metagRoot

F447473

General Info

Members	Datasets	Scaffolds	Average Seq Length
454	320	326	275

Family's Representative Sequence

Representative Sequence	3300053125\|Ga0500618_000393\|Ga0500618_000393_3278_4195
Length	305
Sequence	MTGPMSGATVRGPRDIIRIEDADDPRIADFHAIRERDLTGRHGRFIAEGTVVLRMLAAAHRRSVAGKGDGEGMAMDASRRGSTGFTAEKILLLENRASGVSDILDDFPEDVPVYLASGPVLDLIAGFHLHRGVLALGRRIEEIEAAQLIARSPEKGLIVAAFGISNHDNIGSIFRNAAAFGADAVLLDSQCCDPLYRKALRVSVGSVLSVPYARGGTAGDLLSALSGHGFAIWGLSPAGETEIRHVPADDRMALITGTEGEGLSTDVLSSVKTARIAQAPGLDSLNAGTATGIALYEIAMAQGRL

Samples

	Sample ID	Description	Type	Environment
1	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
2	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
3	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
4	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
5	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
6	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
7	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
8	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
9	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
10	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
11	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
12	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
13	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
14	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
15	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
16	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
17	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
18	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
19	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
20	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
21	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
22	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
23	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
24	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
25	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
26	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
27	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
28	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
29	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
30	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
31	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
32	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
33	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
34	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
35	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
36	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
37	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
38	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
39	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
40	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
41	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
42	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
43	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
44	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
45	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
46	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
47	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
48	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
49	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
50	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
51	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
52	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
53	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
54	2818991461	Neorhizobium alkalisoli 1225	Isolate	Unclassified
55	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
56	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
57	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
58	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
59	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
60	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
61	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
62	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
63	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
64	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
65	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
66	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
67	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
68	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
69	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
70	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
71	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
72	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
73	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
74	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
75	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
76	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
77	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
78	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
79	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
80	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
81	2854896431	Neorhizobium alkalisoli DSM 21826	Isolate	Unclassified
82	2854916844	Neorhizobium huautlense DSM 21817	Isolate	Unclassified
83	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
84	2899792073	Agrobacterium deltaense CNPSo 3391	Isolate	Nodule
85	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
86	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
87	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
88	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
89	2919171160	Neorhizobium sp. 2083	Isolate	Unclassified
90	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
91	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
92	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
93	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
94	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
95	2933011516	Rhizobium sp. SEMIA 4032	Isolate	Unclassified
96	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
97	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
98	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
99	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
100	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
101	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
102	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
103	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
104	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
105	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
106	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
107	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
108	2996887358	Rhizobium sp. R711	Isolate	Nodule
109	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
110	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
111	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
112	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
113	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
114	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
115	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
116	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
117	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
118	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
119	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
120	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
121	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
122	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
123	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
124	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
125	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
126	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
127	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
128	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
129	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
130	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
131	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
132	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
133	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
134	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
135	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
136	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
137	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
138	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
139	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
140	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
141	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
142	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
143	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
144	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
145	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
146	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
147	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
148	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
149	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
150	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
151	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
152	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
153	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
154	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
155	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
156	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
157	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
158	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
159	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
160	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
161	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
162	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
163	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
164	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
165	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
168	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
171	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
182	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
184	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
185	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
186	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
187	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
188	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
189	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
190	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
191	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
192	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
193	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
194	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
195	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
196	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
197	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
198	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
199	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
200	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
201	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
202	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
203	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
204	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
205	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
206	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
207	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
208	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
209	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
210	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
211	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
212	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
213	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
214	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
215	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
216	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
217	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
218	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
219	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
220	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
221	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
222	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
223	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
224	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
225	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
226	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
227	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
228	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
229	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
230	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
231	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
232	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
233	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
234	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
235	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
236	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
237	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
238	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
239	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
240	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
241	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
242	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
243	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
244	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
245	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
246	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
247	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
248	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
249	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
250	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
251	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
252	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
253	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
254	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
255	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
256	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
257	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
258	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
259	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
260	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
261	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
262	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
263	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
264	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
265	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
266	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
267	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
268	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
269	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
270	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
271	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
272	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
273	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
274	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
275	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
276	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
277	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
278	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
279	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
280	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
281	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
282	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
283	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
284	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
285	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
286	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
287	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
288	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
289	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
290	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
291	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
292	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
293	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
294	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
295	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
296	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
297	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
298	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
299	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
300	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
301	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
302	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
303	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
304	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
305	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
306	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
307	8005258706	Rhizobium sp. R693	Isolate	Nodule
308	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
309	8005321885	Rhizobium sp. R72	Isolate	Nodule
310	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
311	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
312	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
313	8005658619	Rhizobium terrae CC-HIH110	Isolate	Unclassified
314	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
315	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
316	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
317	8054460903	Agrobacterium vaccinii B7.6	Isolate	Unclassified
318	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified
319	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
320	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	71.81
Metatranscriptomes	0
Isolates	28.19

Biome Distribution

Category	Percentage (%)
Aerial Root	1.1
Bulb	0
Endosphere	21.37
Nodule	10.57
Rhizoplane	4.41
Rhizosphere	33.04
Stem	0
Stem Tuber	0
Unclassified	29.52

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10000157	3300001979	Bacteria	26806
2	JGI25155J39150_1000155	3300002704	Bacteria	30897
3	JGI25156J39149_1000144	3300002705	Bacteria	52681
4	JGI25156J39149_1000933	3300002705	Bacteria	14122
5	JGI25162J39368_1002945	3300002737	Bacteria	5749
6	JGI25154J39366_1000201	3300002738	Bacteria	43222
7	JGI25154J39366_1001223	3300002738	Bacteria	9688
8	JGI25157J39369_1000051	3300002741	Bacteria	111770
9	JGI25157J39369_1000077	3300002741	Bacteria	86251
10	JGI25152J39213_1001523	3300002773	Bacteria	9857
11	JGI25152J39213_1005000	3300002773	Bacteria	4005
12	JGI25150J39212_1000024	3300002774	Bacteria	129646
13	JGI25151J46595_10000027	3300003187	Bacteria	208739
14	JGI25165J46597_1002510	3300003214	Bacteria	5806
15	JGI25165J46597_1002523	3300003214	Bacteria	5771
16	JGI25165J46597_1002911	3300003214	Bacteria	4824
17	JGI25153J46596_10030502	3300003215	Bacteria	1834
18	rootH1_10012991	3300003316	Bacteria	1635
19	rootL2_10103737	3300003322	Bacteria	6546
20	rootL2_10234331	3300003322	Bacteria	2226
21	rootH1_10010243	3300003323	Bacteria	3385
22	JGI25160J50197_1000001	3300003354	Bacteria	782301
23	JGI25161J50226_1000001	3300003374	Bacteria	655036
24	Ga0055536_1014873	3300003781	Bacteria	2700
25	Ga0055540_1009193	3300003792	Bacteria	3445
26	Ga0058692_1005362	3300003856	Bacteria	3658
27	Ga0058692_1005460	3300003856	Bacteria	3621
28	Ga0055543_1000007	3300004625	Bacteria	204042
29	Ga0065165_1000357	3300005262	Bacteria	75030
30	Ga0065165_1007258	3300005262	Bacteria	5508
31	Ga0070668_100031973	3300005347	Bacteria	4005
32	Ga0070665_100007088	3300005548	Bacteria	11387
33	Ga0068855_100047859	3300005563	Bacteria	5051
34	Ga0068856_100041496	3300005614	Bacteria	4523
35	Ga0075365_10002991	3300006038	Bacteria	8557
36	Ga0075365_10018007	3300006038	Bacteria	4336
37	Ga0075368_10006241	3300006042	Bacteria	4152
38	Ga0075362_10030723	3300006177	Bacteria	2320
39	Ga0075367_10011107	3300006178	Bacteria	4751
40	Ga0075367_10014694	3300006178	Bacteria	4239
41	Ga0075367_10075130	3300006178	Bacteria	2038
42	Ga0075366_10048023	3300006195	Bacteria	2530
43	Ga0079104_1000015	3300006946	Bacteria	321803
44	Ga0099826_10142552	3300006948	Bacteria	1382
45	Ga0105251_10039739	3300009011	Bacteria	2296
46	Ga0105240_10000014	3300009093	Bacteria	482033
47	Ga0105243_10051568	3300009148	Bacteria	3254
48	Ga0105248_10021170	3300009177	Bacteria	7205
49	Ga0105237_10011396	3300009545	Bacteria	9405
50	Ga0123342_1015401	3300009766	Bacteria	6963
51	Ga0105239_10007039	3300010375	Bacteria	12940
52	Ga0157373_10192880	3300013100	Bacteria	1435
53	Ga0157371_10000165	3300013102	Bacteria	96321
54	Ga0157371_10002897	3300013102	Bacteria	16048
55	Ga0157370_10000015	3300013104	Bacteria	185771
56	Ga0157370_10000338	3300013104	Bacteria	59035
57	Ga0157369_10363398	3300013105	Bacteria	1503
58	Ga0209435_100005	3300025206	Bacteria	573745
59	Ga0209437_100058	3300025233	Bacteria	357279
60	Ga0209437_100060	3300025233	Bacteria	355034
61	Ga0207425_1000043	3300025245	Bacteria	208791
62	Ga0209646_1000011	3300025246	Bacteria	573745
63	Ga0209646_1002982	3300025246	Bacteria	3503
64	Ga0209026_1000008	3300025250	Bacteria	573745
65	Ga0209677_100577	3300025253	Bacteria	20109
66	Ga0209759_1000004	3300025256	Bacteria	573745
67	Ga0209129_1000072	3300025258	Bacteria	208805
68	Ga0209129_1006316	3300025258	Bacteria	3878
69	Ga0209233_1000137	3300025261	Bacteria	200314
70	Ga0209233_1000149	3300025261	Bacteria	181183
71	Ga0209233_1000160	3300025261	Bacteria	159035
72	Ga0209673_1028285	3300025273	Bacteria	1808
73	Ga0209673_1051157	3300025273	Bacteria	1092
74	Ga0209130_1000003	3300025284	Bacteria	677988
75	Ga0209025_1000120	3300025294	Bacteria	208791
76	Ga0209025_1000662	3300025294	Bacteria	59654
77	Ga0209025_1025516	3300025294	Bacteria	3005
78	Ga0209564_1013665	3300025295	Bacteria	3428
79	Ga0209564_1034614	3300025295	Bacteria	1478
80	Ga0209758_1000058	3300025297	Bacteria	331603
81	Ga0209758_1000111	3300025297	Bacteria	208790
82	Ga0209758_1003348	3300025297	Bacteria	14698
83	Ga0209050_1005075	3300025298	Bacteria	8501
84	Ga0209256_1010235	3300025299	Bacteria	3959
85	Ga0209256_1035509	3300025299	Bacteria	1316
86	Ga0207426_1000011	3300025302	Bacteria	791203
87	Ga0209051_1008973	3300025303	Bacteria	5213
88	Ga0209051_1019761	3300025303	Bacteria	2927
89	Ga0209257_1007595	3300025304	Bacteria	6497
90	Ga0207695_10000037	3300025913	Bacteria	476303
91	Ga0207671_10000080	3300025914	Bacteria	148567
92	Ga0207650_10000644	3300025925	Bacteria	27740
93	Ga0207667_10157364	3300025949	Bacteria	2338
94	Ga0207668_10017033	3300025972	Bacteria	4547
95	Ga0207702_10048905	3300026078	Bacteria	3567
96	Ga0207698_10021393	3300026142	Bacteria	4473
97	Ga0209281_1000068	3300027111	Bacteria	280238
98	Ga0209371_1000022	3300027312	Bacteria	536342
99	Ga0209371_1013400	3300027312	Bacteria	2304
100	Ga0209282_1077647	3300027666	Bacteria	1784
101	Ga0209813_10002468	3300027866	Bacteria	4234
102	Ga0307515_10000130	3300028794	Bacteria	179263
103	Ga0307515_10165376	3300028794	Bacteria	2233
104	Ga0268256_1000019	3300030500	Bacteria	587949
105	Ga0268256_1001598	3300030500	Bacteria	13172
106	Ga0268256_1013724	3300030500	Bacteria	2437
107	Ga0316181_1143343	3300030744	Bacteria	2397
108	Ga0307513_10012972	3300031456	Bacteria	10248
109	Ga0307516_10076550	3300031730	Bacteria	3198
110	Ga0307405_10004984	3300031731	Bacteria	6346
111	Ga0307406_10008387	3300031901	Bacteria	5762
112	Ga0307412_10000246	3300031911	Bacteria	35145
113	Ga0373935_0062619	3300035692	Bacteria	2383
114	Ga0373927_0000266	3300035695	Bacteria	41356
115	Ga0373925_0025368	3300037068	Bacteria	4330
116	Ga0395900_0313280	3300037418	Bacteria	1552
117	Ga0395905_0001815	3300037471	Bacteria	24703
118	Ga0395905_0005748	3300037471	Bacteria	12612
119	Ga0395905_0136039	3300037471	Bacteria	2311
120	Ga0439465_0009995	3300041413	Bacteria	2986
121	Ga0450900_000589	3300042136	Bacteria	2988
122	Ga0466963_0006905	3300044694	Bacteria	6755
123	Ga0466970_0003599	3300044765	Bacteria	7557
124	Ga0466959_0090693	3300045049	Bacteria	2195
125	Ga0466967_0379028	3300045976	Bacteria	1373
126	Ga0495638_0000618	3300046460	Bacteria	39500
127	Ga0495638_0068492	3300046460	Bacteria	2176
128	Ga0495582_0257004	3300046473	Bacteria	1002
129	Ga0495605_0016323	3300046474	Bacteria	4019
130	Ga0495662_0012693	3300046476	Bacteria	4109
131	Ga0495585_0003707	3300046492	Bacteria	10212
132	Ga0495585_0120957	3300046492	Bacteria	1385
133	Ga0495583_0007464	3300046506	Bacteria	6858
134	Ga0495583_0021839	3300046506	Bacteria	3282
135	Ga0495583_0117454	3300046506	Bacteria	1122
136	Ga0495606_0004366	3300046507	Bacteria	14178
137	Ga0495606_0013891	3300046507	Bacteria	6322
138	Ga0495606_0025177	3300046507	Bacteria	4269
139	Ga0495606_0054976	3300046507	Bacteria	2576
140	Ga0495606_0075957	3300046507	Bacteria	2101
141	Ga0495606_0116639	3300046507	Bacteria	1603
142	Ga0495610_0000874	3300046512	Bacteria	28114
143	Ga0495616_0010243	3300046513	Bacteria	5436
144	Ga0495618_0072945	3300046514	Bacteria	2185
145	Ga0495620_0028769	3300046515	Bacteria	2580
146	Ga0495620_0047650	3300046515	Bacteria	1843
147	Ga0495631_0001047	3300046518	Bacteria	17162
148	Ga0495632_0006285	3300046519	Bacteria	7675
149	Ga0495632_0090408	3300046519	Bacteria	1452
150	Ga0495643_0070045	3300046522	Bacteria	1842
151	Ga0495644_0079566	3300046523	Bacteria	1235
152	Ga0495648_0178915	3300046524	Bacteria	1080
153	Ga0495654_0001812	3300046530	Bacteria	14240
154	Ga0495609_0019241	3300046538	Bacteria	3162
155	Ga0495622_0013310	3300046557	Bacteria	3817
156	Ga0495622_0090748	3300046557	Bacteria	1404
157	Ga0495633_0135152	3300046558	Bacteria	1140
158	Ga0495656_0009872	3300046615	Bacteria	3449
159	Ga0495668_0029111	3300046616	Bacteria	3122
160	Ga0495634_0178862	3300046642	Bacteria	1329
161	Ga0495611_0013450	3300046648	Bacteria	3485
162	Ga0495625_0001949	3300046660	Bacteria	23345
163	Ga0495625_0050637	3300046660	Bacteria	2980
164	Ga0495625_0302335	3300046660	Bacteria	1023
165	Ga0495635_0043675	3300046663	Bacteria	3093
166	Ga0495588_0000971	3300046674	Bacteria	12537
167	Ga0495588_0036516	3300046674	Bacteria	2493
168	Ga0495588_0039117	3300046674	Bacteria	2415
169	Ga0495647_0038690	3300046681	Bacteria	1804
170	Ga0495658_0086856	3300046683	Bacteria	1846
171	Ga0495624_0052939	3300046690	Bacteria	2564
172	Ga0495670_0022826	3300046691	Bacteria	3090
173	Ga0495671_0147652	3300046692	Bacteria	1145
174	Ga0495589_0142460	3300046794	Bacteria	1147
175	Ga0495600_0006423	3300046809	Bacteria	7157
176	Ga0495660_0028916	3300046810	Bacteria	3129
177	Ga0495604_0167799	3300047317	Bacteria	1546
178	Ga0495636_0013524	3300047318	Bacteria	3240
179	Ga0495672_0055468	3300047320	Bacteria	2312
180	Ga0495676_0115001	3300047321	Bacteria	1968
181	Ga0495687_024327	3300047443	Bacteria	2879
182	Ga0495687_036946	3300047443	Bacteria	2180
183	Ga0495673_0050947	3300047469	Bacteria	1815
184	Ga0495681_0002744	3300047470	Bacteria	12461
185	Ga0495686_0002117	3300047472	Bacteria	19444
186	Ga0495686_0010988	3300047472	Bacteria	6405
187	Ga0495686_0030266	3300047472	Bacteria	3516
188	Ga0495686_0065673	3300047472	Bacteria	2243
189	Ga0495602_0175080	3300048088	Bacteria	1661
190	Ga0496100_0095736	3300048903	Bacteria	2036
191	Ga0496101_0065442	3300048904	Bacteria	2650
192	Ga0496101_0413981	3300048904	Bacteria	1062
193	Ga0496102_0035019	3300048905	Bacteria	4518
194	Ga0496102_0085891	3300048905	Bacteria	2906
195	Ga0496103_0230273	3300048906	Bacteria	1192
196	Ga0496104_0132851	3300048907	Bacteria	2391
197	Ga0496105_0092351	3300048908	Bacteria	2499
198	Ga0496105_0428956	3300048908	Bacteria	1046
199	Ga0496109_0580892	3300048912	Bacteria	1056
200	Ga0496110_0089366	3300048913	Bacteria	2753
201	Ga0496111_0000893	3300048914	Bacteria	16237
202	Ga0496113_0022925	3300048916	Bacteria	4424
203	Ga0496113_0550799	3300048916	Bacteria	925
204	Ga0496114_0576536	3300048917	Bacteria	993
205	Ga0496116_0000105	3300048919	Bacteria	192704
206	Ga0496116_0006725	3300048919	Bacteria	10355
207	Ga0496116_0010492	3300048919	Bacteria	7755
208	Ga0496116_0026184	3300048919	Bacteria	4271
209	Ga0496116_0103050	3300048919	Bacteria	1699
210	Ga0496116_0109368	3300048919	Bacteria	1629
211	Ga0496117_0000002	3300048920	Bacteria	2483758
212	Ga0496117_0002801	3300048920	Bacteria	21286
213	Ga0496117_0017684	3300048920	Bacteria	5946
214	Ga0496117_0024245	3300048920	Bacteria	4804
215	Ga0496117_0135698	3300048920	Bacteria	1483
216	Ga0496117_0239770	3300048920	Bacteria	996
217	Ga0496118_0003410	3300048921	Bacteria	20087
218	Ga0496118_0032762	3300048921	Bacteria	4273
219	Ga0496118_0037079	3300048921	Bacteria	3930
220	Ga0496118_0043830	3300048921	Bacteria	3511
221	Ga0496118_0056660	3300048921	Bacteria	2944
222	Ga0496118_0090632	3300048921	Bacteria	2106
223	Ga0496119_0028903	3300048922	Bacteria	3772
224	Ga0496119_0047608	3300048922	Bacteria	2666
225	Ga0496119_0050058	3300048922	Bacteria	2578
226	Ga0496119_0132230	3300048922	Bacteria	1358
227	Ga0496119_0157983	3300048922	Bacteria	1208
228	Ga0496120_0000093	3300048923	Bacteria	146905
229	Ga0496120_0039073	3300048923	Bacteria	2803
230	Ga0496120_0053574	3300048923	Bacteria	2291
231	Ga0496120_0091831	3300048923	Bacteria	1620
232	Ga0496121_0001095	3300048924	Bacteria	47819
233	Ga0496121_0003890	3300048924	Bacteria	20755
234	Ga0496121_0012477	3300048924	Bacteria	9256
235	Ga0496121_0040298	3300048924	Bacteria	4100
236	Ga0496121_0043725	3300048924	Bacteria	3874
237	Ga0496121_0067272	3300048924	Bacteria	2904
238	Ga0496121_0138120	3300048924	Bacteria	1813
239	Ga0496121_0185602	3300048924	Bacteria	1496
240	Ga0496122_0000004	3300048925	Bacteria	645283
241	Ga0496122_0000042	3300048925	Bacteria	280482
242	Ga0496122_0002878	3300048925	Bacteria	23563
243	Ga0496122_0028500	3300048925	Bacteria	4735
244	Ga0496122_0032291	3300048925	Bacteria	4333
245	Ga0496122_0034780	3300048925	Bacteria	4115
246	Ga0496122_0053584	3300048925	Bacteria	3039
247	Ga0496122_0111638	3300048925	Bacteria	1792
248	Ga0496123_0000007	3300048926	Bacteria	645283
249	Ga0496123_0000030	3300048926	Bacteria	291764
250	Ga0496123_0018634	3300048926	Bacteria	5507
251	Ga0496123_0023460	3300048926	Bacteria	4720
252	Ga0496123_0023744	3300048926	Bacteria	4684
253	Ga0496123_0028882	3300048926	Bacteria	4095
254	Ga0496123_0045271	3300048926	Bacteria	2999
255	Ga0496123_0058636	3300048926	Bacteria	2495
256	Ga0496123_0069387	3300048926	Bacteria	2213
257	Ga0496123_0158975	3300048926	Bacteria	1207
258	Ga0496124_0000067	3300048927	Bacteria	222576
259	Ga0496124_0003697	3300048927	Bacteria	18488
260	Ga0496124_0013999	3300048927	Bacteria	7785
261	Ga0496124_0019091	3300048927	Bacteria	6398
262	Ga0496124_0027629	3300048927	Bacteria	5088
263	Ga0496124_0049214	3300048927	Bacteria	3596
264	Ga0496124_0099698	3300048927	Bacteria	2355
265	Ga0496124_0108297	3300048927	Bacteria	2241
266	Ga0496124_0129603	3300048927	Bacteria	2005
267	Ga0496124_0155358	3300048927	Bacteria	1790
268	Ga0496124_0215757	3300048927	Bacteria	1448
269	Ga0496125_0013181	3300048928	Bacteria	8145
270	Ga0496125_0027414	3300048928	Bacteria	5163
271	Ga0496125_0041542	3300048928	Bacteria	3930
272	Ga0496125_0049877	3300048928	Bacteria	3472
273	Ga0496125_0060349	3300048928	Bacteria	3049
274	Ga0496126_0000129	3300048929	Bacteria	174059
275	Ga0496126_0052732	3300048929	Bacteria	3695
276	Ga0496126_0071628	3300048929	Bacteria	3085
277	Ga0496126_0128483	3300048929	Bacteria	2191
278	Ga0495678_023399	3300049459	Bacteria	2685
279	Ga0495682_0017155	3300049460	Bacteria	2736
280	Ga0501044_0432273	3300049823	Bacteria	1225
281	nmdc:mga00v17_247641_c1	3300050491	Bacteria	1155
282	nmdc:mga00v17_35_c1	3300050491	Bacteria	85646
283	nmdc:mga00v17_555593_c1	3300050491	Bacteria	742
284	nmdc:mga00v17_7_c1	3300050491	Bacteria	167228
285	nmdc:mga0yw44_10961_c1	3300050492	Bacteria	4652
286	nmdc:mga0yw44_6536_c1	3300050492	Bacteria	5645
287	nmdc:mga0k408_58487_c1	3300050493	Bacteria	2239
288	nmdc:mga06z11_25531_c1	3300050494	Bacteria	2802
289	nmdc:mga04h51_6821_c1	3300050495	Bacteria	2982
290	nmdc:mga07m45_51099_c1	3300050496	Bacteria	2331
291	nmdc:mga0sz30_26_c1	3300050516	Bacteria	59011
292	Ga0500610_0003389	3300053079	Bacteria	6103
293	Ga0495619_0038746	3300053085	Bacteria	3110
294	Ga0500644_0006831	3300053088	Bacteria	2943
295	Ga0500557_004525	3300053105	Bacteria	2931
296	Ga0500560_001502	3300053107	Bacteria	4082
297	Ga0500560_006712	3300053107	Bacteria	2658
298	Ga0500569_006320	3300053109	Bacteria	2597
299	Ga0500594_0000999	3300053118	Bacteria	6064
300	Ga0500607_055588	3300053121	Bacteria	2092
301	Ga0500608_040452	3300053122	Bacteria	2235
302	Ga0500614_011142	3300053123	Bacteria	1942
303	Ga0500618_000393	3300053125	Bacteria	30064
304	Ga0500618_000972	3300053125	Bacteria	14540
305	Ga0500618_002646	3300053125	Bacteria	6592
306	Ga0500618_003894	3300053125	Bacteria	4966
307	Ga0500618_013436	3300053125	Bacteria	2114
308	Ga0500618_015383	3300053125	Bacteria	1935
309	Ga0500618_018337	3300053125	Bacteria	1731
310	Ga0500559_0014570	3300053136	Bacteria	3322
311	Ga0500561_0000343	3300053137	Bacteria	7778
312	Ga0500568_0005436	3300053139	Bacteria	6583
313	Ga0500573_0005649	3300053140	Bacteria	6704
314	Ga0500573_0040938	3300053140	Bacteria	2675
315	Ga0500590_006680	3300053148	Bacteria	5634
316	Ga0500616_0000291	3300053153	Bacteria	72710
317	Ga0500616_0005294	3300053153	Bacteria	8806
318	Ga0500622_0001703	3300053156	Bacteria	17060
319	Ga0500624_000318	3300053157	Bacteria	16549
320	Ga0500624_023524	3300053157	Bacteria	1011
321	Ga0500627_0005738	3300053158	Bacteria	4156
322	Ga0500633_0049198	3300053160	Bacteria	1449
323	Ga0500634_0025255	3300053161	Bacteria	3234
324	Ga0500636_0000255	3300053177	Bacteria	29384
325	Ga0500636_0005037	3300053177	Bacteria	7501
326	Ga0500645_071825	3300053730	Bacteria	993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048912	Ga0496109_0580892	Ga0496109_0580892_347_1030	227
2	3300048916	Ga0496113_0550799	Ga0496113_0550799_215_898	227
3	3300048917	Ga0496114_0576536	Ga0496114_0576536_283_966	227
4	3300053730	Ga0500645_071825	Ga0500645_071825_20_712	230
5	3300050491	nmdc:mga00v17_555593_c1	nmdc:mga00v17_555593_c1_16_714	231
6	3300046492	Ga0495585_0120957	Ga0495585_0120957_387_1205	248
7	3300046507	Ga0495606_0116639	Ga0495606_0116639_729_1547	248
8	3300046515	Ga0495620_0028769	Ga0495620_0028769_830_1648	248
9	3300005262	Ga0065165_1007258	Ga0065165_10072586	257
10	3300050491	nmdc:mga00v17_247641_c1	nmdc:mga00v17_247641_c1_47_862	258
11	3300046512	Ga0495610_0000874	Ga0495610_0000874_4477_5298	261
12	3300046515	Ga0495620_0047650	Ga0495620_0047650_844_1665	261
13	3300046519	Ga0495632_0090408	Ga0495632_0090408_222_1043	261
14	3300047469	Ga0495673_0050947	Ga0495673_0050947_388_1209	261
15	3300047472	Ga0495686_0010988	Ga0495686_0010988_3334_4155	261
16	3300048927	Ga0496124_0155358	Ga0496124_0155358_358_1179	261
17	3300049459	Ga0495678_023399	Ga0495678_023399_418_1239	261
18	3300031456	Ga0307513_10012972	Ga0307513_100129722	266
19	3300048906	Ga0496103_0230273	Ga0496103_0230273_203_1003	266
20	3300046523	Ga0495644_0079566	Ga0495644_0079566_191_1012	267
21	3300046557	Ga0495622_0090748	Ga0495622_0090748_437_1258	267
22	3300046558	Ga0495633_0135152	Ga0495633_0135152_289_1110	267
23	3300046615	Ga0495656_0009872	Ga0495656_0009872_286_1107	267
24	3300046660	Ga0495625_0050637	Ga0495625_0050637_1882_2703	267
25	3300046674	Ga0495588_0036516	Ga0495588_0036516_1317_2138	267
26	3300046794	Ga0495589_0142460	Ga0495589_0142460_310_1131	267
27	3300053153	Ga0500616_0000291	Ga0500616_0000291_30152_31033	267
28	iso_pu_bacteria	2841859092	2841862531	267
29	iso_pu_bacteria	2513237088	2513598345	268
30	iso_pu_bacteria	2534681796	2535517292	268
31	iso_pu_bacteria	2582581294	2585205040	268
32	iso_pu_bacteria	2582581867	2585404548	268
33	iso_pu_bacteria	2585427590	2585824914	268
34	iso_pu_bacteria	2818991461	2819685437	268
35	iso_pu_bacteria	2923556063	2923562170	268
36	iso_pu_bacteria	2996887358	2996892594	268
37	iso_pu_bacteria	8005258706	8005264779	268
38	iso_pu_bacteria	8005321885	8005327121	268
39	iso_pu_bacteria	8005542996	8005546113	268
40	iso_pu_bacteria	2510917026	2511173885	269
41	iso_pu_bacteria	2513237144	2513910578	269
42	iso_pu_bacteria	2582581299	2585230741	269
43	iso_pu_bacteria	2582581304	2585259180	269
44	iso_pu_bacteria	2585427594	2585847767	269
45	iso_pu_bacteria	2585427634	2586001458	269
46	iso_pu_bacteria	2600254933	2600373946	269
47	iso_pu_bacteria	2643221599	2644002977	269
48	iso_pu_bacteria	2643221634	2644196727	269
49	iso_pu_bacteria	2643221643	2644237956	269
50	iso_pu_bacteria	2738541293	2738803309	269
51	iso_pu_bacteria	2821123053	2821125960	269
52	iso_pu_bacteria	2838736955	2838737563	269
53	iso_pu_bacteria	2841840854	2841842068	269
54	iso_pu_bacteria	2842140634	2842141847	269
55	iso_pu_bacteria	2854896431	2854900461	269
56	iso_pu_bacteria	2854916844	2854917487	269
57	iso_pu_bacteria	2857531043	2857532522	269
58	iso_pu_bacteria	2919171160	2919173168	269
59	iso_pu_bacteria	2933016740	2933022674	269
60	iso_pu_bacteria	3005409236	3005409334	269
61	iso_pu_bacteria	3005452660	3005455116	269
62	iso_pu_bacteria	8005658619	8005658710	270
63	iso_pu_bacteria	8055431914	8055432202	270
64	iso_pu_bacteria	2738541317	2738944266	271
65	iso_pu_bacteria	2913308742	2913308885	271
66	3300002773	JGI25152J39213_1005000	JGI25152J39213_10050005	272
67	3300003792	Ga0055540_1009193	Ga0055540_10091934	272
68	3300005347	Ga0070668_100031973	Ga0070668_1000319733	272
69	3300006038	Ga0075365_10018007	Ga0075365_100180074	272
70	3300006178	Ga0075367_10011107	Ga0075367_100111072	272
71	3300006178	Ga0075367_10075130	Ga0075367_100751302	272
72	3300009011	Ga0105251_10039739	Ga0105251_100397392	272
73	3300009177	Ga0105248_10021170	Ga0105248_1002117010	272
74	3300009766	Ga0123342_1015401	Ga0123342_10154014	272
75	3300025258	Ga0209129_1006316	Ga0209129_10063164	272
76	3300025273	Ga0209673_1051157	Ga0209673_10511572	272
77	3300025294	Ga0209025_1025516	Ga0209025_10255163	272
78	3300025295	Ga0209564_1013665	Ga0209564_10136652	272
79	3300025295	Ga0209564_1034614	Ga0209564_10346142	272
80	3300025297	Ga0209758_1003348	Ga0209758_10033488	272
81	3300025299	Ga0209256_1010235	Ga0209256_10102352	272
82	3300025303	Ga0209051_1019761	Ga0209051_10197612	272
83	3300025972	Ga0207668_10017033	Ga0207668_100170333	272
84	3300046507	Ga0495606_0054976	Ga0495606_0054976_676_1494	272
85	3300048905	Ga0496102_0085891	Ga0496102_0085891_1745_2563	272
86	3300048908	Ga0496105_0092351	Ga0496105_0092351_357_1175	272
87	3300048913	Ga0496110_0089366	Ga0496110_0089366_406_1224	272
88	3300048922	Ga0496119_0050058	Ga0496119_0050058_396_1214	272
89	3300048926	Ga0496123_0158975	Ga0496123_0158975_331_1149	272
90	3300048927	Ga0496124_0129603	Ga0496124_0129603_775_1593	272
91	3300048928	Ga0496125_0060349	Ga0496125_0060349_1467_2285	272
92	3300048929	Ga0496126_0071628	Ga0496126_0071628_1744_2562	272
93	3300053125	Ga0500618_002646	Ga0500618_002646_2912_3730	272
94	3300053125	Ga0500618_018337	Ga0500618_018337_424_1242	272
95	iso_pu_bacteria	2510461069	2510839270	272
96	iso_pu_bacteria	2510917022	2511137440	272
97	iso_pu_bacteria	2524023209	2524459072	272
98	iso_pu_bacteria	2582581307	2585274026	272
99	iso_pu_bacteria	2582581308	2585279490	272
100	iso_pu_bacteria	2582581315	2585322851	272
101	iso_pu_bacteria	2582581316	2585331016	272
102	iso_pu_bacteria	2585427527	2585531026	272
103	iso_pu_bacteria	2585427530	2585553053	272
104	iso_pu_bacteria	2585427531	2585560477	272
105	iso_pu_bacteria	2585427608	2585898672	272
106	iso_pu_bacteria	2585427609	2585903741	272
107	iso_pu_bacteria	2585428125	2587981140	272
108	iso_pu_bacteria	2615840626	2616307062	272
109	iso_pu_bacteria	2615840698	2616554671	272
110	iso_pu_bacteria	2617270742	2617386299	272
111	iso_pu_bacteria	2643221653	2644299069	272
112	iso_pu_bacteria	2643221719	2644657297	272
113	iso_pu_bacteria	2775507049	2776914379	272
114	iso_pu_bacteria	2775507266	2778175749	272
115	iso_pu_bacteria	2818991272	2819240913	272
116	iso_pu_bacteria	2818991448	2819609867	272
117	iso_pu_bacteria	2818991453	2819639977	272
118	iso_pu_bacteria	2838029111	2838034091	272
119	iso_pu_bacteria	2842298080	2842298425	272
120	iso_pu_bacteria	2842357229	2842360437	272
121	iso_pu_bacteria	2842475841	2842480741	272
122	iso_pu_bacteria	2842502639	2842507448	272
123	iso_pu_bacteria	2842509118	2842510439	272
124	iso_pu_bacteria	2899803654	2899806638	272
125	iso_pu_bacteria	2989776772	2989779642	272
126	iso_pu_bacteria	3005416602	3005418753	272
127	iso_pu_bacteria	8005246636	8005249746	272
128	iso_pu_bacteria	8005314921	8005318355	272
129	iso_pu_bacteria	8005484373	8005488764	272
130	iso_pu_bacteria	8005645114	8005645858	272
131	iso_pu_bacteria	8024486573	8024488494	272
132	iso_pu_bacteria	8057575449	8057576953	272
133	3300002773	JGI25152J39213_1001523	JGI25152J39213_100152312	273
134	3300002774	JGI25150J39212_1000024	JGI25150J39212_100002424	273
135	3300003187	JGI25151J46595_10000027	JGI25151J46595_1000002789	273
136	3300003215	JGI25153J46596_10030502	JGI25153J46596_100305023	273
137	3300003781	Ga0055536_1014873	Ga0055536_10148732	273
138	3300006038	Ga0075365_10002991	Ga0075365_100029915	273
139	3300006946	Ga0079104_1000015	Ga0079104_1000015214	273
140	3300013100	Ga0157373_10192880	Ga0157373_101928802	273
141	3300025245	Ga0207425_1000043	Ga0207425_100004387	273
142	3300025258	Ga0209129_1000072	Ga0209129_1000072107	273
143	3300025273	Ga0209673_1028285	Ga0209673_10282853	273
144	3300025294	Ga0209025_1000120	Ga0209025_1000120107	273
145	3300025297	Ga0209758_1000058	Ga0209758_1000058256	273
146	3300025297	Ga0209758_1000111	Ga0209758_1000111107	273
147	3300025298	Ga0209050_1005075	Ga0209050_10050758	273
148	3300025299	Ga0209256_1035509	Ga0209256_10355092	273
149	3300025303	Ga0209051_1008973	Ga0209051_10089732	273
150	3300025304	Ga0209257_1007595	Ga0209257_10075953	273
151	3300027111	Ga0209281_1000068	Ga0209281_1000068175	273
152	3300031731	Ga0307405_10004984	Ga0307405_100049843	273
153	3300031901	Ga0307406_10008387	Ga0307406_100083874	273
154	3300031911	Ga0307412_10000246	Ga0307412_1000024620	273
155	3300037471	Ga0395905_0001815	Ga0395905_0001815_22260_23081	273
156	3300041413	Ga0439465_0009995	Ga0439465_0009995_431_1252	273
157	3300046460	Ga0495638_0000618	Ga0495638_0000618_14578_15399	273
158	3300046474	Ga0495605_0016323	Ga0495605_0016323_1458_2279	273
159	3300046492	Ga0495585_0003707	Ga0495585_0003707_8972_9793	273
160	3300046506	Ga0495583_0007464	Ga0495583_0007464_4122_4943	273
161	3300046506	Ga0495583_0021839	Ga0495583_0021839_1969_2790	273
162	3300046513	Ga0495616_0010243	Ga0495616_0010243_229_1050	273
163	3300046518	Ga0495631_0001047	Ga0495631_0001047_11783_12604	273
164	3300046519	Ga0495632_0006285	Ga0495632_0006285_2112_2933	273
165	3300046524	Ga0495648_0178915	Ga0495648_0178915_112_933	273
166	3300046530	Ga0495654_0001812	Ga0495654_0001812_8550_9371	273
167	3300046538	Ga0495609_0019241	Ga0495609_0019241_1906_2727	273
168	3300046616	Ga0495668_0029111	Ga0495668_0029111_1077_1898	273
169	3300046648	Ga0495611_0013450	Ga0495611_0013450_777_1598	273
170	3300046660	Ga0495625_0001949	Ga0495625_0001949_21058_21879	273
171	3300046691	Ga0495670_0022826	Ga0495670_0022826_477_1298	273
172	3300046692	Ga0495671_0147652	Ga0495671_0147652_307_1128	273
173	3300046810	Ga0495660_0028916	Ga0495660_0028916_327_1148	273
174	3300047318	Ga0495636_0013524	Ga0495636_0013524_483_1304	273
175	3300047320	Ga0495672_0055468	Ga0495672_0055468_244_1065	273
176	3300047443	Ga0495687_036946	Ga0495687_036946_1023_1844	273
177	3300047472	Ga0495686_0065673	Ga0495686_0065673_1274_2095	273
178	3300048919	Ga0496116_0006725	Ga0496116_0006725_6002_6823	273
179	3300048919	Ga0496116_0010492	Ga0496116_0010492_5997_6818	273
180	3300048919	Ga0496116_0026184	Ga0496116_0026184_1890_2711	273
181	3300048919	Ga0496116_0103050	Ga0496116_0103050_563_1384	273
182	3300048919	Ga0496116_0109368	Ga0496116_0109368_537_1358	273
183	3300048920	Ga0496117_0017684	Ga0496117_0017684_330_1151	273
184	3300048920	Ga0496117_0024245	Ga0496117_0024245_429_1250	273
185	3300048921	Ga0496118_0032762	Ga0496118_0032762_3044_3865	273
186	3300048922	Ga0496119_0132230	Ga0496119_0132230_380_1201	273
187	3300048924	Ga0496121_0040298	Ga0496121_0040298_432_1253	273
188	3300048924	Ga0496121_0043725	Ga0496121_0043725_1764_2585	273
189	3300048924	Ga0496121_0185602	Ga0496121_0185602_434_1255	273
190	3300048925	Ga0496122_0002878	Ga0496122_0002878_9781_10614	273
191	3300048925	Ga0496122_0032291	Ga0496122_0032291_525_1346	273
192	3300048925	Ga0496122_0053584	Ga0496122_0053584_1955_2776	273
193	3300048925	Ga0496122_0111638	Ga0496122_0111638_663_1484	273
194	3300048926	Ga0496123_0023460	Ga0496123_0023460_2326_3147	273
195	3300048926	Ga0496123_0045271	Ga0496123_0045271_211_1032	273
196	3300048926	Ga0496123_0058636	Ga0496123_0058636_388_1209	273
197	3300048926	Ga0496123_0069387	Ga0496123_0069387_345_1166	273
198	3300048927	Ga0496124_0000067	Ga0496124_0000067_16989_17822	273
199	3300048927	Ga0496124_0003697	Ga0496124_0003697_3533_4354	273
200	3300048927	Ga0496124_0027629	Ga0496124_0027629_3789_4610	273
201	3300048927	Ga0496124_0049214	Ga0496124_0049214_1064_1885	273
202	3300048927	Ga0496124_0099698	Ga0496124_0099698_304_1125	273
203	3300048927	Ga0496124_0108297	Ga0496124_0108297_566_1387	273
204	3300048927	Ga0496124_0215757	Ga0496124_0215757_426_1247	273
205	3300048928	Ga0496125_0013181	Ga0496125_0013181_5561_6382	273
206	3300048929	Ga0496126_0052732	Ga0496126_0052732_699_1520	273
207	3300049460	Ga0495682_0017155	Ga0495682_0017155_1661_2482	273
208	3300050492	nmdc:mga0yw44_6536_c1	nmdc:mga0yw44_6536_c1_278_1099	273
209	3300053079	Ga0500610_0003389	Ga0500610_0003389_4666_5487	273
210	3300053105	Ga0500557_004525	Ga0500557_004525_1650_2471	273
211	3300053109	Ga0500569_006320	Ga0500569_006320_1694_2515	273
212	3300053118	Ga0500594_0000999	Ga0500594_0000999_1739_2560	273
213	3300053125	Ga0500618_000972	Ga0500618_000972_4880_5701	273
214	3300053125	Ga0500618_013436	Ga0500618_013436_898_1719	273
215	3300053125	Ga0500618_015383	Ga0500618_015383_456_1277	273
216	3300053136	Ga0500559_0014570	Ga0500559_0014570_2204_3025	273
217	3300053139	Ga0500568_0005436	Ga0500568_0005436_3849_4670	273
218	3300053153	Ga0500616_0005294	Ga0500616_0005294_3676_4497	273
219	3300053158	Ga0500627_0005738	Ga0500627_0005738_293_1114	273
220	3300053160	Ga0500633_0049198	Ga0500633_0049198_465_1286	273
221	3300053177	Ga0500636_0000255	Ga0500636_0000255_4774_5607	273
222	iso_pu_bacteria	2667528174	2671111913	273
223	iso_pu_bacteria	2842482326	2842483655	273
224	iso_pu_bacteria	2919408235	2919410415	273
225	iso_pu_bacteria	8018150411	8018154038	273
226	iso_pu_bacteria	8056875544	8056875998	273
227	3300028794	Ga0307515_10165376	Ga0307515_101653763	274
228	3300037418	Ga0395900_0313280	Ga0395900_0313280_16_840	274
229	3300037471	Ga0395905_0005748	Ga0395905_0005748_115_939	274
230	3300037471	Ga0395905_0136039	Ga0395905_0136039_1217_2041	274
231	3300048925	Ga0496122_0000042	Ga0496122_0000042_145052_145885	274
232	3300048926	Ga0496123_0000030	Ga0496123_0000030_145875_146708	274
233	iso_pu_bacteria	2643221558	2643812980	274
234	iso_pu_bacteria	8005682033	8005682467	274
235	3300048924	Ga0496121_0001095	Ga0496121_0001095_1406_2242	275
236	3300050491	nmdc:mga00v17_35_c1	nmdc:mga00v17_35_c1_39048_39884	275
237	3300001979	JGI24740J21852_10000157	JGI24740J21852_1000015715	276
238	3300002704	JGI25155J39150_1000155	JGI25155J39150_100015525	276
239	3300002705	JGI25156J39149_1000144	JGI25156J39149_100014413	276
240	3300002705	JGI25156J39149_1000933	JGI25156J39149_100093313	276
241	3300002737	JGI25162J39368_1002945	JGI25162J39368_10029452	276
242	3300002738	JGI25154J39366_1000201	JGI25154J39366_100020135	276
243	3300002738	JGI25154J39366_1001223	JGI25154J39366_100122311	276
244	3300002741	JGI25157J39369_1000051	JGI25157J39369_100005130	276
245	3300002741	JGI25157J39369_1000077	JGI25157J39369_10000774	276
246	3300003214	JGI25165J46597_1002510	JGI25165J46597_10025106	276
247	3300003214	JGI25165J46597_1002523	JGI25165J46597_10025237	276
248	3300003214	JGI25165J46597_1002911	JGI25165J46597_10029114	276
249	3300003316	rootH1_10012991	rootH1_100129912	276
250	3300003322	rootL2_10103737	rootL2_101037375	276
251	3300003322	rootL2_10234331	rootL2_102343312	276
252	3300003323	rootH1_10010243	rootH1_100102434	276
253	3300003354	JGI25160J50197_1000001	JGI25160J50197_1000001124	276
254	3300003374	JGI25161J50226_1000001	JGI25161J50226_1000001644	276
255	3300003856	Ga0058692_1005362	Ga0058692_10053622	276
256	3300003856	Ga0058692_1005460	Ga0058692_10054603	276
257	3300004625	Ga0055543_1000007	Ga0055543_100000771	276
258	3300005262	Ga0065165_1000357	Ga0065165_100035767	276
259	3300005548	Ga0070665_100007088	Ga0070665_1000070887	276
260	3300005563	Ga0068855_100047859	Ga0068855_1000478594	276
261	3300005614	Ga0068856_100041496	Ga0068856_1000414965	276
262	3300006042	Ga0075368_10006241	Ga0075368_100062414	276
263	3300006177	Ga0075362_10030723	Ga0075362_100307232	276
264	3300006178	Ga0075367_10014694	Ga0075367_100146945	276
265	3300006195	Ga0075366_10048023	Ga0075366_100480232	276
266	3300006948	Ga0099826_10142552	Ga0099826_101425522	276
267	3300009093	Ga0105240_10000014	Ga0105240_1000001471	276
268	3300009148	Ga0105243_10051568	Ga0105243_100515681	276
269	3300009545	Ga0105237_10011396	Ga0105237_100113963	276
270	3300010375	Ga0105239_10007039	Ga0105239_100070395	276
271	3300013102	Ga0157371_10000165	Ga0157371_1000016524	276
272	3300013102	Ga0157371_10002897	Ga0157371_1000289712	276
273	3300013104	Ga0157370_10000015	Ga0157370_1000001571	276
274	3300013104	Ga0157370_10000338	Ga0157370_1000033853	276
275	3300013105	Ga0157369_10363398	Ga0157369_103633982	276
276	3300025206	Ga0209435_100005	Ga0209435_100005423	276
277	3300025233	Ga0209437_100058	Ga0209437_100058158	276
278	3300025233	Ga0209437_100060	Ga0209437_100060104	276
279	3300025246	Ga0209646_1000011	Ga0209646_1000011423	276
280	3300025246	Ga0209646_1002982	Ga0209646_10029822	276
281	3300025250	Ga0209026_1000008	Ga0209026_1000008423	276
282	3300025253	Ga0209677_100577	Ga0209677_10057714	276
283	3300025256	Ga0209759_1000004	Ga0209759_1000004423	276
284	3300025261	Ga0209233_1000137	Ga0209233_100013773	276
285	3300025261	Ga0209233_1000149	Ga0209233_100014927	276
286	3300025261	Ga0209233_1000160	Ga0209233_1000160127	276
287	3300025284	Ga0209130_1000003	Ga0209130_1000003651	276
288	3300025294	Ga0209025_1000662	Ga0209025_100066228	276
289	3300025302	Ga0207426_1000011	Ga0207426_1000011124	276
290	3300025913	Ga0207695_10000037	Ga0207695_1000003772	276
291	3300025914	Ga0207671_10000080	Ga0207671_1000008073	276
292	3300025925	Ga0207650_10000644	Ga0207650_100006446	276
293	3300025949	Ga0207667_10157364	Ga0207667_101573642	276
294	3300026078	Ga0207702_10048905	Ga0207702_100489054	276
295	3300026142	Ga0207698_10021393	Ga0207698_100213933	276
296	3300027312	Ga0209371_1000022	Ga0209371_1000022410	276
297	3300027312	Ga0209371_1013400	Ga0209371_10134003	276
298	3300027666	Ga0209282_1077647	Ga0209282_10776472	276
299	3300027866	Ga0209813_10002468	Ga0209813_100024686	276
300	3300028794	Ga0307515_10000130	Ga0307515_10000130181	276
301	3300030500	Ga0268256_1000019	Ga0268256_1000019110	276
302	3300030500	Ga0268256_1001598	Ga0268256_10015987	276
303	3300030500	Ga0268256_1013724	Ga0268256_10137242	276
304	3300030744	Ga0316181_1143343	Ga0316181_11433433	276
305	3300031730	Ga0307516_10076550	Ga0307516_100765502	276
306	3300035692	Ga0373935_0062619	Ga0373935_0062619_138_974	276
307	3300035695	Ga0373927_0000266	Ga0373927_0000266_22836_23672	276
308	3300037068	Ga0373925_0025368	Ga0373925_0025368_1674_2510	276
309	3300042136	Ga0450900_000589	Ga0450900_000589_724_1578	276
310	3300044694	Ga0466963_0006905	Ga0466963_0006905_1852_2682	276
311	3300044765	Ga0466970_0003599	Ga0466970_0003599_5179_6009	276
312	3300045049	Ga0466959_0090693	Ga0466959_0090693_292_1122	276
313	3300045976	Ga0466967_0379028	Ga0466967_0379028_176_1006	276
314	3300046460	Ga0495638_0068492	Ga0495638_0068492_650_1480	276
315	3300046473	Ga0495582_0257004	Ga0495582_0257004_87_917	276
316	3300046476	Ga0495662_0012693	Ga0495662_0012693_1297_2127	276
317	3300046506	Ga0495583_0117454	Ga0495583_0117454_218_1048	276
318	3300046507	Ga0495606_0004366	Ga0495606_0004366_12177_13007	276
319	3300046507	Ga0495606_0013891	Ga0495606_0013891_4131_4961	276
320	3300046507	Ga0495606_0025177	Ga0495606_0025177_1524_2354	276
321	3300046507	Ga0495606_0075957	Ga0495606_0075957_88_918	276
322	3300046514	Ga0495618_0072945	Ga0495618_0072945_1193_2023	276
323	3300046522	Ga0495643_0070045	Ga0495643_0070045_44_874	276
324	3300046557	Ga0495622_0013310	Ga0495622_0013310_1412_2242	276
325	3300046642	Ga0495634_0178862	Ga0495634_0178862_39_869	276
326	3300046660	Ga0495625_0302335	Ga0495625_0302335_142_972	276
327	3300046663	Ga0495635_0043675	Ga0495635_0043675_227_1057	276
328	3300046674	Ga0495588_0000971	Ga0495588_0000971_3900_4772	276
329	3300046674	Ga0495588_0039117	Ga0495588_0039117_510_1340	276
330	3300046681	Ga0495647_0038690	Ga0495647_0038690_122_952	276
331	3300046683	Ga0495658_0086856	Ga0495658_0086856_217_1047	276
332	3300046690	Ga0495624_0052939	Ga0495624_0052939_425_1255	276
333	3300046809	Ga0495600_0006423	Ga0495600_0006423_5254_6084	276
334	3300047317	Ga0495604_0167799	Ga0495604_0167799_111_941	276
335	3300047321	Ga0495676_0115001	Ga0495676_0115001_106_936	276
336	3300047443	Ga0495687_024327	Ga0495687_024327_87_917	276
337	3300047470	Ga0495681_0002744	Ga0495681_0002744_8872_9735	276
338	3300047472	Ga0495686_0002117	Ga0495686_0002117_16631_17461	276
339	3300047472	Ga0495686_0030266	Ga0495686_0030266_2053_2886	276
340	3300048088	Ga0495602_0175080	Ga0495602_0175080_78_908	276
341	3300048903	Ga0496100_0095736	Ga0496100_0095736_1050_1880	276
342	3300048904	Ga0496101_0065442	Ga0496101_0065442_1661_2491	276
343	3300048904	Ga0496101_0413981	Ga0496101_0413981_140_970	276
344	3300048905	Ga0496102_0035019	Ga0496102_0035019_1968_2798	276
345	3300048907	Ga0496104_0132851	Ga0496104_0132851_98_952	276
346	3300048908	Ga0496105_0428956	Ga0496105_0428956_27_857	276
347	3300048914	Ga0496111_0000893	Ga0496111_0000893_6166_6999	276
348	3300048916	Ga0496113_0022925	Ga0496113_0022925_1642_2472	276
349	3300048919	Ga0496116_0000105	Ga0496116_0000105_9109_9963	276
350	3300048920	Ga0496117_0000002	Ga0496117_0000002_138332_139204	276
351	3300048920	Ga0496117_0002801	Ga0496117_0002801_6617_7447	276
352	3300048920	Ga0496117_0135698	Ga0496117_0135698_182_1015	276
353	3300048920	Ga0496117_0239770	Ga0496117_0239770_66_920	276
354	3300048921	Ga0496118_0003410	Ga0496118_0003410_12707_13537	276
355	3300048921	Ga0496118_0037079	Ga0496118_0037079_1955_2800	276
356	3300048921	Ga0496118_0043830	Ga0496118_0043830_893_1765	276
357	3300048921	Ga0496118_0056660	Ga0496118_0056660_810_1664	276
358	3300048921	Ga0496118_0090632	Ga0496118_0090632_1134_1967	276
359	3300048922	Ga0496119_0028903	Ga0496119_0028903_441_1274	276
360	3300048922	Ga0496119_0047608	Ga0496119_0047608_1403_2233	276
361	3300048922	Ga0496119_0157983	Ga0496119_0157983_226_1080	276
362	3300048923	Ga0496120_0000093	Ga0496120_0000093_8014_8886	276
363	3300048923	Ga0496120_0039073	Ga0496120_0039073_660_1490	276
364	3300048923	Ga0496120_0053574	Ga0496120_0053574_1381_2235	276
365	3300048923	Ga0496120_0091831	Ga0496120_0091831_459_1292	276
366	3300048924	Ga0496121_0003890	Ga0496121_0003890_13710_14540	276
367	3300048924	Ga0496121_0012477	Ga0496121_0012477_3252_4082	276
368	3300048924	Ga0496121_0067272	Ga0496121_0067272_410_1240	276
369	3300048924	Ga0496121_0138120	Ga0496121_0138120_473_1306	276
370	3300048925	Ga0496122_0000004	Ga0496122_0000004_506472_507344	276
371	3300048925	Ga0496122_0028500	Ga0496122_0028500_1780_2610	276
372	3300048925	Ga0496122_0034780	Ga0496122_0034780_1488_2342	276
373	3300048926	Ga0496123_0000007	Ga0496123_0000007_506472_507344	276
374	3300048926	Ga0496123_0018634	Ga0496123_0018634_2721_3554	276
375	3300048926	Ga0496123_0023744	Ga0496123_0023744_2094_2924	276
376	3300048926	Ga0496123_0028882	Ga0496123_0028882_1396_2229	276
377	3300048927	Ga0496124_0013999	Ga0496124_0013999_2215_3045	276
378	3300048927	Ga0496124_0019091	Ga0496124_0019091_2105_2938	276
379	3300048928	Ga0496125_0027414	Ga0496125_0027414_2468_3298	276
380	3300048928	Ga0496125_0041542	Ga0496125_0041542_1398_2252	276
381	3300048928	Ga0496125_0049877	Ga0496125_0049877_436_1266	276
382	3300048929	Ga0496126_0000129	Ga0496126_0000129_170350_171204	276
383	3300048929	Ga0496126_0128483	Ga0496126_0128483_895_1725	276
384	3300049823	Ga0501044_0432273	Ga0501044_0432273_90_929	276
385	3300050491	nmdc:mga00v17_7_c1	nmdc:mga00v17_7_c1_131794_132666	276
386	3300050492	nmdc:mga0yw44_10961_c1	nmdc:mga0yw44_10961_c1_2590_3462	276
387	3300050493	nmdc:mga0k408_58487_c1	nmdc:mga0k408_58487_c1_795_1667	276
388	3300050494	nmdc:mga06z11_25531_c1	nmdc:mga06z11_25531_c1_1140_2012	276
389	3300050495	nmdc:mga04h51_6821_c1	nmdc:mga04h51_6821_c1_1538_2410	276
390	3300050496	nmdc:mga07m45_51099_c1	nmdc:mga07m45_51099_c1_573_1445	276
391	3300050516	nmdc:mga0sz30_26_c1	nmdc:mga0sz30_26_c1_52984_53856	276
392	3300053085	Ga0495619_0038746	Ga0495619_0038746_2240_3070	276
393	3300053088	Ga0500644_0006831	Ga0500644_0006831_653_1483	276
394	3300053107	Ga0500560_001502	Ga0500560_001502_178_1050	276
395	3300053107	Ga0500560_006712	Ga0500560_006712_1659_2522	276
396	3300053121	Ga0500607_055588	Ga0500607_055588_441_1295	276
397	3300053122	Ga0500608_040452	Ga0500608_040452_435_1265	276
398	3300053123	Ga0500614_011142	Ga0500614_011142_976_1806	276
399	3300053125	Ga0500618_000393	Ga0500618_000393_3278_4195	276
400	3300053125	Ga0500618_003894	Ga0500618_003894_2277_3107	276
401	3300053137	Ga0500561_0000343	Ga0500561_0000343_2132_3004	276
402	3300053140	Ga0500573_0005649	Ga0500573_0005649_4118_4951	276
403	3300053140	Ga0500573_0040938	Ga0500573_0040938_1031_1870	276
404	3300053148	Ga0500590_006680	Ga0500590_006680_3905_4735	276
405	3300053156	Ga0500622_0001703	Ga0500622_0001703_12934_13764	276
406	3300053157	Ga0500624_000318	Ga0500624_000318_12672_13535	276
407	3300053157	Ga0500624_023524	Ga0500624_023524_97_951	276
408	3300053161	Ga0500634_0025255	Ga0500634_0025255_709_1572	276
409	3300053177	Ga0500636_0005037	Ga0500636_0005037_1713_2567	276
410	iso_pu_bacteria	2537561587	2537875818	276
411	iso_pu_bacteria	2554235003	2554248580	276
412	iso_pu_bacteria	2558860242	2559295668	276
413	iso_pu_bacteria	2599185210	2599601994	276
414	iso_pu_bacteria	2600255279	2601609751	276
415	iso_pu_bacteria	2600255308	2601746526	276
416	iso_pu_bacteria	2643221568	2643855273	276
417	iso_pu_bacteria	2643221582	2643920012	276
418	iso_pu_bacteria	2643221693	2644523365	276
419	iso_pu_bacteria	2808606387	2808987599	276
420	iso_pu_bacteria	2818991439	2819559387	276
421	iso_pu_bacteria	2838675328	2838675441	276
422	iso_pu_bacteria	2838714209	2838714322	276
423	iso_pu_bacteria	2838719591	2838721876	276
424	iso_pu_bacteria	2838724970	2838725083	276
425	iso_pu_bacteria	2841846520	2841848860	276
426	iso_pu_bacteria	2842124991	2842125109	276
427	iso_pu_bacteria	2842130223	2842130336	276
428	iso_pu_bacteria	2842152218	2842154494	276
429	iso_pu_bacteria	2842170452	2842170565	276
430	iso_pu_bacteria	2842175837	2842178114	276
431	iso_pu_bacteria	2842187318	2842187431	276
432	iso_pu_bacteria	2842211629	2842211742	276
433	iso_pu_bacteria	2842224351	2842226638	276
434	iso_pu_bacteria	2842515876	2842519315	276
435	iso_pu_bacteria	2899792073	2899795788	276
436	iso_pu_bacteria	2899845264	2899847301	276
437	iso_pu_bacteria	2919114240	2919114353	276
438	iso_pu_bacteria	2926754445	2926755373	276
439	iso_pu_bacteria	2926760298	2926762483	276
440	iso_pu_bacteria	2933006813	2933009139	276
441	iso_pu_bacteria	2933011516	2933014514	276
442	iso_pu_bacteria	2933594066	2933596261	276
443	iso_pu_bacteria	2978969890	2978972083	276
444	iso_pu_bacteria	2979089926	2979092248	276
445	iso_pu_bacteria	2979095461	2979100363	276
446	iso_pu_bacteria	2979100975	2979104238	276
447	iso_pu_bacteria	2984509177	2984511183	276
448	iso_pu_bacteria	2984518228	2984522455	276
449	iso_pu_bacteria	2984537506	2984541758	276
450	iso_pu_bacteria	2984587000	2984590365	276
451	iso_pu_bacteria	2984601300	2984604115	276
452	iso_pu_bacteria	650716007	650740879	276
453	iso_pu_bacteria	8003570095	8003571954	276
454	iso_pu_bacteria	8054460903	8054463297	276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

156

296

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1gz0-assembly4.cif.gz_E	23s ribosomal rna g2251 2'o-methyltransferase rlmb	0.9219	113	273
5co4-assembly1.cif.gz_A	structural insights into the 2-oh methylation of c/u34 on trna	0.9122	124	272
1gz0-assembly4.cif.gz_E	23s ribosomal rna g2251 2'o-methyltransferase rlmb	0.8904	113	273
5co4-assembly1.cif.gz_A	structural insights into the 2-oh methylation of c/u34 on trna	0.884	124	272
7e3q-assembly1.cif.gz_B	crystal structure of sah bound trml from vibrio vulnificus	0.8826	128	275

ID	Description	Score	Start	End	Superfamily
af_P9WFY3_121_283_3.40.1280.10	Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain	0.9538	126	273	3.40.1280.10
af_Q76NT0_373_525_3.40.1280.10	Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain	0.9391	128	269	3.40.1280.10
4x3lA02	Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain	0.9318	123	274	3.40.1280.10
af_P9WFY5_148_322_3.40.1280.10	Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain	0.9302	119	272	3.40.1280.10
af_P94978_97_258_3.40.1280.10	Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain	0.9243	115	272	3.40.1280.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2W4CSN4-F1-model_v4	deleted	0.99	1	276
AF-A0A0Q6RM15-F1-model_v4	RNA methyltransferase	0.9796	7	276	GO:0003723 GO:0006396 GO:0008173 GO:0032259
AF-A0A246DXV9-F1-model_v4	RNA methyltransferase	0.978	7	276	GO:0003723 GO:0006396 GO:0008173 GO:0032259
AF-A0A0Q6RM15-F1-model_v4	RNA methyltransferase	0.9655	7	276	GO:0003723 GO:0006396 GO:0008173 GO:0032259
AF-A0A246DXV9-F1-model_v4	RNA methyltransferase	0.9604	7	276	GO:0003723 GO:0006396 GO:0008173 GO:0032259

Feature Viewer

pLDDT	pTM	Quality
90.75	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F447473

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00588

SpoU_methylase

SpoU rRNA Methylase family

156

296

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map