F447527

General Info

Members Datasets Scaffolds Average Seq Length
455 258 910 392

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100001843|Ga0070706_1000018438
Length 439
Sequence VPSGAPEASGGYSMSSWRGLGLGRSGSAYGRAYGRLEPVRQARPGYDGRRPGGLMRPKTLWQRAVARQSLLRRFDWVLTAAVLGLSLVGVLLVWSATEHGLGQAGADPQTYLKKQLLNIVIGLILMASVSTLDYRTLRTYAPVAYALTSLGLLVVLSPVGSTVNGAHSWIALPGGFQTEPSEFAKVTLILMTAVILSELRDGDRRPRLRDLVAVLACGALPLGLVVAEPDLGVLILMVVMLAGVIALSGIRLRWLAGLGAVIGLVGLVTWGMHLLKPYQVQRLTAFINPSADPTGTGYSAAQAKIAVGSGGMFGQGLFHGSLVAGNFVPEQHTDFIFAVAGEELGFVGTITIVGLIAVLLIRSLRIAVRADDQFGLLVASGVTIWFAVQAFINIGMTIGITPVTGLPLPFVSYGGSAMFADMIAIGVLQAVHRRHSVFD

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
172 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
173 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
252 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
253 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
254 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
255 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
256 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
257 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
258 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0.66
Isolates 1.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 7.25
Rhizosphere 88.13
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100001843 3300005467 Bacteria 21945
2 JGI25406J46586_10008235 3300003203 Bacteria 4731
3 Ga0070658_10051118 3300005327 Bacteria 3349
4 Ga0070670_100010040 3300005331 Bacteria 8080
5 Ga0068869_100001939 3300005334 Bacteria 12410
6 Ga0070666_10008152 3300005335 Bacteria 6490
7 Ga0070680_100086086 3300005336 Bacteria 2597
8 Ga0070682_100056684 3300005337 Bacteria 2465
9 Ga0068868_100069059 3300005338 Bacteria 2815
10 Ga0070660_100059231 3300005339 Bacteria 2969
11 Ga0070691_10003845 3300005341 Bacteria 6782
12 Ga0070661_100066891 3300005344 Bacteria 2640
13 Ga0070675_100053088 3300005354 Bacteria 3333
14 Ga0070673_100037060 3300005364 Bacteria 3712
15 Ga0070667_100006322 3300005367 Bacteria 9845
16 Ga0070709_10002183 3300005434 Bacteria 10602
17 Ga0070709_10008907 3300005434 Bacteria 5525
18 Ga0070709_10079134 3300005434 Bacteria 2140
19 Ga0070714_100000064 3300005435 Bacteria 96578
20 Ga0070714_100004480 3300005435 Bacteria 10523
21 Ga0070714_100039718 3300005435 Bacteria 3962
22 Ga0070713_100002585 3300005436 Bacteria 11842
23 Ga0070713_100055545 3300005436 Bacteria 3291
24 Ga0070708_100021559 3300005445 Bacteria 5450
25 Ga0070708_100034748 3300005445 Bacteria 4387
26 Ga0070708_100041134 3300005445 Bacteria 4052
27 Ga0070708_100065424 3300005445 Bacteria 3260
28 Ga0070663_100019371 3300005455 Bacteria 4483
29 Ga0070678_100015859 3300005456 Bacteria 4801
30 Ga0070662_100210822 3300005457 Bacteria 1546
31 Ga0070681_10203905 3300005458 Bacteria 1895
32 Ga0070706_100001944 3300005467 Bacteria 21302
33 Ga0070706_100005821 3300005467 Bacteria 11701
34 Ga0070706_100029556 3300005467 Bacteria 5048
35 Ga0070706_100101584 3300005467 Bacteria 2673
36 Ga0070707_100001314 3300005468 Bacteria 24456
37 Ga0070707_100004490 3300005468 Bacteria 13072
38 Ga0070707_100010134 3300005468 Bacteria 8774
39 Ga0070707_100019721 3300005468 Bacteria 6356
40 Ga0070707_100020306 3300005468 Bacteria 6265
41 Ga0070707_100043190 3300005468 Bacteria 4315
42 Ga0070707_100048089 3300005468 Bacteria 4085
43 Ga0070707_100169626 3300005468 Bacteria 2127
44 Ga0070698_100000648 3300005471 Bacteria 37226
45 Ga0070698_100027922 3300005471 Bacteria 5862
46 Ga0070698_100073310 3300005471 Bacteria 3431
47 Ga0070699_100115988 3300005518 Bacteria 2353
48 Ga0070697_100137491 3300005536 Bacteria 2052
49 Ga0068853_100044843 3300005539 Bacteria 3786
50 Ga0070693_100011449 3300005547 Bacteria 4467
51 Ga0070665_100010752 3300005548 Bacteria 9260
52 Ga0068854_100013652 3300005578 Bacteria 5337
53 Ga0068856_100010121 3300005614 Bacteria 9165
54 Ga0068856_100015980 3300005614 Bacteria 7256
55 Ga0068856_100084519 3300005614 Bacteria 3153
56 Ga0068856_100224160 3300005614 Bacteria 1895
57 Ga0068859_100007906 3300005617 Bacteria 10788
58 Ga0068859_100021102 3300005617 Bacteria 6536
59 Ga0068864_100014859 3300005618 Bacteria 6469
60 Ga0068851_10004021 3300005834 Bacteria 6600
61 Ga0068870_10019888 3300005840 Bacteria 3262
62 Ga0068863_100000271 3300005841 Bacteria 53894
63 Ga0068863_100003639 3300005841 Bacteria 15224
64 Ga0068863_100013290 3300005841 Bacteria 7945
65 Ga0068858_100019060 3300005842 Bacteria 6419
66 Ga0068860_100000017 3300005843 Bacteria 307083
67 Ga0081538_10006437 3300005981 Bacteria 10339
68 Ga0081538_10015033 3300005981 Bacteria 6020
69 Ga0081540_1007731 3300005983 Bacteria 7615
70 Ga0081540_1036736 3300005983 Bacteria 2608
71 Ga0070717_10002384 3300006028 Bacteria 13249
72 Ga0070717_10042627 3300006028 Bacteria 3702
73 Ga0070717_10049117 3300006028 Bacteria 3463
74 Ga0075368_10006122 3300006042 Bacteria 4183
75 Ga0075363_100034079 3300006048 Unclassified 2656
76 Ga0075364_10052356 3300006051 Bacteria 2667
77 Ga0070715_10029416 3300006163 Bacteria 2212
78 Ga0070712_100017900 3300006175 Bacteria 4591
79 Ga0070712_100089284 3300006175 Bacteria 2254
80 Ga0070712_100195920 3300006175 Bacteria 1584
81 Ga0097621_100015307 3300006237 Bacteria 5769
82 Ga0068871_100062346 3300006358 Bacteria 3046
83 Ga0075431_100175320 3300006847 Bacteria 2202
84 Ga0075433_10116069 3300006852 Bacteria 2375
85 Ga0075434_100012470 3300006871 Bacteria 8062
86 Ga0075436_100005573 3300006914 Bacteria 8645
87 Ga0075436_100030195 3300006914 Bacteria 3730
88 Ga0097620_100007906 3300006931 Bacteria 10788
89 Ga0097620_100021103 3300006931 Bacteria 6536
90 Ga0075435_100028147 3300007076 Bacteria 4405
91 Ga0105251_10034762 3300009011 Bacteria 2491
92 Ga0105240_10213476 3300009093 Bacteria 2253
93 Ga0111539_10046574 3300009094 Bacteria 5186
94 Ga0105245_10118878 3300009098 Bacteria 2466
95 Ga0105245_10251658 3300009098 Bacteria 1717
96 Ga0105247_10014870 3300009101 Bacteria 4665
97 Ga0105247_10126574 3300009101 Bacteria 1661
98 Ga0114129_10005839 3300009147 Bacteria 17435
99 Ga0105241_10005492 3300009174 Bacteria 9373
100 Ga0105248_10143495 3300009177 Bacteria 2694
101 Ga0105237_10052534 3300009545 Bacteria 4090
102 Ga0105238_10209470 3300009551 Bacteria 1925
103 Ga0105246_10003852 3300011119 Bacteria 9098
104 Ga0157373_10085415 3300013100 Bacteria 2224
105 Ga0157371_10024052 3300013102 Bacteria 4450
106 Ga0157370_10108914 3300013104 Bacteria 2590
107 Ga0157369_10017433 3300013105 Bacteria 8069
108 Ga0157374_10194419 3300013296 Bacteria 1985
109 Ga0163163_10212338 3300014325 Bacteria 1984
110 Ga0157377_10018367 3300014745 Bacteria 3633
111 Ga0157379_10049738 3300014968 Bacteria 3743
112 Ga0157379_10096077 3300014968 Bacteria 2659
113 Ga0157379_10255610 3300014968 Bacteria 1591
114 Ga0157376_10012856 3300014969 Bacteria 6227
115 Ga0157376_10047789 3300014969 Bacteria 3535
116 Ga0206354_10112494 3300020081 Bacteria 2789
117 Ga0206353_11951871 3300020082 Bacteria 1458
118 Ga0213874_10010737 3300021377 Bacteria 2301
119 Ga0213876_10002700 3300021384 Bacteria 10340
120 Ga0224712_10000596 3300022467 Bacteria 7345
121 Ga0224572_1004611 3300024225 Bacteria 2410
122 Ga0207426_1005255 3300025302 Bacteria 5974
123 Ga0207692_10003711 3300025898 Bacteria 5993
124 Ga0207692_10008387 3300025898 Bacteria 4273
125 Ga0207692_10018829 3300025898 Bacteria 3107
126 Ga0207710_10010328 3300025900 Bacteria 3930
127 Ga0207688_10003287 3300025901 Bacteria 8830
128 Ga0207680_10001789 3300025903 Bacteria 10152
129 Ga0207685_10026306 3300025905 Bacteria 2022
130 Ga0207699_10002612 3300025906 Bacteria 8506
131 Ga0207699_10006193 3300025906 Bacteria 5770
132 Ga0207699_10012993 3300025906 Bacteria 4247
133 Ga0207699_10028241 3300025906 Bacteria 3116
134 Ga0207699_10041342 3300025906 Bacteria 2662
135 Ga0207643_10000112 3300025908 Bacteria 55805
136 Ga0207705_10014555 3300025909 Bacteria 5660
137 Ga0207684_10000628 3300025910 Bacteria 42093
138 Ga0207684_10002608 3300025910 Bacteria 18029
139 Ga0207684_10021839 3300025910 Bacteria 5463
140 Ga0207654_10009176 3300025911 Bacteria 5014
141 Ga0207707_10032041 3300025912 Bacteria 4601
142 Ga0207695_10258096 3300025913 Bacteria 1641
143 Ga0207693_10021212 3300025915 Bacteria 5163
144 Ga0207693_10045551 3300025915 Bacteria 3447
145 Ga0207693_10080433 3300025915 Bacteria 2551
146 Ga0207663_10006967 3300025916 Bacteria 5828
147 Ga0207663_10059297 3300025916 Bacteria 2420
148 Ga0207663_10115195 3300025916 Unclassified 1831
149 Ga0207660_10090564 3300025917 Bacteria 2266
150 Ga0207657_10010453 3300025919 Bacteria 9259
151 Ga0207649_10003278 3300025920 Bacteria 8861
152 Ga0207652_10011479 3300025921 Bacteria 7141
153 Ga0207646_10000325 3300025922 Bacteria 64667
154 Ga0207646_10000787 3300025922 Bacteria 41124
155 Ga0207646_10005720 3300025922 Bacteria 13041
156 Ga0207646_10020780 3300025922 Bacteria 6079
157 Ga0207646_10026148 3300025922 Bacteria 5330
158 Ga0207646_10031244 3300025922 Bacteria 4823
159 Ga0207646_10051443 3300025922 Bacteria 3686
160 Ga0207646_10173732 3300025922 Bacteria 1946
161 Ga0207646_10232309 3300025922 Bacteria 1666
162 Ga0207650_10006207 3300025925 Bacteria 8143
163 Ga0207700_10004407 3300025928 Bacteria 8296
164 Ga0207700_10030796 3300025928 Bacteria 3805
165 Ga0207700_10031569 3300025928 Bacteria 3765
166 Ga0207664_10000027 3300025929 Bacteria 190185
167 Ga0207664_10004678 3300025929 Bacteria 9287
168 Ga0207664_10026524 3300025929 Bacteria 4381
169 Ga0207664_10028279 3300025929 Bacteria 4259
170 Ga0207644_10019825 3300025931 Bacteria 4565
171 Ga0207706_10210717 3300025933 Bacteria 1703
172 Ga0207670_10008662 3300025936 Bacteria 5757
173 Ga0207665_10002920 3300025939 Bacteria 11453
174 Ga0207665_10005281 3300025939 Bacteria 8632
175 Ga0207665_10021930 3300025939 Bacteria 4200
176 Ga0207689_10000247 3300025942 Bacteria 48421
177 Ga0207679_10016578 3300025945 Bacteria 4896
178 Ga0207651_10008906 3300025960 Bacteria 5452
179 Ga0207668_10030220 3300025972 Bacteria 3559
180 Ga0207658_10023833 3300025986 Bacteria 4276
181 Ga0207677_10002957 3300026023 Bacteria 8979
182 Ga0207703_10011850 3300026035 Bacteria 6789
183 Ga0207703_10082069 3300026035 Bacteria 2689
184 Ga0207678_10002660 3300026067 Bacteria 16232
185 Ga0207678_10223978 3300026067 Bacteria 1610
186 Ga0207708_10015862 3300026075 Bacteria 5656
187 Ga0207702_10003223 3300026078 Bacteria 15072
188 Ga0207702_10017442 3300026078 Bacteria 5941
189 Ga0207702_10020215 3300026078 Bacteria 5515
190 Ga0207702_10044769 3300026078 Bacteria 3720
191 Ga0207702_10260004 3300026078 Bacteria 1634
192 Ga0207641_10000547 3300026088 Bacteria 42161
193 Ga0207641_10002930 3300026088 Bacteria 15444
194 Ga0207641_10026139 3300026088 Bacteria 4816
195 Ga0207648_10066138 3300026089 Bacteria 3152
196 Ga0207676_10001377 3300026095 Bacteria 18083
197 Ga0207674_10042770 3300026116 Bacteria 4676
198 Ga0207675_100075545 3300026118 Bacteria 3154
199 Ga0207683_10001767 3300026121 Bacteria 19129
200 Ga0207428_10011502 3300027907 Bacteria 7819
201 Ga0268266_10002626 3300028379 Bacteria 18973
202 Ga0268266_10029448 3300028379 Bacteria 4668
203 Ga0268265_10207492 3300028380 Bacteria 1705
204 Ga0268264_10000033 3300028381 Bacteria 404123
205 Ga0268264_10111170 3300028381 Bacteria 2400
206 Ga0265327_10031367 3300031251 Bacteria 2987
207 Ga0316579_10003887 3300031691 Bacteria 5887
208 Ga0316576_10133138 3300031727 Bacteria 1870
209 Ga0316578_10019095 3300031728 Bacteria 3767
210 Ga0316578_10119375 3300031728 Bacteria 1585
211 Ga0316577_10000199 3300031733 Bacteria 20061
212 Ga0307406_10188811 3300031901 Bacteria 1507
213 Ga0307406_10206577 3300031901 Unclassified 1450
214 Ga0307412_10080601 3300031911 Bacteria 2249
215 Ga0307409_100180358 3300031995 Bacteria 1869
216 Ga0307409_100382674 3300031995 Bacteria 1338
217 Ga0307416_100391192 3300032002 Unclassified 1424
218 Ga0307414_10047532 3300032004 Bacteria 2954
219 Ga0307411_10010096 3300032005 Bacteria 5012
220 Ga0307415_100009057 3300032126 Bacteria 5556
221 Ga0307415_100011244 3300032126 Bacteria 5113
222 Ga0373930_0003616 3300034816 Bacteria 2466
223 Ga0373938_0003643 3300034957 Bacteria 2538
224 Ga0373934_0000413 3300035086 Bacteria 14982
225 Ga0373940_0004874 3300035088 Bacteria 2866
226 Ga0373944_0037114 3300035089 Bacteria 1491
227 Ga0373949_0008787 3300035090 Bacteria 2211
228 Ga0373951_0021183 3300035091 Bacteria 1492
229 Ga0373923_0108706 3300035111 Bacteria 1229
230 Ga0373936_0001913 3300035113 Bacteria 7688
231 Ga0373939_0010770 3300035114 Bacteria 2295
232 Ga0373953_0000184 3300035117 Bacteria 16555
233 Ga0373953_0003838 3300035117 Bacteria 4731
234 Ga0373954_0031460 3300035118 Bacteria 2450
235 Ga0373954_0050264 3300035118 Bacteria 1956
236 Ga0373956_0000234 3300035119 Bacteria 22056
237 Ga0373957_0000078 3300035120 Bacteria 23295
238 Ga0373960_0032690 3300035121 Bacteria 1462
239 Ga0373943_0022223 3300035170 Bacteria 2937
240 Ga0373955_0000045 3300035172 Bacteria 48797
241 Ga0373955_0006666 3300035172 Bacteria 5268
242 Ga0373955_0009096 3300035172 Bacteria 4638
243 Ga0373942_0004048 3300035207 Bacteria 3420
244 Ga0373924_0013067 3300035410 Bacteria 3115
245 Ga0373924_0020827 3300035410 Bacteria 2552
246 Ga0373931_0089509 3300035691 Bacteria 1712
247 Ga0373935_0131636 3300035692 Bacteria 1681
248 Ga0373933_0000076 3300035724 Bacteria 61470
249 Ga0373933_0002022 3300035724 Bacteria 11667
250 Ga0373933_0005795 3300035724 Bacteria 6719
251 Ga0373933_0022492 3300035724 Bacteria 3591
252 Ga0373933_0032234 3300035724 Bacteria 3044
253 Ga0373947_0048816 3300035725 Bacteria 2540
254 Ga0373937_0000183 3300036401 Bacteria 61487
255 Ga0373937_0005456 3300036401 Bacteria 10890
256 Ga0373937_0081695 3300036401 Bacteria 2990
257 Ga0373937_0130463 3300036401 Bacteria 2347
258 Ga0373937_0155157 3300036401 Bacteria 2145
259 Ga0316582_0093846 3300036647 Unclassified 1979
260 Ga0316582_0122748 3300036647 Unclassified 1739
261 Ga0316584_0012092 3300036712 Bacteria 6080
262 Ga0316584_0031338 3300036712 Unclassified 3932
263 Ga0373925_0006614 3300037068 Bacteria 8519
264 Ga0373925_0006734 3300037068 Bacteria 8423
265 Ga0373925_0010243 3300037068 Bacteria 6802
266 Ga0373925_0144736 3300037068 Bacteria 1862
267 Ga0373925_0181417 3300037068 Bacteria 1666
268 Ga0395900_0070959 3300037418 Bacteria 3580
269 Ga0436364_0833483 3300037853 Bacteria 70774
270 Ga0436364_0990413 3300037853 Bacteria 2211
271 Ga0436364_1330548 3300037853 Bacteria 2922
272 Ga0436365_0299031 3300039437 Bacteria 1596
273 Ga0436365_0556697 3300039437 Bacteria 40854
274 Ga0439450_011224 3300042008 Bacteria 1750
275 Ga0439455_0003750 3300042012 Bacteria 2937
276 Ga0439463_010016 3300042016 Bacteria 2329
277 Ga0451577_0001424 3300042876 Bacteria 31902
278 Ga0466963_0024205 3300044694 Bacteria 3865
279 Ga0466963_0024616 3300044694 Bacteria 3832
280 Ga0466963_0050826 3300044694 Bacteria 2745
281 Ga0453684_0020435 3300044712 Bacteria 9986
282 Ga0453684_0039430 3300044712 Bacteria 6437
283 Ga0453684_0115646 3300044712 Bacteria 3250
284 Ga0453684_0523778 3300044712 Unclassified 1309
285 Ga0466957_0171517 3300044842 Unclassified 1413
286 Ga0466960_0009546 3300044901 Bacteria 4004
287 Ga0466960_0040068 3300044901 Bacteria 2213
288 Ga0466958_0040166 3300045836 Bacteria 2812
289 Ga0466967_0032828 3300045976 Bacteria 4388
290 Ga0495592_0000158 3300046454 Bacteria 59662
291 Ga0495592_0024039 3300046454 Bacteria 4634
292 Ga0495592_0072348 3300046454 Bacteria 2508
293 Ga0495592_0137117 3300046454 Bacteria 1705
294 Ga0495629_0007691 3300046459 Bacteria 7928
295 Ga0495629_0083769 3300046459 Bacteria 2225
296 Ga0495641_0054900 3300046461 Bacteria 1809
297 Ga0495651_0000101 3300046462 Bacteria 62279
298 Ga0495651_0006023 3300046462 Bacteria 9259
299 Ga0495651_0066018 3300046462 Bacteria 2762
300 Ga0495651_0146243 3300046462 Bacteria 1708
301 Ga0495653_0011293 3300046463 Bacteria 7299
302 Ga0495653_0013637 3300046463 Bacteria 6624
303 Ga0495653_0035138 3300046463 Bacteria 3957
304 Ga0495653_0123070 3300046463 Bacteria 1845
305 Ga0495580_0068593 3300046472 Bacteria 2479
306 Ga0495582_0019448 3300046473 Bacteria 3713
307 Ga0495639_0057948 3300046475 Bacteria 1770
308 Ga0495664_0013931 3300046477 Bacteria 4556
309 Ga0495664_0026245 3300046477 Bacteria 3393
310 Ga0495664_0041986 3300046477 Bacteria 2707
311 Ga0495664_0060703 3300046477 Bacteria 2251
312 Ga0495664_0075375 3300046477 Bacteria 2018
313 Ga0495608_0000099 3300046511 Bacteria 61951
314 Ga0495608_0005986 3300046511 Bacteria 8649
315 Ga0495608_0061701 3300046511 Bacteria 2464
316 Ga0495618_0025395 3300046514 Bacteria 3676
317 Ga0495618_0029182 3300046514 Bacteria 3440
318 Ga0495628_0001746 3300046516 Bacteria 19773
319 Ga0495628_0012516 3300046516 Bacteria 7150
320 Ga0495628_0075955 3300046516 Bacteria 2615
321 Ga0495643_0107405 3300046522 Bacteria 1423
322 Ga0495666_0030929 3300046526 Bacteria 2625
323 Ga0495652_0000214 3300046529 Bacteria 66835
324 Ga0495652_0009396 3300046529 Bacteria 8888
325 Ga0495652_0034675 3300046529 Bacteria 4397
326 Ga0495652_0094543 3300046529 Bacteria 2437
327 Ga0495640_0032223 3300046533 Bacteria 3734
328 Ga0495640_0059179 3300046533 Bacteria 2610
329 Ga0495640_0101957 3300046533 Bacteria 1883
330 Ga0495586_0043921 3300046535 Bacteria 2406
331 Ga0495587_0000108 3300046536 Bacteria 62874
332 Ga0495587_0007326 3300046536 Bacteria 7152
333 Ga0495587_0022044 3300046536 Bacteria 3924
334 Ga0495587_0062379 3300046536 Bacteria 2182
335 Ga0495645_0052940 3300046543 Bacteria 2951
336 Ga0495667_0000102 3300046559 Bacteria 61487
337 Ga0495667_0004532 3300046559 Bacteria 9377
338 Ga0495667_0061123 3300046559 Bacteria 2470
339 Ga0495667_0061325 3300046559 Bacteria 2465
340 Ga0495667_0116675 3300046559 Bacteria 1724
341 Ga0495634_0016352 3300046642 Bacteria 5306
342 Ga0495634_0037303 3300046642 Bacteria 3321
343 Ga0495635_0002343 3300046663 Bacteria 12879
344 Ga0495635_0122209 3300046663 Bacteria 1775
345 Ga0495657_0000311 3300046675 Bacteria 44641
346 Ga0495657_0020337 3300046675 Bacteria 4772
347 Ga0495657_0055468 3300046675 Bacteria 2642
348 Ga0495599_0000275 3300046678 Bacteria 31815
349 Ga0495599_0015260 3300046678 Bacteria 4765
350 Ga0495599_0030172 3300046678 Bacteria 3400
351 Ga0495599_0035048 3300046678 Bacteria 3151
352 Ga0495599_0073946 3300046678 Bacteria 2127
353 Ga0495623_0000402 3300046679 Bacteria 28670
354 Ga0495623_0008752 3300046679 Bacteria 6572
355 Ga0495623_0031151 3300046679 Bacteria 3430
356 Ga0495623_0067340 3300046679 Bacteria 2235
357 Ga0495646_0002481 3300046680 Bacteria 11327
358 Ga0495646_0019828 3300046680 Bacteria 4252
359 Ga0495658_0024057 3300046683 Bacteria 3239
360 Ga0495613_0217637 3300046689 Bacteria 1341
361 Ga0495624_0064912 3300046690 Bacteria 2281
362 Ga0495600_0051955 3300046809 Bacteria 2675
363 Ga0495600_0059307 3300046809 Bacteria 2499
364 Ga0495600_0098261 3300046809 Bacteria 1908
365 Ga0495604_0000096 3300047317 Bacteria 75336
366 Ga0495604_0006737 3300047317 Bacteria 9107
367 Ga0495604_0013083 3300047317 Bacteria 6611
368 Ga0495604_0059188 3300047317 Bacteria 2938
369 Ga0495674_0004732 3300047319 Bacteria 13086
370 Ga0495674_0020879 3300047319 Bacteria 6063
371 Ga0495674_0065235 3300047319 Bacteria 3163
372 Ga0495674_0152300 3300047319 Bacteria 1938
373 Ga0495680_0000493 3300047322 Bacteria 44550
374 Ga0495680_0012970 3300047322 Bacteria 7296
375 Ga0495680_0020562 3300047322 Bacteria 5548
376 Ga0495680_0034622 3300047322 Bacteria 4075
377 Ga0495680_0055931 3300047322 Bacteria 3057
378 Ga0495680_0068751 3300047322 Bacteria 2704
379 Ga0495680_0081130 3300047322 Bacteria 2449
380 Ga0495675_0011035 3300047444 Bacteria 5664
381 Ga0495675_0019126 3300047444 Bacteria 4351
382 Ga0495675_0021125 3300047444 Bacteria 4143
383 Ga0495675_0053888 3300047444 Bacteria 2552
384 Ga0495684_0073726 3300047471 Bacteria 2593
385 Ga0495684_0125499 3300047471 Bacteria 1931
386 Ga0495593_0025052 3300047673 Bacteria 3301
387 Ga0495602_0000165 3300048088 Bacteria 61487
388 Ga0495602_0023622 3300048088 Bacteria 5986
389 Ga0495602_0027141 3300048088 Bacteria 5511
390 Ga0495602_0072926 3300048088 Bacteria 2924
391 Ga0495614_0076994 3300048089 Bacteria 1442
392 Ga0495626_0050349 3300048091 Unclassified 1925
393 Ga0496100_0075358 3300048903 Bacteria 2262
394 Ga0496100_0201359 3300048903 Bacteria 1451
395 Ga0496101_0026404 3300048904 Bacteria 4038
396 Ga0496102_0003763 3300048905 Bacteria 12830
397 Ga0496103_0037565 3300048906 Bacteria 2968
398 Ga0496104_0000911 3300048907 Bacteria 25347
399 Ga0496104_0002980 3300048907 Bacteria 14590
400 Ga0496104_0148747 3300048907 Bacteria 2248
401 Ga0496105_0000492 3300048908 Bacteria 26022
402 Ga0496105_0004192 3300048908 Bacteria 10826
403 Ga0496106_0003272 3300048909 Bacteria 12106
404 Ga0496106_0032352 3300048909 Bacteria 3899
405 Ga0496108_0017546 3300048911 Bacteria 5857
406 Ga0496108_0021047 3300048911 Bacteria 5359
407 Ga0496108_0099117 3300048911 Bacteria 2483
408 Ga0496109_0007169 3300048912 Bacteria 9421
409 Ga0496109_0087453 3300048912 Bacteria 2878
410 Ga0496109_0237857 3300048912 Bacteria 1713
411 Ga0496110_0004072 3300048913 Bacteria 11279
412 Ga0496110_0030906 3300048913 Bacteria 4619
413 Ga0496110_0078404 3300048913 Bacteria 2941
414 Ga0496111_0004766 3300048914 Bacteria 8604
415 Ga0496111_0178198 3300048914 Bacteria 1580
416 Ga0496112_0000486 3300048915 Bacteria 26671
417 Ga0496112_0161096 3300048915 Bacteria 2210
418 Ga0496112_0221807 3300048915 Bacteria 1846
419 Ga0496113_0012389 3300048916 Bacteria 5730
420 Ga0496113_0024204 3300048916 Bacteria 4312
421 Ga0496113_0070128 3300048916 Bacteria 2663
422 Ga0496114_0013737 3300048917 Bacteria 6491
423 Ga0496114_0072221 3300048917 Bacteria 2902
424 Ga0496115_0013584 3300048918 Bacteria 6162
425 Ga0496115_0025450 3300048918 Bacteria 4607
426 Ga0496126_0000396 3300048929 Bacteria 89557
427 Ga0496126_0185337 3300048929 Bacteria 1765
428 Ga0501298_023067 3300049521 Bacteria 1177
429 Ga0501042_0014947 3300049578 Bacteria 5307
430 nmdc:mga06z11_101444_c1 3300050494 Bacteria 1580
431 nmdc:mga05p37_145673_c1 3300050507 Bacteria 2901
432 nmdc:mga08y16_81493_c1 3300050511 Bacteria 3374
433 nmdc:mga0n895_23570_c1 3300050512 Bacteria 5787
434 nmdc:mga0n895_282553_c1 3300050512 Bacteria 1683
435 nmdc:mga0rr50_2965_c1 3300050513 Bacteria 9710
436 nmdc:mga08x19_54640_c1 3300050514 Bacteria 2572
437 nmdc:mga08x19_5872_c1 3300050514 Bacteria 7261
438 nmdc:mga0a205_3011_c1 3300050515 Bacteria 14933
439 Ga0495601_0078760 3300053077 Bacteria 2112
440 Ga0495612_0008534 3300053078 Bacteria 4156
441 Ga0495612_0046086 3300053078 Bacteria 1785
442 Ga0495595_0000557 3300053084 Bacteria 14264
443 Ga0495595_0028040 3300053084 Bacteria 2512
444 Ga0495595_0039509 3300053084 Bacteria 2153
445 Ga0495619_0043010 3300053085 Bacteria 2960
446 Ga0500616_0027077 3300053153 Bacteria 3168
447 Ga0590071_002827 3300059421 Bacteria 4349
448 2676496512 2675903060 Bacteria 10051191
449 2745169818 2744054657 Bacteria 5016802
450 2817617512 2816332336 Bacteria 5207640
451 2884701809 2884693830 Bacteria 11273186
452 2895439081 2895427314 Bacteria 13147766
453 2895446509 2895442618 Bacteria 11027144
454 3002998753 3002998708 Bacteria 11715108
455 8053950194 8053945823 Bacteria 8962862
456 Ga0070706_100001843
457 JGI25406J46586_10008235
458 Ga0070658_10051118
459 Ga0070670_100010040
460 Ga0068869_100001939
461 Ga0070666_10008152
462 Ga0070680_100086086
463 Ga0070682_100056684
464 Ga0068868_100069059
465 Ga0070660_100059231
466 Ga0070691_10003845
467 Ga0070661_100066891
468 Ga0070675_100053088
469 Ga0070673_100037060
470 Ga0070667_100006322
471 Ga0070709_10002183
472 Ga0070709_10008907
473 Ga0070709_10079134
474 Ga0070714_100000064
475 Ga0070714_100004480
476 Ga0070714_100039718
477 Ga0070713_100002585
478 Ga0070713_100055545
479 Ga0070708_100021559
480 Ga0070708_100034748
481 Ga0070708_100041134
482 Ga0070708_100065424
483 Ga0070663_100019371
484 Ga0070678_100015859
485 Ga0070662_100210822
486 Ga0070681_10203905
487 Ga0070706_100001944
488 Ga0070706_100005821
489 Ga0070706_100029556
490 Ga0070706_100101584
491 Ga0070707_100001314
492 Ga0070707_100004490
493 Ga0070707_100010134
494 Ga0070707_100019721
495 Ga0070707_100020306
496 Ga0070707_100043190
497 Ga0070707_100048089
498 Ga0070707_100169626
499 Ga0070698_100000648
500 Ga0070698_100027922
501 Ga0070698_100073310
502 Ga0070699_100115988
503 Ga0070697_100137491
504 Ga0068853_100044843
505 Ga0070693_100011449
506 Ga0070665_100010752
507 Ga0068854_100013652
508 Ga0068856_100010121
509 Ga0068856_100015980
510 Ga0068856_100084519
511 Ga0068856_100224160
512 Ga0068859_100007906
513 Ga0068859_100021102
514 Ga0068864_100014859
515 Ga0068851_10004021
516 Ga0068870_10019888
517 Ga0068863_100000271
518 Ga0068863_100003639
519 Ga0068863_100013290
520 Ga0068858_100019060
521 Ga0068860_100000017
522 Ga0081538_10006437
523 Ga0081538_10015033
524 Ga0081540_1007731
525 Ga0081540_1036736
526 Ga0070717_10002384
527 Ga0070717_10042627
528 Ga0070717_10049117
529 Ga0075368_10006122
530 Ga0075363_100034079
531 Ga0075364_10052356
532 Ga0070715_10029416
533 Ga0070712_100017900
534 Ga0070712_100089284
535 Ga0070712_100195920
536 Ga0097621_100015307
537 Ga0068871_100062346
538 Ga0075431_100175320
539 Ga0075433_10116069
540 Ga0075434_100012470
541 Ga0075436_100005573
542 Ga0075436_100030195
543 Ga0097620_100007906
544 Ga0097620_100021103
545 Ga0075435_100028147
546 Ga0105251_10034762
547 Ga0105240_10213476
548 Ga0111539_10046574
549 Ga0105245_10118878
550 Ga0105245_10251658
551 Ga0105247_10014870
552 Ga0105247_10126574
553 Ga0114129_10005839
554 Ga0105241_10005492
555 Ga0105248_10143495
556 Ga0105237_10052534
557 Ga0105238_10209470
558 Ga0105246_10003852
559 Ga0157373_10085415
560 Ga0157371_10024052
561 Ga0157370_10108914
562 Ga0157369_10017433
563 Ga0157374_10194419
564 Ga0163163_10212338
565 Ga0157377_10018367
566 Ga0157379_10049738
567 Ga0157379_10096077
568 Ga0157379_10255610
569 Ga0157376_10012856
570 Ga0157376_10047789
571 Ga0206354_10112494
572 Ga0206353_11951871
573 Ga0213874_10010737
574 Ga0213876_10002700
575 Ga0224712_10000596
576 Ga0224572_1004611
577 Ga0207426_1005255
578 Ga0207692_10003711
579 Ga0207692_10008387
580 Ga0207692_10018829
581 Ga0207710_10010328
582 Ga0207688_10003287
583 Ga0207680_10001789
584 Ga0207685_10026306
585 Ga0207699_10002612
586 Ga0207699_10006193
587 Ga0207699_10012993
588 Ga0207699_10028241
589 Ga0207699_10041342
590 Ga0207643_10000112
591 Ga0207705_10014555
592 Ga0207684_10000628
593 Ga0207684_10002608
594 Ga0207684_10021839
595 Ga0207654_10009176
596 Ga0207707_10032041
597 Ga0207695_10258096
598 Ga0207693_10021212
599 Ga0207693_10045551
600 Ga0207693_10080433
601 Ga0207663_10006967
602 Ga0207663_10059297
603 Ga0207663_10115195
604 Ga0207660_10090564
605 Ga0207657_10010453
606 Ga0207649_10003278
607 Ga0207652_10011479
608 Ga0207646_10000325
609 Ga0207646_10000787
610 Ga0207646_10005720
611 Ga0207646_10020780
612 Ga0207646_10026148
613 Ga0207646_10031244
614 Ga0207646_10051443
615 Ga0207646_10173732
616 Ga0207646_10232309
617 Ga0207650_10006207
618 Ga0207700_10004407
619 Ga0207700_10030796
620 Ga0207700_10031569
621 Ga0207664_10000027
622 Ga0207664_10004678
623 Ga0207664_10026524
624 Ga0207664_10028279
625 Ga0207644_10019825
626 Ga0207706_10210717
627 Ga0207670_10008662
628 Ga0207665_10002920
629 Ga0207665_10005281
630 Ga0207665_10021930
631 Ga0207689_10000247
632 Ga0207679_10016578
633 Ga0207651_10008906
634 Ga0207668_10030220
635 Ga0207658_10023833
636 Ga0207677_10002957
637 Ga0207703_10011850
638 Ga0207703_10082069
639 Ga0207678_10002660
640 Ga0207678_10223978
641 Ga0207708_10015862
642 Ga0207702_10003223
643 Ga0207702_10017442
644 Ga0207702_10020215
645 Ga0207702_10044769
646 Ga0207702_10260004
647 Ga0207641_10000547
648 Ga0207641_10002930
649 Ga0207641_10026139
650 Ga0207648_10066138
651 Ga0207676_10001377
652 Ga0207674_10042770
653 Ga0207675_100075545
654 Ga0207683_10001767
655 Ga0207428_10011502
656 Ga0268266_10002626
657 Ga0268266_10029448
658 Ga0268265_10207492
659 Ga0268264_10000033
660 Ga0268264_10111170
661 Ga0265327_10031367
662 Ga0316579_10003887
663 Ga0316576_10133138
664 Ga0316578_10019095
665 Ga0316578_10119375
666 Ga0316577_10000199
667 Ga0307406_10188811
668 Ga0307406_10206577
669 Ga0307412_10080601
670 Ga0307409_100180358
671 Ga0307409_100382674
672 Ga0307416_100391192
673 Ga0307414_10047532
674 Ga0307411_10010096
675 Ga0307415_100009057
676 Ga0307415_100011244
677 Ga0373930_0003616
678 Ga0373938_0003643
679 Ga0373934_0000413
680 Ga0373940_0004874
681 Ga0373944_0037114
682 Ga0373949_0008787
683 Ga0373951_0021183
684 Ga0373923_0108706
685 Ga0373936_0001913
686 Ga0373939_0010770
687 Ga0373953_0000184
688 Ga0373953_0003838
689 Ga0373954_0031460
690 Ga0373954_0050264
691 Ga0373956_0000234
692 Ga0373957_0000078
693 Ga0373960_0032690
694 Ga0373943_0022223
695 Ga0373955_0000045
696 Ga0373955_0006666
697 Ga0373955_0009096
698 Ga0373942_0004048
699 Ga0373924_0013067
700 Ga0373924_0020827
701 Ga0373931_0089509
702 Ga0373935_0131636
703 Ga0373933_0000076
704 Ga0373933_0002022
705 Ga0373933_0005795
706 Ga0373933_0022492
707 Ga0373933_0032234
708 Ga0373947_0048816
709 Ga0373937_0000183
710 Ga0373937_0005456
711 Ga0373937_0081695
712 Ga0373937_0130463
713 Ga0373937_0155157
714 Ga0316582_0093846
715 Ga0316582_0122748
716 Ga0316584_0012092
717 Ga0316584_0031338
718 Ga0373925_0006614
719 Ga0373925_0006734
720 Ga0373925_0010243
721 Ga0373925_0144736
722 Ga0373925_0181417
723 Ga0395900_0070959
724 Ga0436364_0833483
725 Ga0436364_0990413
726 Ga0436364_1330548
727 Ga0436365_0299031
728 Ga0436365_0556697
729 Ga0439450_011224
730 Ga0439455_0003750
731 Ga0439463_010016
732 Ga0451577_0001424
733 Ga0466963_0024205
734 Ga0466963_0024616
735 Ga0466963_0050826
736 Ga0453684_0020435
737 Ga0453684_0039430
738 Ga0453684_0115646
739 Ga0453684_0523778
740 Ga0466957_0171517
741 Ga0466960_0009546
742 Ga0466960_0040068
743 Ga0466958_0040166
744 Ga0466967_0032828
745 Ga0495592_0000158
746 Ga0495592_0024039
747 Ga0495592_0072348
748 Ga0495592_0137117
749 Ga0495629_0007691
750 Ga0495629_0083769
751 Ga0495641_0054900
752 Ga0495651_0000101
753 Ga0495651_0006023
754 Ga0495651_0066018
755 Ga0495651_0146243
756 Ga0495653_0011293
757 Ga0495653_0013637
758 Ga0495653_0035138
759 Ga0495653_0123070
760 Ga0495580_0068593
761 Ga0495582_0019448
762 Ga0495639_0057948
763 Ga0495664_0013931
764 Ga0495664_0026245
765 Ga0495664_0041986
766 Ga0495664_0060703
767 Ga0495664_0075375
768 Ga0495608_0000099
769 Ga0495608_0005986
770 Ga0495608_0061701
771 Ga0495618_0025395
772 Ga0495618_0029182
773 Ga0495628_0001746
774 Ga0495628_0012516
775 Ga0495628_0075955
776 Ga0495643_0107405
777 Ga0495666_0030929
778 Ga0495652_0000214
779 Ga0495652_0009396
780 Ga0495652_0034675
781 Ga0495652_0094543
782 Ga0495640_0032223
783 Ga0495640_0059179
784 Ga0495640_0101957
785 Ga0495586_0043921
786 Ga0495587_0000108
787 Ga0495587_0007326
788 Ga0495587_0022044
789 Ga0495587_0062379
790 Ga0495645_0052940
791 Ga0495667_0000102
792 Ga0495667_0004532
793 Ga0495667_0061123
794 Ga0495667_0061325
795 Ga0495667_0116675
796 Ga0495634_0016352
797 Ga0495634_0037303
798 Ga0495635_0002343
799 Ga0495635_0122209
800 Ga0495657_0000311
801 Ga0495657_0020337
802 Ga0495657_0055468
803 Ga0495599_0000275
804 Ga0495599_0015260
805 Ga0495599_0030172
806 Ga0495599_0035048
807 Ga0495599_0073946
808 Ga0495623_0000402
809 Ga0495623_0008752
810 Ga0495623_0031151
811 Ga0495623_0067340
812 Ga0495646_0002481
813 Ga0495646_0019828
814 Ga0495658_0024057
815 Ga0495613_0217637
816 Ga0495624_0064912
817 Ga0495600_0051955
818 Ga0495600_0059307
819 Ga0495600_0098261
820 Ga0495604_0000096
821 Ga0495604_0006737
822 Ga0495604_0013083
823 Ga0495604_0059188
824 Ga0495674_0004732
825 Ga0495674_0020879
826 Ga0495674_0065235
827 Ga0495674_0152300
828 Ga0495680_0000493
829 Ga0495680_0012970
830 Ga0495680_0020562
831 Ga0495680_0034622
832 Ga0495680_0055931
833 Ga0495680_0068751
834 Ga0495680_0081130
835 Ga0495675_0011035
836 Ga0495675_0019126
837 Ga0495675_0021125
838 Ga0495675_0053888
839 Ga0495684_0073726
840 Ga0495684_0125499
841 Ga0495593_0025052
842 Ga0495602_0000165
843 Ga0495602_0023622
844 Ga0495602_0027141
845 Ga0495602_0072926
846 Ga0495614_0076994
847 Ga0495626_0050349
848 Ga0496100_0075358
849 Ga0496100_0201359
850 Ga0496101_0026404
851 Ga0496102_0003763
852 Ga0496103_0037565
853 Ga0496104_0000911
854 Ga0496104_0002980
855 Ga0496104_0148747
856 Ga0496105_0000492
857 Ga0496105_0004192
858 Ga0496106_0003272
859 Ga0496106_0032352
860 Ga0496108_0017546
861 Ga0496108_0021047
862 Ga0496108_0099117
863 Ga0496109_0007169
864 Ga0496109_0087453
865 Ga0496109_0237857
866 Ga0496110_0004072
867 Ga0496110_0030906
868 Ga0496110_0078404
869 Ga0496111_0004766
870 Ga0496111_0178198
871 Ga0496112_0000486
872 Ga0496112_0161096
873 Ga0496112_0221807
874 Ga0496113_0012389
875 Ga0496113_0024204
876 Ga0496113_0070128
877 Ga0496114_0013737
878 Ga0496114_0072221
879 Ga0496115_0013584
880 Ga0496115_0025450
881 Ga0496126_0000396
882 Ga0496126_0185337
883 Ga0501298_023067
884 Ga0501042_0014947
885 nmdc:mga06z11_101444_c1
886 nmdc:mga05p37_145673_c1
887 nmdc:mga08y16_81493_c1
888 nmdc:mga0n895_23570_c1
889 nmdc:mga0n895_282553_c1
890 nmdc:mga0rr50_2965_c1
891 nmdc:mga08x19_54640_c1
892 nmdc:mga08x19_5872_c1
893 nmdc:mga0a205_3011_c1
894 Ga0495601_0078760
895 Ga0495612_0008534
896 Ga0495612_0046086
897 Ga0495595_0000557
898 Ga0495595_0028040
899 Ga0495595_0039509
900 Ga0495619_0043010
901 Ga0500616_0027077
902 Ga0590071_002827
903 2676496512
904 2745169818
905 2817617512
906 2884701809
907 2895439081
908 2895446509
909 3002998753
910 8053950194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

75

437

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.8955 25 386
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8935 19 380
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.8882 22 383
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.8881 25 386
6pl5-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.8826 22 380
ID Description Score Start End Superfamily
af_K7MBN0_417_531_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3349 77 185 1.20.140.150
af_K7MBN0_417_531_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3194 77 185 1.20.140.150
af_P71830_8_201_1.10.357.10 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.3126 26 191 1.10.357.10
4iggA06 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.2998 224 395 1.20.120.230
af_P71830_8_201_1.10.357.10 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.2775 26 191 1.10.357.10
ID Description Score Start End GO Terms
AF-A0A5B8U9I7-F1-model_v4 peptidoglycan glycosyltransferase (EC 2.4.99.28) 0.9835 22 391 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555
AF-A0A7V9Q1E0-F1-model_v4 peptidoglycan glycosyltransferase (EC 2.4.99.28) 0.9815 54 393 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555
AF-A0A7W1LEZ9-F1-model_v4 Rod shape-determining protein RodA 0.9807 106 388 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A7V8W9A5-F1-model_v4 peptidoglycan glycosyltransferase (EC 2.4.99.28) 0.9798 20 391 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555
AF-A0A537TP45-F1-model_v4 peptidoglycan glycosyltransferase (EC 2.4.99.28) 0.9787 20 388 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555

Map