809
409 Ga0495626_0103605 3300048091 Bacteria 1238
410 Ga0496102_0002668 3300048905 Bacteria 15171
411 Ga0496102_0018788 3300048905 Bacteria 6080
412 Ga0496104_0079965 3300048907 Bacteria 3116
413 Ga0496107_0145223 3300048910 Bacteria 1754
414 Ga0496107_0187732 3300048910 Bacteria 1535
415 Ga0496108_0297034 3300048911 Bacteria 1407
416 Ga0496109_0425717 3300048912 Bacteria 1254
417 Ga0496110_0000462 3300048913 Bacteria 27650
418 Ga0496110_0085648 3300048913 Bacteria 2813
419 Ga0496111_0111261 3300048914 Bacteria 2017
420 Ga0496115_0014353 3300048918 Bacteria 5996
421 Ga0496122_0016581 3300048925 Bacteria 6956
422 Ga0496123_0011288 3300048926 Bacteria 7763
423 Ga0496123_0077799 3300048926 Bacteria 2035
424 Ga0496124_0010663 3300048927 Bacteria 9272
425 Ga0496124_0027073 3300048927 Bacteria 5157
426 Ga0496124_0048276 3300048927 Bacteria 3639
427 Ga0496124_0104422 3300048927 Bacteria 2291
428 Ga0496124_0211692 3300048927 Bacteria 1466
429 Ga0495678_000190 3300049459 Bacteria 71878
430 Ga0495678_004786 3300049459 Bacteria 7704
431 Ga0495678_005984 3300049459 Bacteria 6564
432 Ga0495678_012815 3300049459 Bacteria 3959
433 Ga0495678_018113 3300049459 Bacteria 3174
434 Ga0495678_018557 3300049459 Bacteria 3124
435 Ga0495682_0000937 3300049460 Bacteria 17697
436 Ga0495682_0012511 3300049460 Bacteria 3250
437 Ga0495682_0020760 3300049460 Bacteria 2464
438 Ga0495682_0049928 3300049460 Bacteria 1524
439 Ga0501227_016521 3300049665 Bacteria 1659
440 Ga0501279_000692 3300049775 Bacteria 4416
441 Ga0501035_0007157 3300049822 Bacteria 10438
442 Ga0501044_0066127 3300049823 Bacteria 3687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0000462 Ga0496110_0000462_11055_12182 317
2 3300046471 Ga0495650_0001065 Ga0495650_0001065_28255_29334 318
3 3300046492 Ga0495585_0093578 Ga0495585_0093578_208_1293 318
4 3300046455 Ga0495603_0057102 Ga0495603_0057102_671_1756 319
5 3300046491 Ga0495584_0002149 Ga0495584_0002149_9904_10986 319
6 3300046492 Ga0495585_0026650 Ga0495585_0026650_437_1519 319
7 3300046499 Ga0495594_0023879 Ga0495594_0023879_349_1434 319
8 3300046500 Ga0495596_0019850 Ga0495596_0019850_532_1614 319
9 3300046542 Ga0495597_0003123 Ga0495597_0003123_1905_2993 319
10 3300046557 Ga0495622_0007554 Ga0495622_0007554_1881_2966 319
11 3300046558 Ga0495633_0013399 Ga0495633_0013399_2209_3291 319
12 3300046616 Ga0495668_0039806 Ga0495668_0039806_1164_2252 319
13 3300046674 Ga0495588_0109252 Ga0495588_0109252_219_1304 319
14 3300047321 Ga0495676_0026273 Ga0495676_0026273_736_1821 319
15 3300047323 Ga0495683_0002376 Ga0495683_0002376_9905_10987 319
16 3300049460 Ga0495682_0049928 Ga0495682_0049928_58_1140 319
17 3300046506 Ga0495583_0002934 Ga0495583_0002934_7212_8297 320
18 3300046538 Ga0495609_0017230 Ga0495609_0017230_1569_2654 320
19 3300046542 Ga0495597_0001926 Ga0495597_0001926_12301_13386 321
20 3300046616 Ga0495668_0007683 Ga0495668_0007683_670_1752 321
21 3300046794 Ga0495589_0004246 Ga0495589_0004246_383_1468 321
22 3300048927 Ga0496124_0211692 Ga0496124_0211692_172_1257 321
23 3300046522 Ga0495643_0047261 Ga0495643_0047261_919_2004 322
24 3300046524 Ga0495648_0005653 Ga0495648_0005653_2254_3369 322
25 3300049459 Ga0495678_000190 Ga0495678_000190_27082_28176 322
26 3300046557 Ga0495622_0073385 Ga0495622_0073385_13_1005 323
27 3300046660 Ga0495625_0032894 Ga0495625_0032894_346_1440 323
28 3300044658 Ga0466972_0002853 Ga0466972_0002853_7281_8363 324
29 3300044706 Ga0466964_0001019 Ga0466964_0001019_14_1096 324
30 3300044735 Ga0466968_0001262 Ga0466968_0001262_3000_4082 324
31 3300044842 Ga0466957_0032760 Ga0466957_0032760_1241_2323 324
32 3300048907 Ga0496104_0079965 Ga0496104_0079965_742_1836 324
33 3300048911 Ga0496108_0297034 Ga0496108_0297034_232_1326 324
34 3300048913 Ga0496110_0085648 Ga0496110_0085648_1287_2372 324
35 3300048914 Ga0496111_0111261 Ga0496111_0111261_909_1994 324
36 3300046810 Ga0495660_0012779 Ga0495660_0012779_3125_4240 325
37 3300046452 Ga0495617_004774 Ga0495617_004774_1133_2215 326
38 3300046499 Ga0495594_0115018 Ga0495594_0115018_214_1299 326
39 3300046538 Ga0495609_0029983 Ga0495609_0029983_104_1186 326
40 3300046691 Ga0495670_0058978 Ga0495670_0058978_215_1300 326
41 3300037466 Ga0395898_0429993 Ga0395898_0429993_115_1203 327
42 3300046528 Ga0495642_0001360 Ga0495642_0001360_7200_8282 327
43 3300046616 Ga0495668_0001879 Ga0495668_0001879_14441_15526 327
44 3300047443 Ga0495687_000374 Ga0495687_000374_31793_32878 327
45 3300048091 Ga0495626_0046603 Ga0495626_0046603_197_1327 327
46 3300047321 Ga0495676_0035926 Ga0495676_0035926_1339_2421 329
47 3300049823 Ga0501044_0066127 Ga0501044_0066127_1972_3078 329
48 3300038443 Ga0395901_0248089 Ga0395901_0248089_27_1028 330
49 3300046538 Ga0495609_0036459 Ga0495609_0036459_1191_2183 330
50 3300046474 Ga0495605_0000287 Ga0495605_0000287_21582_22658 331
51 3300046501 Ga0495607_0032987 Ga0495607_0032987_2125_3120 331
52 3300046501 Ga0495607_0044572 Ga0495607_0044572_500_1576 331
53 3300046506 Ga0495583_0000158 Ga0495583_0000158_21968_23050 331
54 3300046518 Ga0495631_0048387 Ga0495631_0048387_18_1013 331
55 3300046665 Ga0495661_0008282 Ga0495661_0008282_1039_2115 331
56 3300046694 Ga0495649_0005902 Ga0495649_0005902_4554_5630 331
57 3300046794 Ga0495589_0000563 Ga0495589_0000563_4788_5864 331
58 3300046810 Ga0495660_0000101 Ga0495660_0000101_52034_53110 331
59 3300047320 Ga0495672_0000348 Ga0495672_0000348_18447_19523 331
60 3300047323 Ga0495683_0010875 Ga0495683_0010875_2067_3143 331
61 3300047443 Ga0495687_000938 Ga0495687_000938_6392_7468 331
62 3300047470 Ga0495681_0129651 Ga0495681_0129651_14_1009 331
63 3300048091 Ga0495626_0000347 Ga0495626_0000347_25703_26779 331
64 3300048091 Ga0495626_0001251 Ga0495626_0001251_7382_8482 332
65 3300048910 Ga0496107_0187732 Ga0496107_0187732_249_1331 333
66 3300038443 Ga0395901_0000187 Ga0395901_0000187_77310_78401 334
67 3300005327 Ga0070658_10093776 Ga0070658_100937763 335
68 3300005366 Ga0070659_100088112 Ga0070659_1000881123 335
69 3300047472 Ga0495686_0000802 Ga0495686_0000802_4743_5825 335
70 3300049460 Ga0495682_0020760 Ga0495682_0020760_420_1502 335
71 3300046528 Ga0495642_0007504 Ga0495642_0007504_405_1487 336
72 3300046543 Ga0495645_0155793 Ga0495645_0155793_148_1230 337
73 3300046665 Ga0495661_0001219 Ga0495661_0001219_11838_12923 337
74 3300049822 Ga0501035_0007157 Ga0501035_0007157_9048_10139 337
75 3300048927 Ga0496124_0027073 Ga0496124_0027073_2630_3724 338
76 3300046474 Ga0495605_0024823 Ga0495605_0024823_789_1871 340
77 3300046500 Ga0495596_0011976 Ga0495596_0011976_2132_3214 340
78 3300046518 Ga0495631_0005565 Ga0495631_0005565_3289_4371 340
79 3300046523 Ga0495644_0003815 Ga0495644_0003815_4644_5726 340
80 3300047323 Ga0495683_0073531 Ga0495683_0073531_386_1468 340
81 3300047469 Ga0495673_0013400 Ga0495673_0013400_1542_2624 340
82 3300048091 Ga0495626_0035537 Ga0495626_0035537_788_1870 340
83 3300046506 Ga0495583_0001239 Ga0495583_0001239_17929_19014 341
84 3300046507 Ga0495606_0053930 Ga0495606_0053930_1203_2285 341
85 3300046491 Ga0495584_0039278 Ga0495584_0039278_1281_2366 344
86 3300046524 Ga0495648_0031199 Ga0495648_0031199_2155_3240 344
87 3300047323 Ga0495683_0091305 Ga0495683_0091305_226_1338 344
88 3300048091 Ga0495626_0026544 Ga0495626_0026544_892_2007 345
89 3300042139 Ga0450904_000164 Ga0450904_000164_5378_6463 346
90 3300046492 Ga0495585_0016898 Ga0495585_0016898_2500_3585 346
91 3300046506 Ga0495583_0065863 Ga0495583_0065863_112_1197 346
92 3300025254 Ga0209148_1001902 Ga0209148_10019026 347
93 3300044684 Ga0466966_0013549 Ga0466966_0013549_3464_4540 348
94 3300003856 Ga0058692_1011371 Ga0058692_10113712 349
95 3300013100 Ga0157373_10059000 Ga0157373_100590002 349
96 3300013102 Ga0157371_10076662 Ga0157371_100766623 349
97 3300015261 Ga0182006_1013381 Ga0182006_10133813 349
98 3300047443 Ga0495687_000030 Ga0495687_000030_131717_132802 349
99 iso_pu_bacteria 3007252601 3007253718 350
100 3300046500 Ga0495596_0006730 Ga0495596_0006730_1035_2120 352
101 3300046518 Ga0495631_0018196 Ga0495631_0018196_2043_3128 352
102 3300046684 Ga0495669_0009699 Ga0495669_0009699_1755_2840 352
103 3300048091 Ga0495626_0006236 Ga0495626_0006236_5227_6312 352
104 3300048091 Ga0495626_0008092 Ga0495626_0008092_14_1072 352
105 3300046512 Ga0495610_0046779 Ga0495610_0046779_951_2033 353
106 3300046513 Ga0495616_0004627 Ga0495616_0004627_976_2058 353
107 3300046522 Ga0495643_0000455 Ga0495643_0000455_25564_26679 353
108 3300046648 Ga0495611_0050619 Ga0495611_0050619_410_1492 353
109 3300046691 Ga0495670_0001736 Ga0495670_0001736_1436_2518 353
110 iso_pu_bacteria 2643221556 2643799515 353
111 iso_pu_bacteria 2643221684 2644471605 353
112 iso_pu_bacteria 8047673197 8047675990 353
113 3300046460 Ga0495638_0191061 Ga0495638_0191061_58_1152 354
114 3300046513 Ga0495616_0037886 Ga0495616_0037886_534_1619 354
115 3300046518 Ga0495631_0040682 Ga0495631_0040682_307_1392 354
116 3300049665 Ga0501227_016521 Ga0501227_016521_132_1217 354
117 iso_pu_bacteria 2643221645 2644254738 354
118 iso_pu_bacteria 2738541280 2738738047 354
119 iso_pu_bacteria 2738541300 2738843163 354
120 iso_pu_bacteria 2738543018 2739273914 354
121 iso_pu_bacteria 2738543030 2739342958 354
122 3300031838 Ga0307518_10109853 Ga0307518_101098531 355
123 3300037312 Ga0395899_0000386 Ga0395899_0000386_34152_35222 356
124 3300046520 Ga0495637_0013000 Ga0495637_0013000_1657_2742 356
125 3300046665 Ga0495661_0063076 Ga0495661_0063076_248_1333 356
126 3300048091 Ga0495626_0002285 Ga0495626_0002285_678_1763 356
127 3300048927 Ga0496124_0010663 Ga0496124_0010663_3284_4399 356
128 iso_pu_bacteria 2643221664 2644360292 356
129 3300013100 Ga0157373_10068338 Ga0157373_100683383 357
130 3300013307 Ga0157372_10309450 Ga0157372_103094502 357
131 3300044693 Ga0466961_0133032 Ga0466961_0133032_76_1152 357
132 3300045049 Ga0466959_0021567 Ga0466959_0021567_3281_4357 357
133 3300045836 Ga0466958_0069612 Ga0466958_0069612_145_1221 357
134 3300046513 Ga0495616_0014542 Ga0495616_0014542_2046_3122 357
135 3300046810 Ga0495660_0040828 Ga0495660_0040828_641_1717 357
136 3300048925 Ga0496122_0016581 Ga0496122_0016581_710_1786 357
137 3300048926 Ga0496123_0011288 Ga0496123_0011288_5897_6973 357
138 iso_pu_bacteria 2643221554 2643792001 357
139 iso_pu_bacteria 2643221638 2644216519 357
140 iso_pu_bacteria 2808606418 2809145778 357
141 3300005339 Ga0070660_100080492 Ga0070660_1000804923 358
142 3300025919 Ga0207657_10043844 Ga0207657_100438445 358
143 3300037312 Ga0395899_0024756 Ga0395899_0024756_2799_3884 358
144 3300037418 Ga0395900_0176101 Ga0395900_0176101_748_1833 358
145 3300044693 Ga0466961_0027461 Ga0466961_0027461_2513_3607 358
146 3300045049 Ga0466959_0016924 Ga0466959_0016924_1858_2952 358
147 3300046507 Ga0495606_0035287 Ga0495606_0035287_622_1698 358
148 3300046530 Ga0495654_0049968 Ga0495654_0049968_737_1813 358
149 3300046542 Ga0495597_0010744 Ga0495597_0010744_2457_3533 358
150 3300046542 Ga0495597_0027043 Ga0495597_0027043_1435_2511 358
151 3300046660 Ga0495625_0038476 Ga0495625_0038476_1688_2764 358
152 3300046664 Ga0495659_0000884 Ga0495659_0000884_738_1814 358
153 3300046692 Ga0495671_0000266 Ga0495671_0000266_34305_35381 358
154 3300046810 Ga0495660_0039672 Ga0495660_0039672_679_1755 358
155 3300047320 Ga0495672_0000297 Ga0495672_0000297_66738_67814 358
156 3300047320 Ga0495672_0025879 Ga0495672_0025879_2099_3175 358
157 3300048905 Ga0496102_0018788 Ga0496102_0018788_2741_3835 358
158 3300048910 Ga0496107_0145223 Ga0496107_0145223_345_1439 358
159 3300048912 Ga0496109_0425717 Ga0496109_0425717_10_1104 358
160 3300048926 Ga0496123_0077799 Ga0496123_0077799_472_1566 358
161 3300045836 Ga0466958_0050469 Ga0466958_0050469_1119_2201 359
162 3300046460 Ga0495638_0001941 Ga0495638_0001941_11538_12620 359
163 3300046474 Ga0495605_0000641 Ga0495605_0000641_10566_11648 359
164 3300046492 Ga0495585_0016793 Ga0495585_0016793_2964_4046 359
165 3300046506 Ga0495583_0000947 Ga0495583_0000947_20004_21086 359
166 3300046507 Ga0495606_0130509 Ga0495606_0130509_404_1483 359
167 3300046513 Ga0495616_0002996 Ga0495616_0002996_3499_4581 359
168 3300046524 Ga0495648_0010486 Ga0495648_0010486_2880_3962 359
169 3300046538 Ga0495609_0001612 Ga0495609_0001612_11957_13039 359
170 3300046615 Ga0495656_0002616 Ga0495656_0002616_1173_2255 359
171 3300046660 Ga0495625_0031580 Ga0495625_0031580_117_1199 359
172 3300046664 Ga0495659_0005704 Ga0495659_0005704_1602_2684 359
173 3300046794 Ga0495589_0041872 Ga0495589_0041872_40_1122 359
174 3300046810 Ga0495660_0001122 Ga0495660_0001122_6954_8033 359
175 3300047318 Ga0495636_0012251 Ga0495636_0012251_1311_2393 359
176 3300047323 Ga0495683_0001476 Ga0495683_0001476_12921_14003 359
177 3300047443 Ga0495687_000814 Ga0495687_000814_19718_20800 359
178 3300047445 Ga0495677_0014132 Ga0495677_0014132_467_1549 359
179 3300047447 Ga0495685_000125 Ga0495685_000125_5423_6505 359
180 3300047469 Ga0495673_0003046 Ga0495673_0003046_8640_9722 359
181 3300047472 Ga0495686_0010020 Ga0495686_0010020_4455_5534 359
182 3300049459 Ga0495678_012815 Ga0495678_012815_2256_3338 359
183 3300049460 Ga0495682_0012511 Ga0495682_0012511_1702_2784 359
184 3300005262 Ga0065165_1000379 Ga0065165_100037934 360
185 3300005563 Ga0068855_100034686 Ga0068855_1000346863 360
186 3300009174 Ga0105241_10030573 Ga0105241_100305732 360
187 3300025911 Ga0207654_10004037 Ga0207654_100040372 360
188 3300026116 Ga0207674_10053744 Ga0207674_100537444 360
189 3300030731 Ga0316177_1201609 Ga0316177_12016092 360
190 3300030736 Ga0316180_1042733 Ga0316180_10427333 360
191 3300030745 Ga0316182_1051692 Ga0316182_10516922 360
192 3300037312 Ga0395899_0112862 Ga0395899_0112862_622_1713 360
193 3300037418 Ga0395900_0020957 Ga0395900_0020957_4867_5958 360
194 3300037466 Ga0395898_0153961 Ga0395898_0153961_36_1127 360
195 3300044706 Ga0466964_0004353 Ga0466964_0004353_665_1756 360
196 3300045976 Ga0466967_0041803 Ga0466967_0041803_725_1816 360
197 3300046452 Ga0495617_000520 Ga0495617_000520_9295_10377 360
198 3300046453 Ga0495627_012341 Ga0495627_012341_62_1174 360
199 3300046457 Ga0495590_0003691 Ga0495590_0003691_334_1449 360
200 3300046460 Ga0495638_0003356 Ga0495638_0003356_3724_4833 360
201 3300046463 Ga0495653_0071491 Ga0495653_0071491_400_1482 360
202 3300046472 Ga0495580_0117793 Ga0495580_0117793_350_1432 360
203 3300046473 Ga0495582_0003170 Ga0495582_0003170_1751_2833 360
204 3300046474 Ga0495605_0005533 Ga0495605_0005533_1200_2288 360
205 3300046491 Ga0495584_0000005 Ga0495584_0000005_72933_74015 360
206 3300046491 Ga0495584_0000713 Ga0495584_0000713_3902_4984 360
207 3300046491 Ga0495584_0001109 Ga0495584_0001109_11738_12820 360
208 3300046491 Ga0495584_0018502 Ga0495584_0018502_510_1592 360
209 3300046492 Ga0495585_0000238 Ga0495585_0000238_25148_26230 360
210 3300046492 Ga0495585_0000277 Ga0495585_0000277_24071_25264 360
211 3300046492 Ga0495585_0003000 Ga0495585_0003000_9762_10844 360
212 3300046492 Ga0495585_0006816 Ga0495585_0006816_4364_5446 360
213 3300046492 Ga0495585_0020798 Ga0495585_0020798_555_1667 360
214 3300046499 Ga0495594_0075051 Ga0495594_0075051_346_1428 360
215 3300046500 Ga0495596_0006438 Ga0495596_0006438_3450_4532 360
216 3300046501 Ga0495607_0002410 Ga0495607_0002410_12475_13575 360
217 3300046501 Ga0495607_0128506 Ga0495607_0128506_129_1211 360
218 3300046506 Ga0495583_0002767 Ga0495583_0002767_915_1997 360
219 3300046507 Ga0495606_0018673 Ga0495606_0018673_223_1305 360
220 3300046507 Ga0495606_0062031 Ga0495606_0062031_453_1535 360
221 3300046507 Ga0495606_0145921 Ga0495606_0145921_255_1367 360
222 3300046513 Ga0495616_0004027 Ga0495616_0004027_406_1488 360
223 3300046513 Ga0495616_0011210 Ga0495616_0011210_29_1129 360
224 3300046518 Ga0495631_0004324 Ga0495631_0004324_65_1147 360
225 3300046518 Ga0495631_0057854 Ga0495631_0057854_303_1385 360
226 3300046519 Ga0495632_0001980 Ga0495632_0001980_2609_3691 360
227 3300046519 Ga0495632_0012833 Ga0495632_0012833_519_1601 360
228 3300046519 Ga0495632_0067244 Ga0495632_0067244_70_1164 360
229 3300046522 Ga0495643_0003928 Ga0495643_0003928_7532_8626 360
230 3300046523 Ga0495644_0004370 Ga0495644_0004370_1691_2773 360
231 3300046524 Ga0495648_0000183 Ga0495648_0000183_31244_32326 360
232 3300046524 Ga0495648_0048376 Ga0495648_0048376_1280_2362 360
233 3300046526 Ga0495666_0003885 Ga0495666_0003885_2124_3206 360
234 3300046528 Ga0495642_0010955 Ga0495642_0010955_70_1152 360
235 3300046529 Ga0495652_0005568 Ga0495652_0005568_71_1153 360
236 3300046531 Ga0495665_0002132 Ga0495665_0002132_519_1601 360
237 3300046536 Ga0495587_0027307 Ga0495587_0027307_493_1575 360
238 3300046538 Ga0495609_0000007 Ga0495609_0000007_307949_309049 360
239 3300046538 Ga0495609_0020007 Ga0495609_0020007_1501_2583 360
240 3300046542 Ga0495597_0008174 Ga0495597_0008174_756_1868 360
241 3300046557 Ga0495622_0010646 Ga0495622_0010646_2643_3725 360
242 3300046558 Ga0495633_0015359 Ga0495633_0015359_40_1122 360
243 3300046558 Ga0495633_0016967 Ga0495633_0016967_1446_2558 360
244 3300046558 Ga0495633_0075561 Ga0495633_0075561_446_1528 360
245 3300046616 Ga0495668_0004966 Ga0495668_0004966_4125_5237 360
246 3300046616 Ga0495668_0030978 Ga0495668_0030978_20_1132 360
247 3300046648 Ga0495611_0002765 Ga0495611_0002765_578_1660 360
248 3300046648 Ga0495611_0113587 Ga0495611_0113587_82_1194 360
249 3300046660 Ga0495625_0118824 Ga0495625_0118824_550_1632 360
250 3300046665 Ga0495661_0000776 Ga0495661_0000776_9801_10901 360
251 3300046665 Ga0495661_0003931 Ga0495661_0003931_4960_6042 360
252 3300046665 Ga0495661_0009782 Ga0495661_0009782_19_1131 360
253 3300046665 Ga0495661_0037270 Ga0495661_0037270_636_1718 360
254 3300046674 Ga0495588_0006779 Ga0495588_0006779_2906_4018 360
255 3300046674 Ga0495588_0037028 Ga0495588_0037028_1292_2374 360
256 3300046679 Ga0495623_0004426 Ga0495623_0004426_6252_7367 360
257 3300046679 Ga0495623_0017214 Ga0495623_0017214_2489_3571 360
258 3300046684 Ga0495669_0018036 Ga0495669_0018036_664_1746 360
259 3300046691 Ga0495670_0043690 Ga0495670_0043690_111_1223 360
260 3300046692 Ga0495671_0018176 Ga0495671_0018176_1065_2177 360
261 3300046692 Ga0495671_0063461 Ga0495671_0063461_39_1151 360
262 3300046692 Ga0495671_0097638 Ga0495671_0097638_194_1306 360
263 3300046694 Ga0495649_0013486 Ga0495649_0013486_1638_2732 360
264 3300046794 Ga0495589_0000081 Ga0495589_0000081_4199_5299 360
265 3300046794 Ga0495589_0018943 Ga0495589_0018943_1981_3093 360
266 3300046810 Ga0495660_0003901 Ga0495660_0003901_4631_5713 360
267 3300047315 Ga0495581_0014218 Ga0495581_0014218_2830_3912 360
268 3300047317 Ga0495604_0088211 Ga0495604_0088211_644_1756 360
269 3300047320 Ga0495672_0048989 Ga0495672_0048989_1084_2166 360
270 3300047322 Ga0495680_0011600 Ga0495680_0011600_4427_5518 360
271 3300047323 Ga0495683_0001107 Ga0495683_0001107_15995_17077 360
272 3300047323 Ga0495683_0039365 Ga0495683_0039365_1047_2129 360
273 3300047323 Ga0495683_0093446 Ga0495683_0093446_165_1247 360
274 3300047443 Ga0495687_000120 Ga0495687_000120_64122_65222 360
275 3300047443 Ga0495687_077357 Ga0495687_077357_125_1255 360
276 3300047445 Ga0495677_0000045 Ga0495677_0000045_60421_61521 360
277 3300047445 Ga0495677_0007829 Ga0495677_0007829_1008_2123 360
278 3300047445 Ga0495677_0028047 Ga0495677_0028047_853_1962 360
279 3300047470 Ga0495681_0035239 Ga0495681_0035239_864_1976 360
280 3300047470 Ga0495681_0088441 Ga0495681_0088441_237_1349 360
281 3300047472 Ga0495686_0000793 Ga0495686_0000793_12126_13208 360
282 3300048088 Ga0495602_0006123 Ga0495602_0006123_2000_3115 360
283 3300048091 Ga0495626_0000105 Ga0495626_0000105_84917_86014 360
284 3300048091 Ga0495626_0004184 Ga0495626_0004184_4762_5844 360
285 3300048091 Ga0495626_0008043 Ga0495626_0008043_513_1601 360
286 3300048091 Ga0495626_0032588 Ga0495626_0032588_900_1982 360
287 3300048091 Ga0495626_0055804 Ga0495626_0055804_68_1150 360
288 3300048918 Ga0496115_0014353 Ga0496115_0014353_3468_4580 360
289 3300048927 Ga0496124_0048276 Ga0496124_0048276_548_1630 360
290 3300049459 Ga0495678_018113 Ga0495678_018113_912_1994 360
291 3300002739 JGI25158J39367_1001693 JGI25158J39367_10016933 361
292 3300002773 JGI25152J39213_1000641 JGI25152J39213_100064122 361
293 3300002774 JGI25150J39212_1003457 JGI25150J39212_10034572 361
294 3300002987 JGI25159J45721_1002616 JGI25159J45721_100261612 361
295 3300002987 JGI25159J45721_1002963 JGI25159J45721_10029636 361
296 3300003374 JGI25161J50226_1001549 JGI25161J50226_10015492 361
297 3300003771 Ga0055526_1004432 Ga0055526_10044328 361
298 3300003771 Ga0055526_1011899 Ga0055526_10118994 361
299 3300003771 Ga0055526_1023229 Ga0055526_10232291 361
300 3300003773 Ga0055537_1000038 Ga0055537_100003872 361
301 3300003773 Ga0055537_1005582 Ga0055537_10055823 361
302 3300003775 Ga0055524_1000024 Ga0055524_100002472 361
303 3300003775 Ga0055524_1007172 Ga0055524_10071722 361
304 3300003775 Ga0055524_1008299 Ga0055524_10082993 361
305 3300003775 Ga0055524_1011583 Ga0055524_10115831 361
306 3300003784 Ga0055534_1000893 Ga0055534_100089313 361
307 3300003790 Ga0055528_1000252 Ga0055528_100025223 361
308 3300003790 Ga0055528_1002464 Ga0055528_10024645 361
309 3300003791 Ga0055530_10003976 Ga0055530_100039762 361
310 3300003791 Ga0055530_10007657 Ga0055530_100076572 361
311 3300003791 Ga0055530_10008022 Ga0055530_100080227 361
312 3300004625 Ga0055543_1001901 Ga0055543_10019017 361
313 3300004625 Ga0055543_1002088 Ga0055543_100208812 361
314 3300005262 Ga0065165_1000936 Ga0065165_100093615 361
315 3300005262 Ga0065165_1005606 Ga0065165_10056062 361
316 3300006948 Ga0099826_10000010 Ga0099826_10000010189 361
317 3300025208 Ga0209436_101767 Ga0209436_1017672 361
318 3300025208 Ga0209436_108396 Ga0209436_1083962 361
319 3300025245 Ga0207425_1000021 Ga0207425_100002199 361
320 3300025245 Ga0207425_1000610 Ga0207425_100061024 361
321 3300025258 Ga0209129_1000020 Ga0209129_1000020170 361
322 3300025258 Ga0209129_1002800 Ga0209129_100280012 361
323 3300025263 Ga0209565_1000123 Ga0209565_100012331 361
324 3300025263 Ga0209565_1001251 Ga0209565_100125116 361
325 3300025263 Ga0209565_1004009 Ga0209565_10040096 361
326 3300025263 Ga0209565_1007178 Ga0209565_10071784 361
327 3300025273 Ga0209673_1000040 Ga0209673_1000040219 361
328 3300025273 Ga0209673_1004967 Ga0209673_10049673 361
329 3300025284 Ga0209130_1000589 Ga0209130_100058915 361
330 3300025284 Ga0209130_1001191 Ga0209130_10011913 361
331 3300025284 Ga0209130_1002435 Ga0209130_10024352 361
332 3300025284 Ga0209130_1003248 Ga0209130_10032488 361
333 3300025291 Ga0209675_1000117 Ga0209675_100011774 361
334 3300025291 Ga0209675_1002849 Ga0209675_10028499 361
335 3300025291 Ga0209675_1022099 Ga0209675_10220991 361
336 3300025295 Ga0209564_1000063 Ga0209564_1000063274 361
337 3300025295 Ga0209564_1000121 Ga0209564_1000121114 361
338 3300025295 Ga0209564_1009604 Ga0209564_10096048 361
339 3300025295 Ga0209564_1026837 Ga0209564_10268373 361
340 3300025295 Ga0209564_1028809 Ga0209564_10288092 361
341 3300025297 Ga0209758_1000077 Ga0209758_1000077165 361
342 3300025298 Ga0209050_1000050 Ga0209050_1000050105 361
343 3300025298 Ga0209050_1005628 Ga0209050_100562812 361
344 3300025298 Ga0209050_1006410 Ga0209050_10064102 361
345 3300025299 Ga0209256_1000054 Ga0209256_1000054180 361
346 3300025299 Ga0209256_1000288 Ga0209256_100028855 361
347 3300025299 Ga0209256_1001035 Ga0209256_100103528 361
348 3300025299 Ga0209256_1001215 Ga0209256_100121524 361
349 3300025299 Ga0209256_1001444 Ga0209256_100144429 361
350 3300025299 Ga0209256_1001903 Ga0209256_100190323 361
351 3300025302 Ga0207426_1003614 Ga0207426_10036149 361
352 3300025304 Ga0209257_1000075 Ga0209257_1000075105 361
353 3300025304 Ga0209257_1005792 Ga0209257_10057922 361
354 3300027666 Ga0209282_1000009 Ga0209282_1000009187 361
355 3300031548 Ga0307408_100005252 Ga0307408_1000052522 361
356 3300031548 Ga0307408_100005442 Ga0307408_1000054423 361
357 3300031548 Ga0307408_100008917 Ga0307408_1000089171 361
358 3300031548 Ga0307408_100009798 Ga0307408_1000097987 361
359 3300031548 Ga0307408_100053182 Ga0307408_1000531822 361
360 3300032002 Ga0307416_100027729 Ga0307416_1000277292 361
361 3300046452 Ga0495617_000027 Ga0495617_000027_126084_127169 361
362 3300046453 Ga0495627_000277 Ga0495627_000277_18935_20020 361
363 3300046457 Ga0495590_0000053 Ga0495590_0000053_89129_90214 361
364 3300046458 Ga0495591_005142 Ga0495591_005142_1342_2427 361
365 3300046460 Ga0495638_0050384 Ga0495638_0050384_834_1919 361
366 3300046471 Ga0495650_0000582 Ga0495650_0000582_16467_17582 361
367 3300046474 Ga0495605_0000135 Ga0495605_0000135_30145_31230 361
368 3300046474 Ga0495605_0035558 Ga0495605_0035558_294_1379 361
369 3300046474 Ga0495605_0054566 Ga0495605_0054566_347_1432 361
370 3300046474 Ga0495605_0058529 Ga0495605_0058529_398_1483 361
371 3300046491 Ga0495584_0001404 Ga0495584_0001404_12827_13912 361
372 3300046492 Ga0495585_0000466 Ga0495585_0000466_16715_17800 361
373 3300046492 Ga0495585_0031507 Ga0495585_0031507_516_1601 361
374 3300046492 Ga0495585_0043400 Ga0495585_0043400_382_1500 361
375 3300046492 Ga0495585_0092212 Ga0495585_0092212_33_1127 361
376 3300046500 Ga0495596_0005840 Ga0495596_0005840_295_1380 361
377 3300046500 Ga0495596_0012988 Ga0495596_0012988_357_1442 361
378 3300046500 Ga0495596_0022231 Ga0495596_0022231_259_1344 361
379 3300046501 Ga0495607_0008196 Ga0495607_0008196_4654_5739 361
380 3300046501 Ga0495607_0022758 Ga0495607_0022758_1227_2312 361
381 3300046506 Ga0495583_0008019 Ga0495583_0008019_630_1715 361
382 3300046506 Ga0495583_0072883 Ga0495583_0072883_143_1228 361
383 3300046507 Ga0495606_0034246 Ga0495606_0034246_429_1514 361
384 3300046513 Ga0495616_0000570 Ga0495616_0000570_20149_21234 361
385 3300046513 Ga0495616_0025166 Ga0495616_0025166_1662_2747 361
386 3300046513 Ga0495616_0046004 Ga0495616_0046004_407_1492 361
387 3300046513 Ga0495616_0046360 Ga0495616_0046360_534_1619 361
388 3300046518 Ga0495631_0059792 Ga0495631_0059792_437_1522 361
389 3300046519 Ga0495632_0000177 Ga0495632_0000177_13094_14179 361
390 3300046519 Ga0495632_0024887 Ga0495632_0024887_1070_2155 361
391 3300046519 Ga0495632_0035840 Ga0495632_0035840_548_1633 361
392 3300046520 Ga0495637_0000053 Ga0495637_0000053_96047_97132 361
393 3300046522 Ga0495643_0048487 Ga0495643_0048487_189_1274 361
394 3300046523 Ga0495644_0001533 Ga0495644_0001533_7813_8898 361
395 3300046523 Ga0495644_0004996 Ga0495644_0004996_2600_3685 361
396 3300046523 Ga0495644_0011868 Ga0495644_0011868_898_1983 361
397 3300046523 Ga0495644_0059921 Ga0495644_0059921_183_1301 361
398 3300046524 Ga0495648_0026746 Ga0495648_0026746_415_1500 361
399 3300046528 Ga0495642_0000137 Ga0495642_0000137_41115_42200 361
400 3300046528 Ga0495642_0010279 Ga0495642_0010279_1050_2144 361
401 3300046528 Ga0495642_0013241 Ga0495642_0013241_227_1312 361
402 3300046528 Ga0495642_0037164 Ga0495642_0037164_458_1543 361
403 3300046538 Ga0495609_0000314 Ga0495609_0000314_8153_9238 361
404 3300046538 Ga0495609_0001446 Ga0495609_0001446_2190_3305 361
405 3300046542 Ga0495597_0000348 Ga0495597_0000348_27219_28304 361
406 3300046558 Ga0495633_0002729 Ga0495633_0002729_10174_11259 361
407 3300046558 Ga0495633_0051892 Ga0495633_0051892_179_1297 361
408 3300046616 Ga0495668_0000343 Ga0495668_0000343_19402_20505 361
409 3300046616 Ga0495668_0013849 Ga0495668_0013849_903_1988 361
410 3300046616 Ga0495668_0039385 Ga0495668_0039385_40_1125 361
411 3300046648 Ga0495611_0000672 Ga0495611_0000672_722_1807 361
412 3300046648 Ga0495611_0001589 Ga0495611_0001589_6548_7633 361
413 3300046660 Ga0495625_0005443 Ga0495625_0005443_2546_3631 361
414 3300046665 Ga0495661_0013782 Ga0495661_0013782_469_1554 361
415 3300046674 Ga0495588_0095420 Ga0495588_0095420_247_1365 361
416 3300046684 Ga0495669_0000791 Ga0495669_0000791_3881_4966 361
417 3300046684 Ga0495669_0006772 Ga0495669_0006772_496_1581 361
418 3300046684 Ga0495669_0013540 Ga0495669_0013540_2371_3456 361
419 3300046684 Ga0495669_0052652 Ga0495669_0052652_431_1516 361
420 3300046691 Ga0495670_0026159 Ga0495670_0026159_1416_2510 361
421 3300046692 Ga0495671_0005577 Ga0495671_0005577_853_1938 361
422 3300046692 Ga0495671_0006429 Ga0495671_0006429_3932_5017 361
423 3300046692 Ga0495671_0014791 Ga0495671_0014791_2090_3175 361
424 3300046694 Ga0495649_0000291 Ga0495649_0000291_11837_12922 361
425 3300046694 Ga0495649_0024334 Ga0495649_0024334_201_1286 361
426 3300046794 Ga0495589_0002907 Ga0495589_0002907_5846_6931 361
427 3300046794 Ga0495589_0025590 Ga0495589_0025590_313_1398 361
428 3300046794 Ga0495589_0071610 Ga0495589_0071610_314_1399 361
429 3300046810 Ga0495660_0011928 Ga0495660_0011928_31_1116 361
430 3300046810 Ga0495660_0033149 Ga0495660_0033149_482_1567 361
431 3300046810 Ga0495660_0069143 Ga0495660_0069143_669_1754 361
432 3300047320 Ga0495672_0000135 Ga0495672_0000135_93988_95073 361
433 3300047320 Ga0495672_0000340 Ga0495672_0000340_31375_32490 361
434 3300047320 Ga0495672_0001282 Ga0495672_0001282_19282_20370 361
435 3300047323 Ga0495683_0010353 Ga0495683_0010353_2379_3494 361
436 3300047443 Ga0495687_002025 Ga0495687_002025_4182_5267 361
437 3300047443 Ga0495687_014646 Ga0495687_014646_1046_2131 361
438 3300047445 Ga0495677_0001774 Ga0495677_0001774_6909_7994 361
439 3300047446 Ga0495679_004750 Ga0495679_004750_362_1447 361
440 3300047446 Ga0495679_008420 Ga0495679_008420_1441_2526 361
441 3300047470 Ga0495681_0001259 Ga0495681_0001259_10562_11647 361
442 3300047470 Ga0495681_0004464 Ga0495681_0004464_8432_9517 361
443 3300047470 Ga0495681_0073101 Ga0495681_0073101_278_1396 361
444 3300047472 Ga0495686_0002181 Ga0495686_0002181_6991_8094 361
445 3300048091 Ga0495626_0001781 Ga0495626_0001781_534_1619 361
446 3300048091 Ga0495626_0015723 Ga0495626_0015723_1102_2187 361
447 3300048091 Ga0495626_0016839 Ga0495626_0016839_2204_3289 361
448 3300048091 Ga0495626_0103605 Ga0495626_0103605_100_1185 361
449 3300048905 Ga0496102_0002668 Ga0496102_0002668_11919_13004 361
450 3300048927 Ga0496124_0104422 Ga0496124_0104422_658_1743 361
451 3300049459 Ga0495678_004786 Ga0495678_004786_5311_6396 361
452 3300049459 Ga0495678_005984 Ga0495678_005984_1461_2546 361
453 3300049459 Ga0495678_018557 Ga0495678_018557_1990_3075 361
454 3300049460 Ga0495682_0000937 Ga0495682_0000937_15906_16991 361
455 3300049775 Ga0501279_000692 Ga0501279_000692_103_1188 361

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

50

383

0.95

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

45

292

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hdt-assembly1.cif.gz_A crystal structure of a carnitinyl-coa dehydratase from mycobacterium thermoresistibile 0.963 3 351
4hdt-assembly1.cif.gz_A crystal structure of a carnitinyl-coa dehydratase from mycobacterium thermoresistibile 0.938 3 351
3bpt-assembly1.cif.gz_A crystal structure of human beta-hydroxyisobutyryl-coa hydrolase in complex with quercetin 0.9348 1 349
4j2u-assembly2.cif.gz_B crystal structure of an enoyl-coa hydratase from rhodobacter sphaeroides 2.4.1 0.9245 4 349
6ywe-assembly1.cif.gz_88 the structure of the mitoribosome from neurospora crassa in the p/e trna bound state 0.9096 1 351
ID Description Score Start End Superfamily
af_O53419_1_345_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9619 2 348 3.90.226.10
af_Q5XIE6_31_385_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9396 4 349 3.90.226.10
af_Q19278_30_386_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.935 4 348 3.90.226.10
af_O53419_1_345_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9293 2 348 3.90.226.10
af_I1KQ42_38_407_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9265 6 351 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A6I1HMA1-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9908 1 361 GO:0003860
GO:0006574
GO:0016853
AF-A0A350CSM3-F1-model_v4 3-hydroxyisobutyryl-CoA hydrolase 0.9766 1 225 GO:0003860
GO:0006574
AF-A0A344U971-F1-model_v4 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) 0.9671 3 348 GO:0003860
GO:0005829
GO:0006574
GO:0016853
AF-A0A6P1HRU7-F1-model_v4 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) 0.965 4 349 GO:0003860
GO:0005829
GO:0006574
AF-A0A0C5XM56-F1-model_v4 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) 0.964 1 351 GO:0003860
GO:0006574

Feature Viewer

pLDDT pTM Quality
91.14 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map