F447607

General Info

Members Datasets Scaffolds Average Seq Length
455 291 363 437

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10004568|Ga0316575_100045682
Length 505
Sequence VRSRRDGAVSGRGRDVGDRLRHGPPADQPTRGTGEDPEEQTDAGPPEVATHAAIVGLLPPTLAPVSDPTAGEGRSLRHGSRLDAYVDRYAERTLGMTASQIRALFAVASRPEVVSLAGGMPTIASLPLDVIGDQMADLVRGHGQTALQYGSGQGDPLLREQITDVMHTVGISGHPDDVVVTVGSQQALDLVTRIFIDPGDTILAEAPSYVGALSTFRSYQAVVHHVAMDDHGLVPEALRDAIRAAHARGSRPTFLYTIPSYHNPAGVTQTEQRRKEVLAIADEADLLVIEDDPYGLLGFSGPPPRALRADAEDRVIYLGSFSKTFAPGLRVGWVLAPHAVREKLVLAAEASVLCPPSLNQMVVSRYLAQSDWMGQVEVFRGLYRERRDAMLSSLHELFPAGSHWTQPEGGFYVWLTLPEGLDSQAMLPRAVTERVAYVPGTAFYADGFGTREMRLSYCFPTPERIREGVRRLAAVVEAELDLVRTFGPGHLASRAGMGLPGPDLA

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2558860280 Kutzneria sp. 744 Isolate Unclassified
8 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
9 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
10 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
11 2643221549 Agromyces sp. Root1464 Isolate Unclassified
12 2643221572 Leifsonia sp. Root60 Isolate Unclassified
13 2643221616 Leifsonia sp. Root227 Isolate Unclassified
14 2643221619 Agromyces sp. Root81 Isolate Unclassified
15 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
16 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
17 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
18 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
19 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
20 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
21 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
22 2808606372 Agromyces sp. 23-23 Isolate Unclassified
23 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
24 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
25 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
26 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
27 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
28 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
29 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
30 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
31 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
32 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
33 2855683550 Micromonospora sp. RP3T Isolate Unclassified
34 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
35 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
36 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
37 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
38 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
39 2858868258 Micromonospora sp. MH33 Isolate Unclassified
40 2858882152 Micromonospora noduli MED15 Isolate Nodule
41 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
42 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
43 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
44 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
45 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
46 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
47 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
48 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
49 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
50 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
51 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
52 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
53 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
54 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
55 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
56 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
57 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
58 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
59 2902582711 Micromonospora sp. AP08 Isolate Unclassified
60 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
61 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
62 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
63 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
64 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
65 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
66 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
67 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
68 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
69 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
70 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
71 2928153084 Leifsonia sp. 563 Isolate Unclassified
72 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
73 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
74 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
75 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
76 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
77 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
78 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
79 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
80 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
81 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
82 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
83 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
84 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
85 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
86 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
87 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
88 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
89 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
90 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
91 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
92 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
93 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
94 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
95 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
98 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
99 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
100 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
101 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
102 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
103 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
113 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
171 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
175 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
176 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
185 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
186 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
199 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
200 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
267 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
268 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
269 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
270 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
271 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
275 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
276 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 649633069 Micromonospora sp. L5 Isolate Unclassified
281 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
282 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
283 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
284 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
285 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
286 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
287 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
288 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
289 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
290 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
291 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.12
Metatranscriptomes 0.66
Isolates 20.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 12.09
Nodule 1.32
Rhizoplane 5.71
Rhizosphere 60
Stem 0
Stem Tuber 0.22
Unclassified 20.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013695 3300001979 Bacteria 3016
2 JGI24739J22299_10004756 3300001989 Bacteria 5183
3 JGI25164J39214_1001499 3300002772 Bacteria 5285
4 JGI25165J46597_1000005 3300003214 Bacteria 623702
5 Ga0055533_1000002 3300003756 Bacteria 1196393
6 Ga0055525_1000630 3300003759 Bacteria 14363
7 Ga0055527_1000004 3300003760 Bacteria 570634
8 Ga0055542_1000019 3300003762 Bacteria 341174
9 Ga0055529_1000008 3300003763 Bacteria 394786
10 Ga0065714_10009929 3300005288 Bacteria 6105
11 Ga0070658_10000380 3300005327 Bacteria 38742
12 Ga0070658_10028821 3300005327 Bacteria 4458
13 Ga0070658_10041771 3300005327 Bacteria 3700
14 Ga0070690_100140798 3300005330 Bacteria 1637
15 Ga0070682_100111081 3300005337 Bacteria 1827
16 Ga0068868_100147288 3300005338 Bacteria 1937
17 Ga0070660_100053744 3300005339 Bacteria 3107
18 Ga0070661_100148731 3300005344 Bacteria 1770
19 Ga0070668_100005063 3300005347 Bacteria 9756
20 Ga0070668_100135120 3300005347 Bacteria 1983
21 Ga0070668_100138420 3300005347 Bacteria 1960
22 Ga0070671_100030554 3300005355 Bacteria 4445
23 Ga0070671_100124005 3300005355 Bacteria 2174
24 Ga0070659_100022248 3300005366 Bacteria 4838
25 Ga0070659_100097996 3300005366 Bacteria 2357
26 Ga0070667_100016686 3300005367 Bacteria 6078
27 Ga0070667_100021246 3300005367 Bacteria 5393
28 Ga0070667_100087969 3300005367 Bacteria 2667
29 Ga0070710_10004155 3300005437 Bacteria 6874
30 Ga0070684_100105865 3300005535 Bacteria 2517
31 Ga0068853_100008802 3300005539 Bacteria 8118
32 Ga0068853_100111035 3300005539 Bacteria 2435
33 Ga0070665_100131018 3300005548 Bacteria 2510
34 Ga0068855_100030061 3300005563 Bacteria 6497
35 Ga0068855_100045411 3300005563 Bacteria 5197
36 Ga0068857_100001906 3300005577 Bacteria 16804
37 Ga0068854_100051018 3300005578 Bacteria 2962
38 Ga0068852_100009235 3300005616 Bacteria 7306
39 Ga0068852_100035377 3300005616 Bacteria 4166
40 Ga0068851_10000053 3300005834 Bacteria 71192
41 Ga0068863_100052942 3300005841 Bacteria 3846
42 Ga0068858_100000176 3300005842 Bacteria 68056
43 Ga0081455_10001057 3300005937 Bacteria 34651
44 Ga0081539_10002979 3300005985 Bacteria 22217
45 Ga0081539_10004168 3300005985 Bacteria 16407
46 Ga0081539_10004819 3300005985 Bacteria 14467
47 Ga0070717_10089057 3300006028 Bacteria 2603
48 Ga0075365_10007956 3300006038 Bacteria 5979
49 Ga0075364_10076913 3300006051 Bacteria 2203
50 Ga0075428_100000567 3300006844 Bacteria 37710
51 Ga0105240_10005148 3300009093 Bacteria 19564
52 Ga0105240_10153287 3300009093 Bacteria 2743
53 Ga0105245_10005554 3300009098 Bacteria 11077
54 Ga0105247_10065822 3300009101 Bacteria 2255
55 Ga0105243_10029910 3300009148 Bacteria 4191
56 Ga0105243_10179369 3300009148 Bacteria 1841
57 Ga0105241_10000797 3300009174 Bacteria 23942
58 Ga0105248_10000897 3300009177 Bacteria 33319
59 Ga0105248_10038783 3300009177 Bacteria 5333
60 Ga0105237_10004763 3300009545 Bacteria 15599
61 Ga0105237_10006213 3300009545 Bacteria 13315
62 Ga0105237_10049224 3300009545 Bacteria 4236
63 Ga0105238_10000476 3300009551 Bacteria 42016
64 Ga0105238_10012941 3300009551 Bacteria 8420
65 Ga0105238_10183607 3300009551 Bacteria 2068
66 Ga0105238_10290028 3300009551 Bacteria 1618
67 Ga0105249_10054747 3300009553 Bacteria 3648
68 Ga0157371_10005769 3300013102 Bacteria 10372
69 Ga0157371_10061626 3300013102 Bacteria 2659
70 Ga0157369_10012548 3300013105 Bacteria 9613
71 Ga0157369_10049996 3300013105 Bacteria 4530
72 Ga0157375_10460939 3300013308 Bacteria 1436
73 Ga0163163_10024492 3300014325 Bacteria 5745
74 Ga0157380_10007733 3300014326 Bacteria 7651
75 Ga0206356_10714500 3300020070 Bacteria 2437
76 Ga0206354_11255560 3300020081 Bacteria 10711
77 Ga0206353_11401675 3300020082 Bacteria 4377
78 Ga0209566_100056 3300025225 Bacteria 209595
79 Ga0209674_100001 3300025226 Bacteria 4013750
80 Ga0209672_100011 3300025228 Bacteria 856297
81 Ga0209147_100289 3300025229 Bacteria 42738
82 Ga0209563_100001 3300025230 Bacteria 4013775
83 Ga0209563_101759 3300025230 Bacteria 5450
84 Ga0207427_100024 3300025231 Bacteria 438403
85 Ga0209437_100243 3300025233 Bacteria 88712
86 Ga0209677_100001 3300025253 Bacteria 4013787
87 Ga0209677_100271 3300025253 Bacteria 34642
88 Ga0209148_1000023 3300025254 Bacteria 680511
89 Ga0209148_1001423 3300025254 Bacteria 12233
90 Ga0209233_1000001 3300025261 Bacteria 2992747
91 Ga0209455_1000023 3300025272 Bacteria 680449
92 Ga0209455_1014271 3300025272 Bacteria 1805
93 Ga0207656_10000001 3300025321 Bacteria 1323684
94 Ga0207688_10076870 3300025901 Bacteria 1902
95 Ga0207647_10002880 3300025904 Bacteria 12964
96 Ga0207647_10046832 3300025904 Bacteria 2692
97 Ga0207705_10000001 3300025909 Bacteria 2061880
98 Ga0207705_10014710 3300025909 Bacteria 5627
99 Ga0207705_10021403 3300025909 Bacteria 4615
100 Ga0207705_10025588 3300025909 Bacteria 4211
101 Ga0207705_10033057 3300025909 Bacteria 3696
102 Ga0207654_10000001 3300025911 Bacteria 1816198
103 Ga0207695_10002309 3300025913 Bacteria 28441
104 Ga0207695_10056175 3300025913 Bacteria 4098
105 Ga0207671_10000001 3300025914 Bacteria 1318881
106 Ga0207671_10003504 3300025914 Bacteria 15592
107 Ga0207671_10064899 3300025914 Bacteria 2714
108 Ga0207657_10030411 3300025919 Bacteria 4901
109 Ga0207657_10037401 3300025919 Bacteria 4334
110 Ga0207694_10000019 3300025924 Bacteria 312382
111 Ga0207694_10045565 3300025924 Bacteria 3387
112 Ga0207687_10010330 3300025927 Bacteria 6101
113 Ga0207687_10023082 3300025927 Bacteria 4144
114 Ga0207644_10131353 3300025931 Bacteria 1917
115 Ga0207644_10194567 3300025931 Bacteria 1596
116 Ga0207690_10005324 3300025932 Bacteria 7584
117 Ga0207690_10080573 3300025932 Bacteria 2272
118 Ga0207709_10013195 3300025935 Bacteria 4558
119 Ga0207711_10000405 3300025941 Bacteria 45662
120 Ga0207667_10000498 3300025949 Bacteria 51911
121 Ga0207667_10029017 3300025949 Bacteria 6005
122 Ga0207667_10109863 3300025949 Bacteria 2844
123 Ga0207668_10001446 3300025972 Bacteria 13956
124 Ga0207668_10020437 3300025972 Bacteria 4207
125 Ga0207658_10013587 3300025986 Bacteria 5568
126 Ga0207703_10000121 3300026035 Bacteria 94523
127 Ga0207702_10015536 3300026078 Bacteria 6302
128 Ga0207702_10200770 3300026078 Bacteria 1848
129 Ga0207641_10010075 3300026088 Bacteria 7771
130 Ga0207641_10070398 3300026088 Bacteria 3005
131 Ga0207674_10018190 3300026116 Bacteria 7647
132 Ga0207674_10123332 3300026116 Bacteria 2557
133 Ga0207698_10000569 3300026142 Bacteria 21528
134 Ga0207698_10004534 3300026142 Bacteria 8477
135 Ga0207698_10032129 3300026142 Bacteria 3799
136 Ga0268266_10176983 3300028379 Bacteria 1940
137 Ga0307515_10004726 3300028794 Bacteria 27912
138 Ga0307515_10182915 3300028794 Bacteria 2038
139 Ga0307511_10002627 3300030521 Bacteria 18740
140 Ga0307512_10062952 3300030522 Bacteria 2841
141 Ga0307509_10008875 3300031507 Bacteria 12681
142 Ga0307509_10112986 3300031507 Bacteria 2714
143 Ga0307508_10011562 3300031616 Bacteria 8066
144 Ga0307514_10064224 3300031649 Bacteria 2785
145 Ga0316575_10004568 3300031665 Bacteria 4874
146 Ga0316579_10012218 3300031691 Bacteria 3667
147 Ga0316576_10020677 3300031727 Bacteria 4539
148 Ga0316576_10020994 3300031727 Bacteria 4508
149 Ga0316576_10039134 3300031727 Bacteria 3403
150 Ga0316578_10012564 3300031728 Bacteria 4468
151 Ga0307516_10036802 3300031730 Bacteria 4896
152 Ga0316577_10033601 3300031733 Bacteria 2865
153 Ga0307409_100061445 3300031995 Bacteria 2936
154 Ga0307409_100114806 3300031995 Bacteria 2266
155 Ga0307409_100134083 3300031995 Bacteria 2122
156 Ga0307416_100050519 3300032002 Bacteria 3315
157 Ga0307416_100165812 3300032002 Bacteria 2049
158 Ga0307416_100275749 3300032002 Bacteria 1654
159 Ga0307415_100049030 3300032126 Bacteria 2852
160 Ga0307415_100049061 3300032126 Bacteria 2852
161 Ga0316585_10000595 3300032137 Bacteria 8845
162 Ga0307507_10034656 3300033179 Bacteria 5207
163 Ga0373940_0002064 3300035088 Bacteria 3816
164 Ga0373942_0000103 3300035207 Bacteria 18990
165 Ga0316574_0003143 3300035398 Bacteria 8448
166 Ga0316574_0016515 3300035398 Bacteria 4302
167 Ga0316574_0079202 3300035398 Bacteria 2084
168 Ga0316582_0048173 3300036647 Bacteria 2694
169 Ga0316584_0022311 3300036712 Bacteria 4615
170 Ga0395899_0012368 3300037312 Bacteria 6533
171 Ga0395899_0027971 3300037312 Bacteria 4246
172 Ga0395900_0000888 3300037418 Bacteria 39271
173 Ga0395900_0008604 3300037418 Bacteria 10487
174 Ga0395898_0000355 3300037466 Bacteria 101003
175 Ga0395898_0026345 3300037466 Bacteria 5853
176 Ga0395898_0229884 3300037466 Bacteria 1769
177 Ga0316581_0000334 3300037588 Bacteria 8529
178 Ga0395901_0001579 3300038443 Bacteria 23599
179 Ga0395901_0019074 3300038443 Bacteria 7014
180 Ga0395901_0041409 3300038443 Bacteria 4774
181 Ga0451791_1064226 3300041451 Bacteria 2954
182 Ga0451793_1372385 3300041452 Bacteria 5872
183 Ga0451837_0325826 3300041494 Bacteria 1942
184 Ga0451839_1225663 3300041496 Bacteria 2195
185 Ga0451841_0160199 3300041498 Bacteria 3443
186 Ga0451843_0815425 3300041509 Bacteria 6342
187 Ga0451853_0777022 3300041512 Bacteria 8132
188 Ga0451853_1209411 3300041512 Bacteria 6061
189 Ga0466969_0013278 3300044656 Bacteria 4337
190 Ga0466972_0005899 3300044658 Bacteria 6143
191 Ga0466965_0000004 3300044683 Bacteria 229348
192 Ga0466961_0006386 3300044693 Bacteria 7484
193 Ga0466961_0025225 3300044693 Bacteria 3823
194 Ga0466961_0037953 3300044693 Bacteria 3090
195 Ga0466961_0063183 3300044693 Bacteria 2352
196 Ga0466961_0069532 3300044693 Bacteria 2235
197 Ga0466963_0008036 3300044694 Bacteria 6315
198 Ga0466971_0045389 3300044719 Bacteria 1974
199 Ga0466970_0030763 3300044765 Bacteria 2832
200 Ga0466960_0029798 3300044901 Bacteria 2507
201 Ga0466960_0030605 3300044901 Bacteria 2478
202 Ga0466960_0089770 3300044901 Bacteria 1564
203 Ga0466959_0045659 3300045049 Bacteria 3226
204 Ga0466959_0053977 3300045049 Bacteria 2937
205 Ga0466959_0072950 3300045049 Bacteria 2483
206 Ga0466958_0050946 3300045836 Bacteria 2506
207 Ga0495650_0000211 3300046471 Bacteria 125248
208 Ga0495606_0001892 3300046507 Bacteria 26163
209 Ga0495632_0009475 3300046519 Bacteria 5870
210 Ga0495669_0009174 3300046684 Bacteria 4168
211 Ga0495672_0018755 3300047320 Bacteria 4582
212 Ga0495615_0004695 3300048090 Bacteria 2406
213 Ga0496101_0100611 3300048904 Bacteria 2163
214 Ga0496102_0018028 3300048905 Bacteria 6195
215 Ga0496102_0117081 3300048905 Bacteria 2487
216 Ga0496103_0056568 3300048906 Bacteria 2435
217 Ga0496103_0157371 3300048906 Bacteria 1457
218 Ga0496104_0024327 3300048907 Bacteria 5571
219 Ga0496105_0004142 3300048908 Bacteria 10877
220 Ga0496105_0026874 3300048908 Bacteria 4696
221 Ga0496108_0000196 3300048911 Bacteria 55981
222 Ga0496108_0001314 3300048911 Bacteria 19538
223 Ga0496108_0035420 3300048911 Bacteria 4149
224 Ga0496108_0086508 3300048911 Bacteria 2661
225 Ga0496109_0002656 3300048912 Bacteria 15001
226 Ga0496109_0083919 3300048912 Bacteria 2938
227 Ga0496110_0000656 3300048913 Bacteria 23611
228 Ga0496110_0212364 3300048913 Bacteria 1759
229 Ga0496111_0012380 3300048914 Bacteria 5773
230 Ga0496111_0065854 3300048914 Bacteria 2630
231 Ga0496113_0003887 3300048916 Bacteria 9048
232 Ga0496113_0166370 3300048916 Bacteria 1745
233 Ga0496114_0003739 3300048917 Bacteria 11722
234 Ga0496114_0016583 3300048917 Bacteria 5938
235 Ga0496114_0021592 3300048917 Bacteria 5239
236 Ga0496115_0137799 3300048918 Bacteria 2013
237 Ga0496117_0000669 3300048920 Bacteria 54825
238 Ga0496117_0001906 3300048920 Bacteria 27989
239 Ga0496117_0021298 3300048920 Bacteria 5251
240 Ga0496117_0069351 3300048920 Bacteria 2374
241 Ga0496117_0111557 3300048920 Bacteria 1702
242 Ga0496118_0000985 3300048921 Bacteria 44347
243 Ga0496118_0009039 3300048921 Bacteria 10155
244 Ga0496118_0047099 3300048921 Bacteria 3346
245 Ga0496119_0000553 3300048922 Bacteria 50775
246 Ga0496119_0003472 3300048922 Bacteria 16351
247 Ga0496119_0011186 3300048922 Bacteria 7470
248 Ga0496119_0039485 3300048922 Bacteria 3033
249 Ga0496119_0042303 3300048922 Bacteria 2890
250 Ga0496120_0001113 3300048923 Bacteria 34863
251 Ga0496120_0003581 3300048923 Bacteria 13969
252 Ga0496120_0020585 3300048923 Bacteria 4187
253 Ga0496120_0023193 3300048923 Bacteria 3888
254 Ga0496120_0054834 3300048923 Bacteria 2257
255 Ga0496121_0000046 3300048924 Bacteria 335942
256 Ga0496122_0002574 3300048925 Bacteria 25478
257 Ga0496122_0004413 3300048925 Bacteria 17513
258 Ga0496122_0015575 3300048925 Bacteria 7257
259 Ga0496123_0002281 3300048926 Bacteria 24132
260 Ga0496123_0026292 3300048926 Bacteria 4363
261 Ga0496124_0000090 3300048927 Bacteria 192095
262 Ga0496125_0000046 3300048928 Bacteria 295288
263 Ga0496126_0002342 3300048929 Bacteria 25941
264 Ga0501031_0001529 3300049568 Bacteria 14383
265 Ga0501031_0043332 3300049568 Bacteria 2937
266 Ga0501032_0001402 3300049569 Bacteria 19166
267 Ga0501033_0006614 3300049570 Bacteria 9063
268 Ga0501033_0007015 3300049570 Bacteria 8797
269 Ga0501033_0008041 3300049570 Bacteria 8169
270 Ga0501033_0008956 3300049570 Bacteria 7728
271 Ga0501033_0035165 3300049570 Bacteria 3756
272 Ga0501034_0004667 3300049571 Bacteria 15179
273 Ga0501034_0009557 3300049571 Bacteria 10151
274 Ga0501034_0013703 3300049571 Bacteria 8337
275 Ga0501034_0034004 3300049571 Bacteria 5169
276 Ga0501034_0046452 3300049571 Bacteria 4387
277 Ga0501034_0082754 3300049571 Bacteria 3211
278 Ga0501034_0083776 3300049571 Bacteria 3190
279 Ga0501034_0109778 3300049571 Bacteria 2749
280 Ga0501034_0163169 3300049571 Bacteria 2198
281 Ga0501034_0190873 3300049571 Bacteria 2011
282 Ga0501036_0016404 3300049572 Bacteria 6187
283 Ga0501036_0184470 3300049572 Bacteria 1756
284 Ga0501036_0218873 3300049572 Bacteria 1599
285 Ga0501037_0002176 3300049573 Bacteria 14181
286 Ga0501037_0030393 3300049573 Bacteria 3992
287 Ga0501037_0043521 3300049573 Bacteria 3299
288 Ga0501038_0001027 3300049574 Bacteria 25180
289 Ga0501038_0088093 3300049574 Bacteria 2606
290 Ga0501039_0011078 3300049575 Bacteria 6871
291 Ga0501039_0126737 3300049575 Bacteria 2003
292 Ga0501042_0002934 3300049578 Bacteria 10590
293 Ga0501042_0095698 3300049578 Bacteria 2133
294 Ga0501043_0035581 3300049579 Bacteria 3917
295 Ga0501043_0045364 3300049579 Bacteria 3457
296 Ga0501043_0101919 3300049579 Bacteria 2256
297 Ga0501043_0105147 3300049579 Bacteria 2218
298 Ga0501043_0130392 3300049579 Bacteria 1970
299 Ga0501043_0139047 3300049579 Bacteria 1902
300 Ga0501046_0002885 3300049580 Bacteria 15938
301 Ga0501046_0141330 3300049580 Bacteria 1821
302 Ga0501047_0037025 3300049581 Bacteria 4716
303 Ga0501047_0091594 3300049581 Bacteria 2918
304 Ga0501047_0095003 3300049581 Bacteria 2860
305 Ga0501047_0105006 3300049581 Bacteria 2705
306 Ga0501048_0049175 3300049582 Bacteria 3006
307 Ga0501048_0124195 3300049582 Bacteria 1825
308 Ga0501070_0000269 3300049586 Bacteria 49060
309 Ga0501070_0001674 3300049586 Bacteria 19652
310 Ga0501070_0002327 3300049586 Bacteria 16673
311 Ga0501070_0007555 3300049586 Bacteria 9238
312 Ga0501070_0061690 3300049586 Bacteria 3106
313 Ga0501071_0044176 3300049587 Bacteria 3195
314 Ga0501073_0000063 3300049589 Bacteria 66508
315 Ga0501073_0014271 3300049589 Bacteria 5769
316 Ga0501073_0030405 3300049589 Bacteria 3856
317 Ga0501073_0133429 3300049589 Bacteria 1721
318 Ga0501076_0117680 3300049592 Bacteria 2151
319 Ga0501080_0000331 3300049742 Bacteria 36170
320 Ga0501080_0208647 3300049742 Bacteria 1791
321 Ga0501083_0000990 3300049744 Bacteria 18870
322 Ga0501083_0008270 3300049744 Bacteria 7355
323 Ga0501035_0001926 3300049822 Bacteria 20795
324 Ga0501035_0029068 3300049822 Bacteria 5041
325 Ga0501035_0032143 3300049822 Bacteria 4776
326 Ga0501035_0032156 3300049822 Bacteria 4775
327 Ga0501035_0191515 3300049822 Bacteria 1758
328 Ga0501044_0000521 3300049823 Bacteria 46867
329 Ga0501044_0016576 3300049823 Bacteria 7908
330 Ga0501044_0017313 3300049823 Bacteria 7729
331 Ga0501044_0071565 3300049823 Bacteria 3525
332 Ga0501045_0085474 3300049824 Bacteria 2328
333 nmdc:mga00v17_7302_c1 3300050491 Bacteria 5889
334 nmdc:mga0yw44_1262_c1 3300050492 Bacteria 9956
335 nmdc:mga0sz30_10808_c1 3300050516 Bacteria 1996
336 Ga0500635_0000066 3300053080 Bacteria 69274
337 Ga0500643_000124 3300053087 Bacteria 79663
338 Ga0500643_000794 3300053087 Bacteria 20487
339 Ga0500556_0000008 3300053104 Bacteria 304943
340 Ga0500556_0000527 3300053104 Bacteria 26115
341 Ga0500562_000180 3300053108 Bacteria 17367
342 Ga0500652_039988 3300053131 Bacteria 1883
343 Ga0500655_001913 3300053133 Bacteria 3870
344 Ga0500559_0000420 3300053136 Bacteria 30370
345 Ga0500559_0001832 3300053136 Bacteria 11596
346 Ga0500568_0000003 3300053139 Bacteria 863587
347 Ga0500568_0000007 3300053139 Bacteria 292579
348 Ga0500568_0000099 3300053139 Bacteria 80197
349 Ga0500568_0017214 3300053139 Bacteria 3194
350 Ga0500573_0000005 3300053140 Bacteria 315762
351 Ga0500573_0004199 3300053140 Bacteria 7547
352 Ga0500573_0020760 3300053140 Bacteria 3761
353 Ga0500573_0023474 3300053140 Bacteria 3542
354 Ga0500573_0025369 3300053140 Bacteria 3408
355 Ga0500573_0027563 3300053140 Bacteria 3268
356 Ga0500573_0053983 3300053140 Bacteria 2308
357 Ga0500577_0010271 3300053142 Bacteria 2750
358 Ga0500590_001387 3300053148 Bacteria 9919
359 Ga0500616_0000010 3300053153 Bacteria 761410
360 Ga0500616_0000807 3300053153 Bacteria 35698
361 Ga0500616_0015095 3300053153 Bacteria 4426
362 Ga0500620_000266 3300053155 Bacteria 10153
363 Ga0500645_003342 3300053730 Bacteria 6574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10049996 Ga0157369_100499963 401
2 3300038443 Ga0395901_0019074 Ga0395901_0019074_5747_6985 401
3 3300044693 Ga0466961_0025225 Ga0466961_0025225_1616_2848 401
4 3300044694 Ga0466963_0008036 Ga0466963_0008036_698_1924 401
5 3300045049 Ga0466959_0053977 Ga0466959_0053977_704_1936 401
6 3300030521 Ga0307511_10002627 Ga0307511_1000262716 403
7 3300031995 Ga0307409_100134083 Ga0307409_1001340832 405
8 3300036647 Ga0316582_0048173 Ga0316582_0048173_718_1950 407
9 3300036712 Ga0316584_0022311 Ga0316584_0022311_803_2035 407
10 3300035398 Ga0316574_0079202 Ga0316574_0079202_476_1711 409
11 3300009177 Ga0105248_10038783 Ga0105248_100387832 412
12 3300026088 Ga0207641_10070398 Ga0207641_100703982 412
13 3300031995 Ga0307409_100061445 Ga0307409_1000614452 412
14 3300031995 Ga0307409_100114806 Ga0307409_1001148062 412
15 3300032002 Ga0307416_100050519 Ga0307416_1000505193 412
16 3300032002 Ga0307416_100165812 Ga0307416_1001658122 412
17 3300032002 Ga0307416_100275749 Ga0307416_1002757491 412
18 3300037418 Ga0395900_0008604 Ga0395900_0008604_5729_7039 412
19 3300037466 Ga0395898_0229884 Ga0395898_0229884_408_1715 412
20 3300044901 Ga0466960_0029798 Ga0466960_0029798_318_1607 412
21 3300048090 Ga0495615_0004695 Ga0495615_0004695_956_2242 412
22 3300048905 Ga0496102_0117081 Ga0496102_0117081_738_2030 412
23 3300006844 Ga0075428_100000567 Ga0075428_10000056729 413
24 3300033179 Ga0307507_10034656 Ga0307507_100346563 415
25 3300020070 Ga0206356_10714500 Ga0206356_107145002 417
26 3300005985 Ga0081539_10002979 Ga0081539_100029799 419
27 3300005347 Ga0070668_100005063 Ga0070668_1000050635 420
28 3300025972 Ga0207668_10001446 Ga0207668_100014464 420
29 3300005535 Ga0070684_100105865 Ga0070684_1001058652 421
30 3300046519 Ga0495632_0009475 Ga0495632_0009475_2373_3680 422
31 3300006028 Ga0070717_10089057 Ga0070717_100890572 423
32 3300028794 Ga0307515_10004726 Ga0307515_100047265 423
33 3300031507 Ga0307509_10112986 Ga0307509_101129862 423
34 3300031730 Ga0307516_10036802 Ga0307516_100368025 423
35 3300046684 Ga0495669_0009174 Ga0495669_0009174_1829_3112 423
36 iso_pu_bacteria 2515154088 2515498194 423
37 iso_pu_bacteria 2515154129 2515721844 423
38 iso_pu_bacteria 2515154137 2515759415 423
39 iso_pu_bacteria 2515154202 2516084198 423
40 iso_pu_bacteria 2515154203 2516092295 423
41 iso_pu_bacteria 2622736626 2623585772 423
42 iso_pu_bacteria 2772190715 2772642827 423
43 iso_pu_bacteria 2831935698 2831938185 423
44 iso_pu_bacteria 2832004796 2832005328 423
45 iso_pu_bacteria 2855670206 2855675129 423
46 iso_pu_bacteria 2855676851 2855679760 423
47 iso_pu_bacteria 2855683550 2855688020 423
48 iso_pu_bacteria 2856858025 2856859655 423
49 iso_pu_bacteria 2857288857 2857294402 423
50 iso_pu_bacteria 2858848962 2858854689 423
51 iso_pu_bacteria 2858868258 2858868762 423
52 iso_pu_bacteria 2858882152 2858885250 423
53 iso_pu_bacteria 2858888857 2858891883 423
54 iso_pu_bacteria 2858895516 2858899662 423
55 iso_pu_bacteria 2858902515 2858904902 423
56 iso_pu_bacteria 2866065130 2866071463 423
57 iso_pu_bacteria 2867302475 2867304702 423
58 iso_pu_bacteria 2867312974 2867318730 423
59 iso_pu_bacteria 2867319477 2867323954 423
60 iso_pu_bacteria 2867507094 2867509988 423
61 iso_pu_bacteria 2869048445 2869052018 423
62 iso_pu_bacteria 2869061728 2869067476 423
63 iso_pu_bacteria 2869068681 2869074770 423
64 iso_pu_bacteria 2880489317 2880494461 423
65 iso_pu_bacteria 2880495981 2880497843 423
66 iso_pu_bacteria 2902582711 2902588526 423
67 iso_pu_bacteria 2929219909 2929226408 423
68 iso_pu_bacteria 2929226422 2929233112 423
69 iso_pu_bacteria 2996221748 2996222816 423
70 iso_pu_bacteria 649633069 649816363 423
71 iso_pu_bacteria 8003830390 8003836212 423
72 iso_pu_bacteria 8003870546 8003874656 423
73 iso_pu_bacteria 8054704163 8054709575 423
74 iso_pu_bacteria 8054727385 8054729118 423
75 iso_pu_bacteria 8054734606 8054740481 423
76 iso_pu_bacteria 8055412473 8055417469 423
77 3300005347 Ga0070668_100135120 Ga0070668_1001351202 424
78 3300005548 Ga0070665_100131018 Ga0070665_1001310182 424
79 3300013308 Ga0157375_10460939 Ga0157375_104609391 424
80 3300025901 Ga0207688_10076870 Ga0207688_100768702 424
81 3300025972 Ga0207668_10020437 Ga0207668_100204373 424
82 3300030522 Ga0307512_10062952 Ga0307512_100629522 424
83 3300031616 Ga0307508_10011562 Ga0307508_100115623 424
84 3300041451 Ga0451791_1064226 Ga0451791_1064226_756_2045 424
85 3300041452 Ga0451793_1372385 Ga0451793_1372385_1210_2499 424
86 3300041494 Ga0451837_0325826 Ga0451837_0325826_613_1902 424
87 3300041496 Ga0451839_1225663 Ga0451839_1225663_676_1965 424
88 3300041498 Ga0451841_0160199 Ga0451841_0160199_1056_2345 424
89 3300041509 Ga0451843_0815425 Ga0451843_0815425_1854_3143 424
90 3300041512 Ga0451853_0777022 Ga0451853_0777022_4488_5777 424
91 3300048905 Ga0496102_0018028 Ga0496102_0018028_3855_5144 424
92 3300048908 Ga0496105_0004142 Ga0496105_0004142_1628_2968 424
93 3300048911 Ga0496108_0001314 Ga0496108_0001314_14587_15876 424
94 3300048912 Ga0496109_0002656 Ga0496109_0002656_3658_4998 424
95 3300048913 Ga0496110_0000656 Ga0496110_0000656_17772_19112 424
96 3300048914 Ga0496111_0012380 Ga0496111_0012380_3587_4876 424
97 3300048916 Ga0496113_0003887 Ga0496113_0003887_839_2128 424
98 3300048917 Ga0496114_0003739 Ga0496114_0003739_9408_10697 424
99 3300048917 Ga0496114_0021592 Ga0496114_0021592_233_1573 424
100 3300048918 Ga0496115_0137799 Ga0496115_0137799_672_1961 424
101 3300005985 Ga0081539_10004168 Ga0081539_100041684 425
102 3300031507 Ga0307509_10008875 Ga0307509_100088753 425
103 3300041512 Ga0451853_1209411 Ga0451853_1209411_1832_3130 425
104 3300044765 Ga0466970_0030763 Ga0466970_0030763_16_1338 425
105 iso_pu_bacteria 2501939600 2501944871 425
106 iso_pu_bacteria 2751185782 2753269733 425
107 iso_pu_bacteria 8003856774 8003860110 425
108 3300005985 Ga0081539_10004819 Ga0081539_100048195 426
109 3300031727 Ga0316576_10020677 Ga0316576_100206775 426
110 3300031727 Ga0316576_10039134 Ga0316576_100391343 427
111 3300048904 Ga0496101_0100611 Ga0496101_0100611_658_1959 427
112 3300048917 Ga0496114_0016583 Ga0496114_0016583_3520_4821 427
113 iso_pu_bacteria 8047710418 8047719083 427
114 3300028379 Ga0268266_10176983 Ga0268266_101769832 428
115 3300032126 Ga0307415_100049030 Ga0307415_1000490301 428
116 3300037466 Ga0395898_0026345 Ga0395898_0026345_3148_4503 428
117 3300038443 Ga0395901_0001579 Ga0395901_0001579_3603_4958 428
118 3300053087 Ga0500643_000794 Ga0500643_000794_813_2117 428
119 iso_pu_bacteria 2558860280 2559427977 428
120 iso_pu_bacteria 2857737099 2857738779 428
121 iso_pu_bacteria 2915768154 2915774180 428
122 iso_pu_bacteria 2966924647 2966926057 428
123 3300005327 Ga0070658_10000380 Ga0070658_1000038034 429
124 3300005367 Ga0070667_100087969 Ga0070667_1000879692 429
125 3300005539 Ga0068853_100111035 Ga0068853_1001110351 429
126 3300005616 Ga0068852_100035377 Ga0068852_1000353773 429
127 3300009551 Ga0105238_10012941 Ga0105238_100129419 429
128 3300025909 Ga0207705_10014710 Ga0207705_100147106 429
129 3300025924 Ga0207694_10045565 Ga0207694_100455653 429
130 3300026142 Ga0207698_10032129 Ga0207698_100321293 429
131 3300032126 Ga0307415_100049061 Ga0307415_1000490612 429
132 3300035088 Ga0373940_0002064 Ga0373940_0002064_2261_3571 429
133 3300035207 Ga0373942_0000103 Ga0373942_0000103_11779_13089 429
134 3300035398 Ga0316574_0003143 Ga0316574_0003143_2021_3334 429
135 3300035398 Ga0316574_0016515 Ga0316574_0016515_1031_2356 429
136 3300037588 Ga0316581_0000334 Ga0316581_0000334_768_2093 429
137 3300044656 Ga0466969_0013278 Ga0466969_0013278_1894_3213 429
138 3300044693 Ga0466961_0006386 Ga0466961_0006386_1625_2944 429
139 3300045049 Ga0466959_0072950 Ga0466959_0072950_984_2303 429
140 3300048911 Ga0496108_0000196 Ga0496108_0000196_5975_7285 429
141 iso_pu_bacteria 2751185788 2753303949 429
142 iso_pu_bacteria 2904430863 2904432179 429
143 iso_pu_bacteria 2904501621 2904502036 429
144 iso_pu_bacteria 2908674828 2908677857 429
145 iso_pu_bacteria 2909074476 2909076402 429
146 iso_pu_bacteria 2919039151 2919040322 429
147 iso_pu_bacteria 2919042368 2919044455 429
148 iso_pu_bacteria 2928104781 2928105696 429
149 iso_pu_bacteria 2928500415 2928502481 429
150 iso_pu_bacteria 2984551494 2984552202 429
151 3300005937 Ga0081455_10001057 Ga0081455_1000105712 430
152 3300047320 Ga0495672_0018755 Ga0495672_0018755_2138_3475 430
153 3300048911 Ga0496108_0035420 Ga0496108_0035420_914_2326 430
154 iso_pu_bacteria 2585428094 2587861977 430
155 iso_pu_bacteria 2839986021 2839988987 430
156 iso_pu_bacteria 2852643534 2852644007 430
157 iso_pu_bacteria 2857733635 2857735057 430
158 iso_pu_bacteria 2897561785 2897561840 430
159 iso_pu_bacteria 2643221635 2644197576 431
160 3300049571 Ga0501034_0034004 Ga0501034_0034004_1116_2417 432
161 3300049571 Ga0501034_0163169 Ga0501034_0163169_867_2168 432
162 3300049575 Ga0501039_0126737 Ga0501039_0126737_641_1960 432
163 3300049592 Ga0501076_0117680 Ga0501076_0117680_222_1541 432
164 iso_pu_bacteria 2585427649 2586065721 432
165 iso_pu_bacteria 2852677369 2852677573 432
166 iso_pu_bacteria 2870622029 2870625369 432
167 3300006038 Ga0075365_10007956 Ga0075365_100079566 433
168 3300006051 Ga0075364_10076913 Ga0075364_100769132 433
169 3300028794 Ga0307515_10182915 Ga0307515_101829152 433
170 3300044683 Ga0466965_0000004 Ga0466965_0000004_140476_141777 433
171 3300048920 Ga0496117_0001906 Ga0496117_0001906_9551_10855 433
172 3300048921 Ga0496118_0000985 Ga0496118_0000985_25928_27232 433
173 3300048921 Ga0496118_0047099 Ga0496118_0047099_1811_3154 433
174 3300048922 Ga0496119_0000553 Ga0496119_0000553_19902_21203 433
175 3300048922 Ga0496119_0011186 Ga0496119_0011186_3993_5336 433
176 3300048922 Ga0496119_0042303 Ga0496119_0042303_1246_2550 433
177 3300048924 Ga0496121_0000046 Ga0496121_0000046_172725_174026 433
178 3300048925 Ga0496122_0002574 Ga0496122_0002574_9304_10647 433
179 3300048925 Ga0496122_0015575 Ga0496122_0015575_1582_2883 433
180 3300048926 Ga0496123_0002281 Ga0496123_0002281_14017_15318 433
181 3300048927 Ga0496124_0000090 Ga0496124_0000090_179411_180715 433
182 3300048928 Ga0496125_0000046 Ga0496125_0000046_279118_280461 433
183 3300049568 Ga0501031_0043332 Ga0501031_0043332_151_1452 433
184 3300049570 Ga0501033_0008956 Ga0501033_0008956_4450_5751 433
185 3300049571 Ga0501034_0009557 Ga0501034_0009557_1975_3285 433
186 3300049571 Ga0501034_0013703 Ga0501034_0013703_606_1916 433
187 3300049571 Ga0501034_0082754 Ga0501034_0082754_936_2237 433
188 3300049571 Ga0501034_0109778 Ga0501034_0109778_423_1733 433
189 3300049571 Ga0501034_0190873 Ga0501034_0190873_499_1800 433
190 3300049572 Ga0501036_0218873 Ga0501036_0218873_276_1577 433
191 3300049573 Ga0501037_0030393 Ga0501037_0030393_2330_3631 433
192 3300049573 Ga0501037_0043521 Ga0501037_0043521_999_2300 433
193 3300049574 Ga0501038_0088093 Ga0501038_0088093_1165_2466 433
194 3300049579 Ga0501043_0035581 Ga0501043_0035581_2306_3607 433
195 3300049579 Ga0501043_0045364 Ga0501043_0045364_411_1721 433
196 3300049579 Ga0501043_0101919 Ga0501043_0101919_778_2079 433
197 3300049579 Ga0501043_0130392 Ga0501043_0130392_105_1406 433
198 3300049580 Ga0501046_0141330 Ga0501046_0141330_498_1808 433
199 3300049581 Ga0501047_0037025 Ga0501047_0037025_1162_2472 433
200 3300049581 Ga0501047_0105006 Ga0501047_0105006_605_1906 433
201 3300049582 Ga0501048_0049175 Ga0501048_0049175_1576_2925 433
202 3300049582 Ga0501048_0124195 Ga0501048_0124195_187_1488 433
203 3300049586 Ga0501070_0001674 Ga0501070_0001674_3876_5177 433
204 3300049586 Ga0501070_0002327 Ga0501070_0002327_8710_10020 433
205 3300049589 Ga0501073_0000063 Ga0501073_0000063_15184_16485 433
206 3300049589 Ga0501073_0014271 Ga0501073_0014271_1722_3032 433
207 3300049742 Ga0501080_0000331 Ga0501080_0000331_19392_20702 433
208 3300049742 Ga0501080_0208647 Ga0501080_0208647_171_1481 433
209 3300049822 Ga0501035_0001926 Ga0501035_0001926_7151_8452 433
210 3300049822 Ga0501035_0032156 Ga0501035_0032156_2399_3748 433
211 3300049822 Ga0501035_0191515 Ga0501035_0191515_161_1462 433
212 3300049823 Ga0501044_0000521 Ga0501044_0000521_40268_41569 433
213 3300050491 nmdc:mga00v17_7302_c1 nmdc:mga00v17_7302_c1_737_2038 433
214 3300050492 nmdc:mga0yw44_1262_c1 nmdc:mga0yw44_1262_c1_7595_8896 433
215 3300050516 nmdc:mga0sz30_10808_c1 nmdc:mga0sz30_10808_c1_380_1681 433
216 3300053104 Ga0500556_0000527 Ga0500556_0000527_4622_5923 433
217 3300053108 Ga0500562_000180 Ga0500562_000180_3518_4819 433
218 3300053131 Ga0500652_039988 Ga0500652_039988_211_1512 433
219 3300053133 Ga0500655_001913 Ga0500655_001913_2447_3748 433
220 3300053136 Ga0500559_0000420 Ga0500559_0000420_4725_6026 433
221 3300053139 Ga0500568_0000007 Ga0500568_0000007_237201_238502 433
222 3300053139 Ga0500568_0000099 Ga0500568_0000099_39524_40825 433
223 3300053139 Ga0500568_0017214 Ga0500568_0017214_999_2309 433
224 3300053153 Ga0500616_0000807 Ga0500616_0000807_3174_4490 433
225 3300053153 Ga0500616_0015095 Ga0500616_0015095_2380_3681 433
226 iso_pu_bacteria 2643221572 2643877143 433
227 iso_pu_bacteria 2643221669 2644384198 433
228 iso_pu_bacteria 2811994880 2812363195 433
229 iso_pu_bacteria 2895660088 2895662070 433
230 3300005330 Ga0070690_100140798 Ga0070690_1001407981 434
231 3300005355 Ga0070671_100124005 Ga0070671_1001240053 434
232 3300005437 Ga0070710_10004155 Ga0070710_100041557 434
233 3300005841 Ga0068863_100052942 Ga0068863_1000529422 434
234 3300009101 Ga0105247_10065822 Ga0105247_100658222 434
235 3300009177 Ga0105248_10000897 Ga0105248_1000089724 434
236 3300009545 Ga0105237_10004763 Ga0105237_1000476316 434
237 3300014325 Ga0163163_10024492 Ga0163163_100244923 434
238 3300025914 Ga0207671_10003504 Ga0207671_1000350416 434
239 3300025931 Ga0207644_10194567 Ga0207644_101945672 434
240 3300025941 Ga0207711_10000405 Ga0207711_1000040524 434
241 3300026088 Ga0207641_10010075 Ga0207641_100100754 434
242 3300031649 Ga0307514_10064224 Ga0307514_100642242 434
243 3300031665 Ga0316575_10004568 Ga0316575_100045682 434
244 3300031691 Ga0316579_10012218 Ga0316579_100122182 434
245 3300031727 Ga0316576_10020994 Ga0316576_100209942 434
246 3300031728 Ga0316578_10012564 Ga0316578_100125642 434
247 3300031733 Ga0316577_10033601 Ga0316577_100336012 434
248 3300032137 Ga0316585_10000595 Ga0316585_100005952 434
249 3300044719 Ga0466971_0045389 Ga0466971_0045389_585_1901 434
250 3300044901 Ga0466960_0030605 Ga0466960_0030605_55_1371 434
251 3300046471 Ga0495650_0000211 Ga0495650_0000211_99937_101241 434
252 3300048907 Ga0496104_0024327 Ga0496104_0024327_518_1870 434
253 3300048911 Ga0496108_0086508 Ga0496108_0086508_1026_2378 434
254 3300048912 Ga0496109_0083919 Ga0496109_0083919_513_1865 434
255 3300048913 Ga0496110_0212364 Ga0496110_0212364_37_1389 434
256 3300048914 Ga0496111_0065854 Ga0496111_0065854_1040_2392 434
257 3300053087 Ga0500643_000124 Ga0500643_000124_51052_52356 434
258 3300053104 Ga0500556_0000008 Ga0500556_0000008_283327_284631 434
259 3300053136 Ga0500559_0001832 Ga0500559_0001832_8206_9510 434
260 3300053139 Ga0500568_0000003 Ga0500568_0000003_20312_21616 434
261 3300053140 Ga0500573_0000005 Ga0500573_0000005_132134_133438 434
262 iso_pu_bacteria 2643221549 2643767177 434
263 iso_pu_bacteria 2643221619 2644112888 434
264 iso_pu_bacteria 2721755702 2723644027 434
265 iso_pu_bacteria 2808606372 2808899906 434
266 iso_pu_bacteria 2844852863 2844853623 434
267 iso_pu_bacteria 2919443155 2919444697 434
268 iso_pu_bacteria 2935409751 2935412439 434
269 iso_pu_bacteria 8056037122 8056040419 434
270 iso_pu_bacteria 8057345674 8057346614 434
271 3300005367 Ga0070667_100021246 Ga0070667_1000212463 435
272 3300025986 Ga0207658_10013587 Ga0207658_100135875 435
273 iso_pu_bacteria 2862993130 2862994076 435
274 3300005355 Ga0070671_100030554 Ga0070671_1000305545 436
275 3300025931 Ga0207644_10131353 Ga0207644_101313531 436
276 3300044693 Ga0466961_0069532 Ga0466961_0069532_256_1569 436
277 3300049571 Ga0501034_0046452 Ga0501034_0046452_2462_3772 436
278 3300049571 Ga0501034_0083776 Ga0501034_0083776_1064_2377 436
279 3300049586 Ga0501070_0007555 Ga0501070_0007555_7713_9023 436
280 3300049587 Ga0501071_0044176 Ga0501071_0044176_1761_3071 436
281 3300053140 Ga0500573_0053983 Ga0500573_0053983_676_1986 436
282 iso_pu_bacteria 2643221616 2644097408 436
283 iso_pu_bacteria 2643221632 2644181837 436
284 iso_pu_bacteria 2884763398 2884767348 436
285 iso_pu_bacteria 2939657138 2939660478 436
286 3300046507 Ga0495606_0001892 Ga0495606_0001892_15090_16448 437
287 3300049570 Ga0501033_0006614 Ga0501033_0006614_6267_7580 437
288 3300049578 Ga0501042_0002934 Ga0501042_0002934_1548_2861 437
289 3300049579 Ga0501043_0105147 Ga0501043_0105147_479_1798 437
290 3300049581 Ga0501047_0095003 Ga0501047_0095003_1004_2317 437
291 3300049744 Ga0501083_0000990 Ga0501083_0000990_17084_18397 437
292 3300049744 Ga0501083_0008270 Ga0501083_0008270_4962_6281 437
293 3300053140 Ga0500573_0027563 Ga0500573_0027563_529_1845 437
294 iso_pu_bacteria 2844841374 2844844323 437
295 iso_pu_bacteria 2919055335 2919056272 437
296 iso_pu_bacteria 2919523602 2919526275 437
297 iso_pu_bacteria 2928153084 2928154407 437
298 iso_pu_bacteria 2964326757 2964327893 437
299 3300005347 Ga0070668_100138420 Ga0070668_1001384202 438
300 3300009148 Ga0105243_10029910 Ga0105243_100299102 438
301 3300009148 Ga0105243_10179369 Ga0105243_101793692 438
302 3300009553 Ga0105249_10054747 Ga0105249_100547473 438
303 3300014326 Ga0157380_10007733 Ga0157380_100077334 438
304 3300025935 Ga0207709_10013195 Ga0207709_100131953 438
305 3300048906 Ga0496103_0157371 Ga0496103_0157371_73_1422 438
306 3300048920 Ga0496117_0000669 Ga0496117_0000669_36745_38064 438
307 3300048922 Ga0496119_0039485 Ga0496119_0039485_1341_2660 438
308 3300048923 Ga0496120_0054834 Ga0496120_0054834_270_1589 438
309 3300048925 Ga0496122_0004413 Ga0496122_0004413_1393_2712 438
310 3300048926 Ga0496123_0026292 Ga0496123_0026292_936_2255 438
311 3300053140 Ga0500573_0004199 Ga0500573_0004199_6171_7493 438
312 3300053140 Ga0500573_0020760 Ga0500573_0020760_353_1669 438
313 3300053153 Ga0500616_0000010 Ga0500616_0000010_290628_291947 438
314 3300053730 Ga0500645_003342 Ga0500645_003342_4471_5790 438
315 iso_pu_bacteria 8046352972 8046354575 438
316 3300005288 Ga0065714_10009929 Ga0065714_100099293 439
317 3300005327 Ga0070658_10028821 Ga0070658_100288212 439
318 3300005327 Ga0070658_10041771 Ga0070658_100417713 439
319 3300005338 Ga0068868_100147288 Ga0068868_1001472882 439
320 3300005339 Ga0070660_100053744 Ga0070660_1000537442 439
321 3300005344 Ga0070661_100148731 Ga0070661_1001487311 439
322 3300005366 Ga0070659_100022248 Ga0070659_1000222484 439
323 3300005367 Ga0070667_100016686 Ga0070667_1000166862 439
324 3300005539 Ga0068853_100008802 Ga0068853_1000088026 439
325 3300005563 Ga0068855_100030061 Ga0068855_1000300617 439
326 3300005577 Ga0068857_100001906 Ga0068857_10000190610 439
327 3300005578 Ga0068854_100051018 Ga0068854_1000510183 439
328 3300005616 Ga0068852_100009235 Ga0068852_1000092353 439
329 3300005834 Ga0068851_10000053 Ga0068851_1000005365 439
330 3300005842 Ga0068858_100000176 Ga0068858_10000017614 439
331 3300009093 Ga0105240_10005148 Ga0105240_100051484 439
332 3300009093 Ga0105240_10153287 Ga0105240_101532873 439
333 3300009098 Ga0105245_10005554 Ga0105245_100055543 439
334 3300009174 Ga0105241_10000797 Ga0105241_1000079711 439
335 3300009545 Ga0105237_10006213 Ga0105237_100062138 439
336 3300009545 Ga0105237_10049224 Ga0105237_100492243 439
337 3300009551 Ga0105238_10000476 Ga0105238_1000047621 439
338 3300009551 Ga0105238_10183607 Ga0105238_101836072 439
339 3300009551 Ga0105238_10290028 Ga0105238_102900281 439
340 3300025254 Ga0209148_1001423 Ga0209148_10014234 439
341 3300025321 Ga0207656_10000001 Ga0207656_100000011148 439
342 3300025909 Ga0207705_10021403 Ga0207705_100214034 439
343 3300025909 Ga0207705_10025588 Ga0207705_100255883 439
344 3300025909 Ga0207705_10033057 Ga0207705_100330574 439
345 3300025911 Ga0207654_10000001 Ga0207654_10000001461 439
346 3300025913 Ga0207695_10002309 Ga0207695_1000230917 439
347 3300025913 Ga0207695_10056175 Ga0207695_100561753 439
348 3300025914 Ga0207671_10000001 Ga0207671_100000011147 439
349 3300025914 Ga0207671_10064899 Ga0207671_100648993 439
350 3300025919 Ga0207657_10030411 Ga0207657_100304114 439
351 3300025924 Ga0207694_10000019 Ga0207694_1000001954 439
352 3300025927 Ga0207687_10010330 Ga0207687_100103303 439
353 3300025927 Ga0207687_10023082 Ga0207687_100230821 439
354 3300025932 Ga0207690_10005324 Ga0207690_100053245 439
355 3300025949 Ga0207667_10000498 Ga0207667_100004982 439
356 3300025949 Ga0207667_10109863 Ga0207667_101098633 439
357 3300026035 Ga0207703_10000121 Ga0207703_1000012146 439
358 3300026078 Ga0207702_10015536 Ga0207702_100155364 439
359 3300026078 Ga0207702_10200770 Ga0207702_102007702 439
360 3300026116 Ga0207674_10018190 Ga0207674_100181902 439
361 3300026116 Ga0207674_10123332 Ga0207674_101233322 439
362 3300026142 Ga0207698_10000569 Ga0207698_100005697 439
363 3300026142 Ga0207698_10004534 Ga0207698_100045344 439
364 3300048920 Ga0496117_0021298 Ga0496117_0021298_1087_2406 439
365 3300048922 Ga0496119_0003472 Ga0496119_0003472_11980_13299 439
366 3300048923 Ga0496120_0001113 Ga0496120_0001113_26964_28283 439
367 3300048923 Ga0496120_0003581 Ga0496120_0003581_9228_10547 439
368 3300048923 Ga0496120_0023193 Ga0496120_0023193_1524_2843 439
369 3300048929 Ga0496126_0002342 Ga0496126_0002342_7558_8910 439
370 3300049570 Ga0501033_0007015 Ga0501033_0007015_3411_4730 439
371 3300049570 Ga0501033_0035165 Ga0501033_0035165_361_1680 439
372 3300049571 Ga0501034_0004667 Ga0501034_0004667_9740_11059 439
373 3300049572 Ga0501036_0184470 Ga0501036_0184470_54_1373 439
374 3300049578 Ga0501042_0095698 Ga0501042_0095698_438_1757 439
375 3300049579 Ga0501043_0139047 Ga0501043_0139047_48_1367 439
376 3300049581 Ga0501047_0091594 Ga0501047_0091594_1446_2765 439
377 3300049589 Ga0501073_0030405 Ga0501073_0030405_1340_2659 439
378 3300049822 Ga0501035_0032143 Ga0501035_0032143_617_1936 439
379 3300049823 Ga0501044_0017313 Ga0501044_0017313_60_1379 439
380 3300049823 Ga0501044_0071565 Ga0501044_0071565_1841_3160 439
381 3300053148 Ga0500590_001387 Ga0500590_001387_5145_6464 439
382 3300053155 Ga0500620_000266 Ga0500620_000266_3316_4635 439
383 3300002772 JGI25164J39214_1001499 JGI25164J39214_10014994 440
384 3300003214 JGI25165J46597_1000005 JGI25165J46597_1000005412 440
385 3300003760 Ga0055527_1000004 Ga0055527_1000004327 440
386 3300003762 Ga0055542_1000019 Ga0055542_1000019115 440
387 3300003763 Ga0055529_1000008 Ga0055529_1000008250 440
388 3300005337 Ga0070682_100111081 Ga0070682_1001110811 440
389 3300005366 Ga0070659_100097996 Ga0070659_1000979962 440
390 3300005563 Ga0068855_100045411 Ga0068855_1000454114 440
391 3300013102 Ga0157371_10005769 Ga0157371_100057697 440
392 3300013105 Ga0157369_10012548 Ga0157369_100125483 440
393 3300025228 Ga0209672_100011 Ga0209672_100011327 440
394 3300025229 Ga0209147_100289 Ga0209147_10028921 440
395 3300025231 Ga0207427_100024 Ga0207427_100024194 440
396 3300025233 Ga0209437_100243 Ga0209437_10024352 440
397 3300025254 Ga0209148_1000023 Ga0209148_1000023165 440
398 3300025261 Ga0209233_1000001 Ga0209233_1000001237 440
399 3300025272 Ga0209455_1000023 Ga0209455_1000023165 440
400 3300025904 Ga0207647_10002880 Ga0207647_100028805 440
401 3300025904 Ga0207647_10046832 Ga0207647_100468322 440
402 3300025909 Ga0207705_10000001 Ga0207705_100000011019 440
403 3300025919 Ga0207657_10037401 Ga0207657_100374014 440
404 3300025932 Ga0207690_10080573 Ga0207690_100805732 440
405 3300025949 Ga0207667_10029017 Ga0207667_100290174 440
406 3300037312 Ga0395899_0012368 Ga0395899_0012368_2988_4310 440
407 3300037418 Ga0395900_0000888 Ga0395900_0000888_27992_29314 440
408 3300037466 Ga0395898_0000355 Ga0395898_0000355_50388_51710 440
409 3300044901 Ga0466960_0089770 Ga0466960_0089770_173_1495 440
410 3300048906 Ga0496103_0056568 Ga0496103_0056568_605_1927 440
411 3300048908 Ga0496105_0026874 Ga0496105_0026874_2128_3450 440
412 3300048920 Ga0496117_0111557 Ga0496117_0111557_364_1686 440
413 3300048921 Ga0496118_0009039 Ga0496118_0009039_2846_4168 440
414 3300048923 Ga0496120_0020585 Ga0496120_0020585_2724_4046 440
415 3300049568 Ga0501031_0001529 Ga0501031_0001529_4119_5441 440
416 3300049569 Ga0501032_0001402 Ga0501032_0001402_13713_15035 440
417 3300049570 Ga0501033_0008041 Ga0501033_0008041_4685_6007 440
418 3300049572 Ga0501036_0016404 Ga0501036_0016404_183_1505 440
419 3300049573 Ga0501037_0002176 Ga0501037_0002176_3854_5176 440
420 3300049574 Ga0501038_0001027 Ga0501038_0001027_7821_9143 440
421 3300049575 Ga0501039_0011078 Ga0501039_0011078_797_2119 440
422 3300049580 Ga0501046_0002885 Ga0501046_0002885_13364_14686 440
423 3300049586 Ga0501070_0000269 Ga0501070_0000269_38739_40061 440
424 3300049586 Ga0501070_0061690 Ga0501070_0061690_1072_2394 440
425 3300049589 Ga0501073_0133429 Ga0501073_0133429_238_1560 440
426 3300049822 Ga0501035_0029068 Ga0501035_0029068_1782_3104 440
427 3300049823 Ga0501044_0016576 Ga0501044_0016576_3597_4919 440
428 3300049824 Ga0501045_0085474 Ga0501045_0085474_838_2160 440
429 3300053080 Ga0500635_0000066 Ga0500635_0000066_49787_51109 440
430 3300053140 Ga0500573_0023474 Ga0500573_0023474_1647_2975 440
431 3300053140 Ga0500573_0025369 Ga0500573_0025369_229_1557 440
432 3300053142 Ga0500577_0010271 Ga0500577_0010271_1186_2514 440
433 3300001979 JGI24740J21852_10013695 JGI24740J21852_100136952 441
434 3300001989 JGI24739J22299_10004756 JGI24739J22299_100047563 441
435 3300003756 Ga0055533_1000002 Ga0055533_1000002806 441
436 3300003759 Ga0055525_1000630 Ga0055525_100063016 441
437 3300013102 Ga0157371_10061626 Ga0157371_100616263 441
438 3300020081 Ga0206354_11255560 Ga0206354_112555604 441
439 3300020082 Ga0206353_11401675 Ga0206353_114016753 441
440 3300025225 Ga0209566_100056 Ga0209566_100056206 441
441 3300025226 Ga0209674_100001 Ga0209674_1000012760 441
442 3300025230 Ga0209563_100001 Ga0209563_1000012760 441
443 3300025230 Ga0209563_101759 Ga0209563_1017594 441
444 3300025253 Ga0209677_100001 Ga0209677_1000012760 441
445 3300025253 Ga0209677_100271 Ga0209677_10027119 441
446 3300025272 Ga0209455_1014271 Ga0209455_10142712 441
447 3300037312 Ga0395899_0027971 Ga0395899_0027971_2007_3332 441
448 3300038443 Ga0395901_0041409 Ga0395901_0041409_3229_4554 441
449 3300044658 Ga0466972_0005899 Ga0466972_0005899_954_2279 441
450 3300044693 Ga0466961_0037953 Ga0466961_0037953_1742_3067 441
451 3300044693 Ga0466961_0063183 Ga0466961_0063183_313_1638 441
452 3300045049 Ga0466959_0045659 Ga0466959_0045659_1155_2480 441
453 3300045836 Ga0466958_0050946 Ga0466958_0050946_351_1676 441
454 3300048916 Ga0496113_0166370 Ga0496113_0166370_203_1528 441
455 3300048920 Ga0496117_0069351 Ga0496117_0069351_196_1521 441

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

111

472

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vp4-assembly1.cif.gz_B crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution 0.9514 18 413
2z1y-assembly1.cif.gz_A crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27 0.9453 17 413
2zp7-assembly3.cif.gz_F crystal structure of lysn, alpha-aminoadipate aminotransferase (leucine complex), from thermus thermophilus hb27 0.9437 17 409
3av7-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products 0.9358 14 410
2z1y-assembly1.cif.gz_A crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27 0.9358 17 413
ID Description Score Start End Superfamily
2zc0A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9641 80 300 3.40.640.10
2z1yA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9586 306 413 3.90.1150.10
1vp4B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9517 80 303 3.40.640.10
2dtvA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9412 80 302 3.40.640.10
af_Q86AG8_30_465_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9411 80 413 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A6L6BRQ0-F1-model_v4 deleted 0.9823 24 415
AF-A0A6L6BRQ0-F1-model_v4 deleted 0.9701 24 415
AF-A0A7J9WHI1-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9683 29 419 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-R6RNU4-F1-model_v4 Putative phage DNA packaging protein 0.9644 109 409 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A0R1FTE0-F1-model_v4 Aminotransferase, class I II 0.9642 35 411 GO:0008483
GO:0009058
GO:0030170
GO:1901605

Feature Viewer

pLDDT pTM Quality
86.46 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map