F447472
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 454 | 194 | 908 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300050512|nmdc:mga0n895_337440_c2|nmdc:mga0n895_337440_c2_379_858 |
| Length | 159 |
| Sequence | MFSAGTRVCRNTHLVVVLPDDVGDGVRNRRFSKAETRILERCWKLGVCSVREILDSLPEDERVAYTTVQTLVYRLEQKGALRRVKKIGNAQMFEPALDQQQYRSGLVRDLLDLFGGSSRLLVSNLLETGALTLKDLKALESTPRRGKSSRRGQGGKRND |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 50 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 75 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 76 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 77 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 117 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 120 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 121 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 123 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 124 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 125 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 126 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 129 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 130 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 136 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 137 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 138 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 139 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 140 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 143 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 175 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 178 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 179 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 180 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0.44 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.44 |
| Nodule | 0 |
| Rhizoplane | 8.15 |
| Rhizosphere | 89.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 39.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga0n895_337440_c2 | 3300050512 | Unclassified | 994 |
| 2 | MBSR1b_contig_297530 | 2162886012 | Unclassified | 908 |
| 3 | MBSR1b_contig_4117783 | 2162886012 | Unclassified | 850 |
| 4 | Ga0065715_10045757 | 3300005293 | Unclassified | 1370 |
| 5 | Ga0070666_10049568 | 3300005335 | Unclassified | 2822 |
| 6 | Ga0068868_100093962 | 3300005338 | Bacteria | 2419 |
| 7 | Ga0070671_100103198 | 3300005355 | Unclassified | 2392 |
| 8 | Ga0070673_101004693 | 3300005364 | Unclassified | 777 |
| 9 | Ga0070667_100123941 | 3300005367 | Bacteria | 2250 |
| 10 | Ga0070667_100429312 | 3300005367 | Bacteria | 1205 |
| 11 | Ga0070709_10124976 | 3300005434 | Bacteria | 1749 |
| 12 | Ga0070709_10485779 | 3300005434 | Unclassified | 936 |
| 13 | Ga0070709_10959530 | 3300005434 | Unclassified | 678 |
| 14 | Ga0070709_11042018 | 3300005434 | Unclassified | 652 |
| 15 | Ga0070714_100011162 | 3300005435 | Bacteria | 7120 |
| 16 | Ga0070714_100632191 | 3300005435 | Bacteria | 1029 |
| 17 | Ga0070714_100771973 | 3300005435 | Unclassified | 930 |
| 18 | Ga0070713_100004645 | 3300005436 | Bacteria | 9264 |
| 19 | Ga0070713_100016558 | 3300005436 | Bacteria | 5544 |
| 20 | Ga0070713_100022025 | 3300005436 | Bacteria | 4916 |
| 21 | Ga0070713_100028159 | 3300005436 | Unclassified | 4434 |
| 22 | Ga0070713_100061753 | 3300005436 | Bacteria | 3136 |
| 23 | Ga0070713_100091332 | 3300005436 | Bacteria | 2619 |
| 24 | Ga0070713_100107138 | 3300005436 | Bacteria | 2431 |
| 25 | Ga0070713_100218314 | 3300005436 | Bacteria | 1729 |
| 26 | Ga0070713_100334524 | 3300005436 | Unclassified | 1401 |
| 27 | Ga0070713_102219344 | 3300005436 | Unclassified | 532 |
| 28 | Ga0070710_10076307 | 3300005437 | Bacteria | 1945 |
| 29 | Ga0070710_10230574 | 3300005437 | Unclassified | 1182 |
| 30 | Ga0070710_10332363 | 3300005437 | Unclassified | 1001 |
| 31 | Ga0070710_10489373 | 3300005437 | Unclassified | 840 |
| 32 | Ga0070711_100007260 | 3300005439 | Bacteria | 6732 |
| 33 | Ga0070711_100095957 | 3300005439 | Bacteria | 2147 |
| 34 | Ga0070711_100110228 | 3300005439 | Unclassified | 2019 |
| 35 | Ga0070711_100125652 | 3300005439 | Bacteria | 1903 |
| 36 | Ga0070711_100126493 | 3300005439 | Bacteria | 1898 |
| 37 | Ga0070711_100593934 | 3300005439 | Unclassified | 923 |
| 38 | Ga0070711_100594024 | 3300005439 | Bacteria | 923 |
| 39 | Ga0070705_100237928 | 3300005440 | Unclassified | 1271 |
| 40 | Ga0070705_100250453 | 3300005440 | Bacteria | 1243 |
| 41 | Ga0070694_100092946 | 3300005444 | Bacteria | 2120 |
| 42 | Ga0070694_100235040 | 3300005444 | Bacteria | 1380 |
| 43 | Ga0070694_101493791 | 3300005444 | Unclassified | 572 |
| 44 | Ga0070708_100010242 | 3300005445 | Bacteria | 7590 |
| 45 | Ga0070678_100153876 | 3300005456 | Bacteria | 1855 |
| 46 | Ga0070681_10005961 | 3300005458 | Bacteria | 11799 |
| 47 | Ga0070706_100038440 | 3300005467 | Bacteria | 4416 |
| 48 | Ga0070706_100286071 | 3300005467 | Unclassified | 1538 |
| 49 | Ga0070706_100435726 | 3300005467 | Unclassified | 1220 |
| 50 | Ga0070707_100002475 | 3300005468 | Bacteria | 17599 |
| 51 | Ga0070707_100629435 | 3300005468 | Bacteria | 1035 |
| 52 | Ga0070699_100025802 | 3300005518 | Bacteria | 5065 |
| 53 | Ga0070699_100451618 | 3300005518 | Bacteria | 1165 |
| 54 | Ga0070697_100002758 | 3300005536 | Bacteria | 13523 |
| 55 | Ga0070697_100026789 | 3300005536 | Unclassified | 4609 |
| 56 | Ga0070697_100028167 | 3300005536 | Bacteria | 4497 |
| 57 | Ga0070697_100196572 | 3300005536 | Unclassified | 1713 |
| 58 | Ga0070697_100458203 | 3300005536 | Unclassified | 1111 |
| 59 | Ga0070697_100673730 | 3300005536 | Bacteria | 912 |
| 60 | Ga0068853_100028265 | 3300005539 | Bacteria | 4715 |
| 61 | Ga0068853_100344974 | 3300005539 | Bacteria | 1384 |
| 62 | Ga0070686_100151041 | 3300005544 | Bacteria | 1627 |
| 63 | Ga0070686_101134727 | 3300005544 | Unclassified | 647 |
| 64 | Ga0070695_100010359 | 3300005545 | Bacteria | 5565 |
| 65 | Ga0070695_100036972 | 3300005545 | Unclassified | 3075 |
| 66 | Ga0070665_100031286 | 3300005548 | Bacteria | 5356 |
| 67 | Ga0070665_100123006 | 3300005548 | Bacteria | 2596 |
| 68 | Ga0070704_100038720 | 3300005549 | Bacteria | 3269 |
| 69 | Ga0068855_100123109 | 3300005563 | Bacteria | 2967 |
| 70 | Ga0068855_101076788 | 3300005563 | Unclassified | 841 |
| 71 | Ga0068854_101934730 | 3300005578 | Unclassified | 542 |
| 72 | Ga0068856_100097887 | 3300005614 | Bacteria | 2923 |
| 73 | Ga0068856_100239801 | 3300005614 | Unclassified | 1828 |
| 74 | Ga0068856_100337049 | 3300005614 | Bacteria | 1526 |
| 75 | Ga0070702_100463457 | 3300005615 | Bacteria | 922 |
| 76 | Ga0070702_101836032 | 3300005615 | Unclassified | 507 |
| 77 | Ga0068852_100171686 | 3300005616 | Bacteria | 2033 |
| 78 | Ga0068859_100417484 | 3300005617 | Bacteria | 1438 |
| 79 | Ga0068861_100204035 | 3300005719 | Bacteria | 1661 |
| 80 | Ga0068863_100119640 | 3300005841 | Unclassified | 2510 |
| 81 | Ga0068858_100081033 | 3300005842 | Unclassified | 3016 |
| 82 | Ga0068858_100111862 | 3300005842 | Bacteria | 2550 |
| 83 | Ga0068858_100858042 | 3300005842 | Unclassified | 887 |
| 84 | Ga0068860_100019477 | 3300005843 | Bacteria | 6579 |
| 85 | Ga0068860_100041721 | 3300005843 | Bacteria | 4383 |
| 86 | Ga0068860_100123517 | 3300005843 | Unclassified | 2480 |
| 87 | Ga0068860_101355833 | 3300005843 | Unclassified | 732 |
| 88 | Ga0070717_10099855 | 3300006028 | Bacteria | 2463 |
| 89 | Ga0070717_10101344 | 3300006028 | Bacteria | 2445 |
| 90 | Ga0070717_10112015 | 3300006028 | Bacteria | 2329 |
| 91 | Ga0070717_10210549 | 3300006028 | Bacteria | 1706 |
| 92 | Ga0070717_11769931 | 3300006028 | Unclassified | 559 |
| 93 | Ga0070715_10040453 | 3300006163 | Bacteria | 1949 |
| 94 | Ga0070715_10043760 | 3300006163 | Bacteria | 1890 |
| 95 | Ga0070715_10352042 | 3300006163 | Unclassified | 805 |
| 96 | Ga0070715_10441280 | 3300006163 | Unclassified | 733 |
| 97 | Ga0070716_100008459 | 3300006173 | Bacteria | 5104 |
| 98 | Ga0070716_100034807 | 3300006173 | Bacteria | 2764 |
| 99 | Ga0070716_100046573 | 3300006173 | Bacteria | 2441 |
| 100 | Ga0070716_100322498 | 3300006173 | Bacteria | 1083 |
| 101 | Ga0070716_100697455 | 3300006173 | Bacteria | 775 |
| 102 | Ga0070716_100810528 | 3300006173 | Bacteria | 726 |
| 103 | Ga0070716_100859173 | 3300006173 | Bacteria | 707 |
| 104 | Ga0070716_100888997 | 3300006173 | Bacteria | 697 |
| 105 | Ga0070716_100981619 | 3300006173 | Bacteria | 667 |
| 106 | Ga0070712_100004423 | 3300006175 | Bacteria | 8668 |
| 107 | Ga0070712_100011279 | 3300006175 | Bacteria | 5662 |
| 108 | Ga0070712_100025817 | 3300006175 | Bacteria | 3908 |
| 109 | Ga0070712_100055047 | 3300006175 | Bacteria | 2784 |
| 110 | Ga0070712_100101790 | 3300006175 | Bacteria | 2126 |
| 111 | Ga0070712_100229072 | 3300006175 | Unclassified | 1475 |
| 112 | Ga0070712_101140196 | 3300006175 | Bacteria | 677 |
| 113 | Ga0097621_100002000 | 3300006237 | Bacteria | 13908 |
| 114 | Ga0097621_100271461 | 3300006237 | Unclassified | 1490 |
| 115 | Ga0068871_100000420 | 3300006358 | Bacteria | 29371 |
| 116 | Ga0068871_100204910 | 3300006358 | Bacteria | 1704 |
| 117 | Ga0068871_100482655 | 3300006358 | Unclassified | 1115 |
| 118 | Ga0068871_100825092 | 3300006358 | Bacteria | 856 |
| 119 | Ga0075434_100071864 | 3300006871 | Bacteria | 3452 |
| 120 | Ga0075434_100619529 | 3300006871 | Unclassified | 1101 |
| 121 | Ga0075434_100998095 | 3300006871 | Bacteria | 851 |
| 122 | Ga0068865_100009180 | 3300006881 | Bacteria | 6121 |
| 123 | Ga0075436_100030044 | 3300006914 | Bacteria | 3739 |
| 124 | Ga0075436_100326581 | 3300006914 | Unclassified | 1103 |
| 125 | Ga0075436_100394444 | 3300006914 | Unclassified | 1002 |
| 126 | Ga0097620_100417415 | 3300006931 | Bacteria | 1438 |
| 127 | Ga0075435_100008980 | 3300007076 | Bacteria | 7207 |
| 128 | Ga0075435_100021929 | 3300007076 | Bacteria | 4922 |
| 129 | Ga0075435_100056055 | 3300007076 | Bacteria | 3185 |
| 130 | Ga0075435_101847928 | 3300007076 | Unclassified | 530 |
| 131 | Ga0099795_10029639 | 3300007788 | Bacteria | 1872 |
| 132 | Ga0099795_10254610 | 3300007788 | Bacteria | 758 |
| 133 | Ga0099795_10622717 | 3300007788 | Unclassified | 515 |
| 134 | Ga0105250_10152191 | 3300009092 | Bacteria | 963 |
| 135 | Ga0105240_10004870 | 3300009093 | Bacteria | 20201 |
| 136 | Ga0105240_10018036 | 3300009093 | Bacteria | 9492 |
| 137 | Ga0105240_10275451 | 3300009093 | Bacteria | 1936 |
| 138 | Ga0105240_10883311 | 3300009093 | Bacteria | 963 |
| 139 | Ga0105240_11314211 | 3300009093 | Unclassified | 762 |
| 140 | Ga0105245_10017176 | 3300009098 | Bacteria | 6312 |
| 141 | Ga0105245_10029261 | 3300009098 | Bacteria | 4866 |
| 142 | Ga0105245_10499253 | 3300009098 | Bacteria | 1233 |
| 143 | Ga0105247_10007916 | 3300009101 | Bacteria | 6498 |
| 144 | Ga0105247_10054324 | 3300009101 | Unclassified | 2472 |
| 145 | Ga0105247_10585663 | 3300009101 | Unclassified | 825 |
| 146 | Ga0114129_10034673 | 3300009147 | Bacteria | 7129 |
| 147 | Ga0114129_10120149 | 3300009147 | Bacteria | 3619 |
| 148 | Ga0105243_10761409 | 3300009148 | Bacteria | 950 |
| 149 | Ga0105241_10016454 | 3300009174 | Bacteria | 5425 |
| 150 | Ga0105241_10041043 | 3300009174 | Bacteria | 3494 |
| 151 | Ga0105241_11740534 | 3300009174 | Bacteria | 607 |
| 152 | Ga0105242_10013066 | 3300009176 | Bacteria | 6406 |
| 153 | Ga0105248_10047048 | 3300009177 | Bacteria | 4837 |
| 154 | Ga0105248_10317900 | 3300009177 | Unclassified | 1753 |
| 155 | Ga0105248_10672718 | 3300009177 | Bacteria | 1168 |
| 156 | Ga0105248_10750225 | 3300009177 | Bacteria | 1101 |
| 157 | Ga0105237_10023794 | 3300009545 | Bacteria | 6270 |
| 158 | Ga0105237_10287321 | 3300009545 | Bacteria | 1647 |
| 159 | Ga0105238_10511063 | 3300009551 | Unclassified | 1203 |
| 160 | Ga0105238_10733784 | 3300009551 | Bacteria | 1001 |
| 161 | Ga0105238_12347156 | 3300009551 | Unclassified | 569 |
| 162 | Ga0105249_10166051 | 3300009553 | Bacteria | 2137 |
| 163 | Ga0099796_10305350 | 3300010159 | Unclassified | 675 |
| 164 | Ga0105239_10073271 | 3300010375 | Bacteria | 3765 |
| 165 | Ga0157370_10809663 | 3300013104 | Unclassified | 852 |
| 166 | Ga0157370_11857676 | 3300013104 | Unclassified | 540 |
| 167 | Ga0157369_10000432 | 3300013105 | Bacteria | 55626 |
| 168 | Ga0157374_10004401 | 3300013296 | Bacteria | 11851 |
| 169 | Ga0157374_10202702 | 3300013296 | Bacteria | 1943 |
| 170 | Ga0157374_10296003 | 3300013296 | Unclassified | 1600 |
| 171 | Ga0157374_10938362 | 3300013296 | Unclassified | 884 |
| 172 | Ga0157378_10002089 | 3300013297 | Bacteria | 17841 |
| 173 | Ga0157378_10139425 | 3300013297 | Unclassified | 2251 |
| 174 | Ga0157378_11095922 | 3300013297 | Bacteria | 833 |
| 175 | Ga0157378_11507090 | 3300013297 | Unclassified | 717 |
| 176 | Ga0163162_10052314 | 3300013306 | Bacteria | 4101 |
| 177 | Ga0163162_10267514 | 3300013306 | Bacteria | 1841 |
| 178 | Ga0163162_10314184 | 3300013306 | Bacteria | 1699 |
| 179 | Ga0163162_11061090 | 3300013306 | Unclassified | 917 |
| 180 | Ga0157372_10091424 | 3300013307 | Bacteria | 3461 |
| 181 | Ga0157372_10433679 | 3300013307 | Unclassified | 1532 |
| 182 | Ga0157372_10505910 | 3300013307 | Bacteria | 1408 |
| 183 | Ga0157372_10903985 | 3300013307 | Unclassified | 1024 |
| 184 | Ga0157375_10610416 | 3300013308 | Unclassified | 1249 |
| 185 | Ga0163163_10027058 | 3300014325 | Bacteria | 5488 |
| 186 | Ga0157379_10018006 | 3300014968 | Bacteria | 6226 |
| 187 | Ga0157379_10085555 | 3300014968 | Unclassified | 2826 |
| 188 | Ga0157379_10342207 | 3300014968 | Bacteria | 1368 |
| 189 | Ga0157379_12414704 | 3300014968 | Unclassified | 525 |
| 190 | Ga0157376_10000051 | 3300014969 | Bacteria | 102604 |
| 191 | Ga0157376_10217775 | 3300014969 | Bacteria | 1766 |
| 192 | Ga0213873_10032748 | 3300021358 | Unclassified | 1301 |
| 193 | Ga0213876_10025390 | 3300021384 | Bacteria | 3126 |
| 194 | Ga0228598_1032622 | 3300024227 | Bacteria | 1026 |
| 195 | Ga0207692_10136995 | 3300025898 | Bacteria | 1389 |
| 196 | Ga0207692_10139892 | 3300025898 | Bacteria | 1376 |
| 197 | Ga0207692_10434647 | 3300025898 | Unclassified | 824 |
| 198 | Ga0207710_10033056 | 3300025900 | Unclassified | 2268 |
| 199 | Ga0207710_10255841 | 3300025900 | Unclassified | 876 |
| 200 | Ga0207680_10285721 | 3300025903 | Bacteria | 1147 |
| 201 | Ga0207685_10076014 | 3300025905 | Bacteria | 1376 |
| 202 | Ga0207685_10097076 | 3300025905 | Bacteria | 1253 |
| 203 | Ga0207685_10280156 | 3300025905 | Bacteria | 818 |
| 204 | Ga0207685_10330362 | 3300025905 | Unclassified | 763 |
| 205 | Ga0207699_10021707 | 3300025906 | Bacteria | 3466 |
| 206 | Ga0207699_10028296 | 3300025906 | Unclassified | 3113 |
| 207 | Ga0207699_10147649 | 3300025906 | Bacteria | 1552 |
| 208 | Ga0207699_10261315 | 3300025906 | Bacteria | 1197 |
| 209 | Ga0207699_10442330 | 3300025906 | Unclassified | 931 |
| 210 | Ga0207699_10485677 | 3300025906 | Bacteria | 890 |
| 211 | Ga0207699_10949254 | 3300025906 | Bacteria | 635 |
| 212 | Ga0207699_10958403 | 3300025906 | Unclassified | 632 |
| 213 | Ga0207684_10006421 | 3300025910 | Bacteria | 10717 |
| 214 | Ga0207684_10006479 | 3300025910 | Bacteria | 10673 |
| 215 | Ga0207684_10094780 | 3300025910 | Unclassified | 2546 |
| 216 | Ga0207684_10197235 | 3300025910 | Bacteria | 1736 |
| 217 | Ga0207654_10043277 | 3300025911 | Plasmid | 2552 |
| 218 | Ga0207707_10004860 | 3300025912 | Bacteria | 11789 |
| 219 | Ga0207707_10109010 | 3300025912 | Unclassified | 2421 |
| 220 | Ga0207695_10004359 | 3300025913 | Bacteria | 19377 |
| 221 | Ga0207695_10422791 | 3300025913 | Bacteria | 1216 |
| 222 | Ga0207671_10251332 | 3300025914 | Bacteria | 1390 |
| 223 | Ga0207671_10260537 | 3300025914 | Bacteria | 1365 |
| 224 | Ga0207693_10001611 | 3300025915 | Bacteria | 19946 |
| 225 | Ga0207693_10003415 | 3300025915 | Bacteria | 13558 |
| 226 | Ga0207693_10011098 | 3300025915 | Bacteria | 7299 |
| 227 | Ga0207693_10028408 | 3300025915 | Bacteria | 4420 |
| 228 | Ga0207693_10235892 | 3300025915 | Unclassified | 1436 |
| 229 | Ga0207693_10754417 | 3300025915 | Unclassified | 752 |
| 230 | Ga0207663_10003279 | 3300025916 | Bacteria | 7895 |
| 231 | Ga0207663_10007761 | 3300025916 | Bacteria | 5587 |
| 232 | Ga0207663_10030925 | 3300025916 | Bacteria | 3163 |
| 233 | Ga0207663_10095824 | 3300025916 | Bacteria | 1980 |
| 234 | Ga0207663_10276687 | 3300025916 | Bacteria | 1245 |
| 235 | Ga0207663_10549303 | 3300025916 | Bacteria | 903 |
| 236 | Ga0207660_10542505 | 3300025917 | Unclassified | 945 |
| 237 | Ga0207649_10784351 | 3300025920 | Unclassified | 743 |
| 238 | Ga0207646_10002174 | 3300025922 | Bacteria | 23395 |
| 239 | Ga0207646_10762837 | 3300025922 | Bacteria | 863 |
| 240 | Ga0207687_10123686 | 3300025927 | Bacteria | 1939 |
| 241 | Ga0207687_10191406 | 3300025927 | Bacteria | 1592 |
| 242 | Ga0207700_10007604 | 3300025928 | Bacteria | 6644 |
| 243 | Ga0207700_10089453 | 3300025928 | Bacteria | 2427 |
| 244 | Ga0207700_10099818 | 3300025928 | Unclassified | 2312 |
| 245 | Ga0207700_10126212 | 3300025928 | Bacteria | 2082 |
| 246 | Ga0207700_10451368 | 3300025928 | Bacteria | 1133 |
| 247 | Ga0207700_10471619 | 3300025928 | Bacteria | 1108 |
| 248 | Ga0207664_10011514 | 3300025929 | Bacteria | 6293 |
| 249 | Ga0207664_10087334 | 3300025929 | Unclassified | 2549 |
| 250 | Ga0207664_10415390 | 3300025929 | Unclassified | 1198 |
| 251 | Ga0207664_10441677 | 3300025929 | Bacteria | 1160 |
| 252 | Ga0207664_10629063 | 3300025929 | Unclassified | 964 |
| 253 | Ga0207644_10098045 | 3300025931 | Bacteria | 2196 |
| 254 | Ga0207644_10609708 | 3300025931 | Unclassified | 907 |
| 255 | Ga0207686_10035589 | 3300025934 | Unclassified | 2990 |
| 256 | Ga0207686_10070848 | 3300025934 | Bacteria | 2241 |
| 257 | Ga0207709_10495942 | 3300025935 | Unclassified | 952 |
| 258 | Ga0207665_10003482 | 3300025939 | Bacteria | 10512 |
| 259 | Ga0207665_10021448 | 3300025939 | Bacteria | 4247 |
| 260 | Ga0207665_10119527 | 3300025939 | Bacteria | 1860 |
| 261 | Ga0207665_10264713 | 3300025939 | Bacteria | 1275 |
| 262 | Ga0207665_10270342 | 3300025939 | Bacteria | 1262 |
| 263 | Ga0207665_10303043 | 3300025939 | Bacteria | 1195 |
| 264 | Ga0207665_10476261 | 3300025939 | Unclassified | 961 |
| 265 | Ga0207665_10629846 | 3300025939 | Bacteria | 839 |
| 266 | Ga0207665_10808852 | 3300025939 | Unclassified | 741 |
| 267 | Ga0207665_10811005 | 3300025939 | Unclassified | 740 |
| 268 | Ga0207665_11424368 | 3300025939 | Bacteria | 551 |
| 269 | Ga0207711_10030934 | 3300025941 | Bacteria | 4516 |
| 270 | Ga0207711_10568240 | 3300025941 | Bacteria | 1058 |
| 271 | Ga0207689_10226074 | 3300025942 | Bacteria | 1547 |
| 272 | Ga0207667_10030456 | 3300025949 | Bacteria | 5837 |
| 273 | Ga0207667_10486332 | 3300025949 | Unclassified | 1253 |
| 274 | Ga0207651_10159473 | 3300025960 | Bacteria | 1767 |
| 275 | Ga0207712_10388068 | 3300025961 | Bacteria | 1170 |
| 276 | Ga0207640_10832991 | 3300025981 | Unclassified | 801 |
| 277 | Ga0207658_10419328 | 3300025986 | Bacteria | 1180 |
| 278 | Ga0207703_10035663 | 3300026035 | Unclassified | 3953 |
| 279 | Ga0207703_10605944 | 3300026035 | Bacteria | 1036 |
| 280 | Ga0207639_10000005 | 3300026041 | Bacteria | 579948 |
| 281 | Ga0207702_10084320 | 3300026078 | Bacteria | 2766 |
| 282 | Ga0207702_10164217 | 3300026078 | Unclassified | 2030 |
| 283 | Ga0207702_10274879 | 3300026078 | Bacteria | 1590 |
| 284 | Ga0207641_10030399 | 3300026088 | Bacteria | 4475 |
| 285 | Ga0207641_11503273 | 3300026088 | Unclassified | 675 |
| 286 | Ga0207675_100418695 | 3300026118 | Bacteria | 1323 |
| 287 | Ga0207683_10015303 | 3300026121 | Bacteria | 6531 |
| 288 | Ga0207698_10180503 | 3300026142 | Bacteria | 1869 |
| 289 | Ga0265356_1012938 | 3300028017 | Bacteria | 914 |
| 290 | Ga0268266_10034146 | 3300028379 | Unclassified | 4325 |
| 291 | Ga0268266_10288197 | 3300028379 | Bacteria | 1528 |
| 292 | Ga0268264_10014108 | 3300028381 | Bacteria | 6570 |
| 293 | Ga0268264_10049788 | 3300028381 | Bacteria | 3487 |
| 294 | Ga0268264_10633992 | 3300028381 | Bacteria | 1056 |
| 295 | Ga0268264_11320271 | 3300028381 | Unclassified | 732 |
| 296 | Ga0307511_10044772 | 3300030521 | Unclassified | 3669 |
| 297 | Ga0265762_1000154 | 3300030760 | Bacteria | 10728 |
| 298 | Ga0265760_10123995 | 3300031090 | Unclassified | 831 |
| 299 | Ga0373934_0167246 | 3300035086 | Bacteria | 902 |
| 300 | Ga0373944_0203323 | 3300035089 | Unclassified | 718 |
| 301 | Ga0373932_0337345 | 3300035112 | Unclassified | 570 |
| 302 | Ga0373954_0461842 | 3300035118 | Unclassified | 629 |
| 303 | Ga0373956_0018588 | 3300035119 | Bacteria | 2944 |
| 304 | Ga0373956_0097557 | 3300035119 | Unclassified | 1360 |
| 305 | Ga0373943_0367289 | 3300035170 | Unclassified | 827 |
| 306 | Ga0373943_0480654 | 3300035170 | Unclassified | 724 |
| 307 | Ga0373943_0695695 | 3300035170 | Unclassified | 602 |
| 308 | Ga0373955_0036861 | 3300035172 | Bacteria | 2598 |
| 309 | Ga0373955_0193679 | 3300035172 | Unclassified | 1209 |
| 310 | Ga0373955_0259575 | 3300035172 | Unclassified | 1043 |
| 311 | Ga0373931_0057564 | 3300035691 | Unclassified | 2085 |
| 312 | Ga0373935_0288154 | 3300035692 | Unclassified | 1158 |
| 313 | Ga0373935_0743735 | 3300035692 | Unclassified | 722 |
| 314 | Ga0373927_0002916 | 3300035695 | Bacteria | 12441 |
| 315 | Ga0373933_0010319 | 3300035724 | Bacteria | 5119 |
| 316 | Ga0373933_0209557 | 3300035724 | Bacteria | 1248 |
| 317 | Ga0373933_0340433 | 3300035724 | Viruses | 974 |
| 318 | Ga0373947_0057922 | 3300035725 | Unclassified | 2346 |
| 319 | Ga0373947_0394529 | 3300035725 | Unclassified | 933 |
| 320 | Ga0373947_0688565 | 3300035725 | Unclassified | 697 |
| 321 | Ga0373937_0087093 | 3300036401 | Unclassified | 2890 |
| 322 | Ga0373937_0090715 | 3300036401 | Bacteria | 2830 |
| 323 | Ga0373937_0193567 | 3300036401 | Unclassified | 1911 |
| 324 | Ga0373925_0307054 | 3300037068 | Unclassified | 1282 |
| 325 | Ga0373925_0389956 | 3300037068 | Unclassified | 1135 |
| 326 | Ga0373925_0484981 | 3300037068 | Unclassified | 1014 |
| 327 | Ga0373925_0873576 | 3300037068 | Unclassified | 741 |
| 328 | Ga0395900_0428907 | 3300037418 | Bacteria | 1282 |
| 329 | Ga0395898_0081221 | 3300037466 | Bacteria | 3126 |
| 330 | Ga0436364_0837200 | 3300037853 | Unclassified | 664 |
| 331 | Ga0436365_0678905 | 3300039437 | Bacteria | 1033 |
| 332 | Ga0436365_1043451 | 3300039437 | Bacteria | 5015 |
| 333 | Ga0436365_1157401 | 3300039437 | Bacteria | 526 |
| 334 | Ga0436361_0779106 | 3300039447 | Unclassified | 787 |
| 335 | Ga0436363_0170048 | 3300039450 | Bacteria | 611 |
| 336 | Ga0436362_0001144 | 3300039453 | Bacteria | 2041 |
| 337 | Ga0436362_0190854 | 3300039453 | Bacteria | 1816 |
| 338 | Ga0466964_0081045 | 3300044706 | Bacteria | 1393 |
| 339 | Ga0451576_2604880 | 3300045051 | Unclassified | 516 |
| 340 | Ga0466967_0124762 | 3300045976 | Bacteria | 2384 |
| 341 | Ga0495592_0554979 | 3300046454 | Unclassified | 706 |
| 342 | Ga0495629_0430921 | 3300046459 | Bacteria | 894 |
| 343 | Ga0495651_0097897 | 3300046462 | Unclassified | 2190 |
| 344 | Ga0495651_0283196 | 3300046462 | Unclassified | 1119 |
| 345 | Ga0495653_0859920 | 3300046463 | Unclassified | 542 |
| 346 | Ga0495580_0000109 | 3300046472 | Bacteria | 55386 |
| 347 | Ga0495580_0008007 | 3300046472 | Bacteria | 8446 |
| 348 | Ga0495580_0027002 | 3300046472 | Unclassified | 4181 |
| 349 | Ga0495580_0032424 | 3300046472 | Bacteria | 3771 |
| 350 | Ga0495580_0062791 | 3300046472 | Unclassified | 2606 |
| 351 | Ga0495580_0231404 | 3300046472 | Unclassified | 1269 |
| 352 | Ga0495580_0267542 | 3300046472 | Bacteria | 1168 |
| 353 | Ga0495580_0896428 | 3300046472 | Bacteria | 570 |
| 354 | Ga0495582_0265084 | 3300046473 | Unclassified | 985 |
| 355 | Ga0495639_0661295 | 3300046475 | Unclassified | 539 |
| 356 | Ga0495662_0251847 | 3300046476 | Unclassified | 870 |
| 357 | Ga0495664_0021092 | 3300046477 | Bacteria | 3763 |
| 358 | Ga0495664_0238673 | 3300046477 | Unclassified | 1100 |
| 359 | Ga0495628_0442868 | 3300046516 | Bacteria | 944 |
| 360 | Ga0495628_0573986 | 3300046516 | Bacteria | 808 |
| 361 | Ga0495628_0700408 | 3300046516 | Unclassified | 715 |
| 362 | Ga0495628_0771949 | 3300046516 | Bacteria | 674 |
| 363 | Ga0495630_0084290 | 3300046517 | Unclassified | 2400 |
| 364 | Ga0495630_0117552 | 3300046517 | Bacteria | 2016 |
| 365 | Ga0495652_0287631 | 3300046529 | Bacteria | 1201 |
| 366 | Ga0495652_0345875 | 3300046529 | Bacteria | 1067 |
| 367 | Ga0495665_0053169 | 3300046531 | Unclassified | 2143 |
| 368 | Ga0495665_0254914 | 3300046531 | Unclassified | 903 |
| 369 | Ga0495665_0391975 | 3300046531 | Unclassified | 705 |
| 370 | Ga0495665_0608031 | 3300046531 | Bacteria | 546 |
| 371 | Ga0495587_0079250 | 3300046536 | Unclassified | 1905 |
| 372 | Ga0495645_0228263 | 3300046543 | Bacteria | 1248 |
| 373 | Ga0495645_0323782 | 3300046543 | Unclassified | 1000 |
| 374 | Ga0495645_0688339 | 3300046543 | Unclassified | 622 |
| 375 | Ga0495667_0290930 | 3300046559 | Unclassified | 1036 |
| 376 | Ga0495667_0348985 | 3300046559 | Unclassified | 935 |
| 377 | Ga0495667_0846805 | 3300046559 | Bacteria | 562 |
| 378 | Ga0495635_0703266 | 3300046663 | Unclassified | 655 |
| 379 | Ga0495657_0690794 | 3300046675 | Unclassified | 587 |
| 380 | Ga0495599_0375949 | 3300046678 | Bacteria | 849 |
| 381 | Ga0495623_0097093 | 3300046679 | Bacteria | 1800 |
| 382 | Ga0495623_0113401 | 3300046679 | Bacteria | 1640 |
| 383 | Ga0495646_0327918 | 3300046680 | Unclassified | 805 |
| 384 | Ga0495647_0027723 | 3300046681 | Unclassified | 2083 |
| 385 | Ga0495647_0068353 | 3300046681 | Bacteria | 1417 |
| 386 | Ga0495658_0015535 | 3300046683 | Unclassified | 3906 |
| 387 | Ga0495658_0193158 | 3300046683 | Unclassified | 1266 |
| 388 | Ga0495658_0400457 | 3300046683 | Bacteria | 875 |
| 389 | Ga0495600_0156749 | 3300046809 | Bacteria | 1473 |
| 390 | Ga0495604_0291760 | 3300047317 | Unclassified | 1098 |
| 391 | Ga0495604_0357746 | 3300047317 | Bacteria | 969 |
| 392 | Ga0495604_0449322 | 3300047317 | Unclassified | 842 |
| 393 | Ga0495674_0027377 | 3300047319 | Bacteria | 5210 |
| 394 | Ga0495674_0046743 | 3300047319 | Unclassified | 3842 |
| 395 | Ga0495674_0118742 | 3300047319 | Bacteria | 2236 |
| 396 | Ga0495674_0291021 | 3300047319 | Unclassified | 1336 |
| 397 | Ga0495675_0008148 | 3300047444 | Bacteria | 6486 |
| 398 | Ga0495675_0127900 | 3300047444 | Unclassified | 1580 |
| 399 | Ga0495675_0265588 | 3300047444 | Unclassified | 1027 |
| 400 | Ga0495684_0094636 | 3300047471 | Unclassified | 2262 |
| 401 | Ga0495602_0007463 | 3300048088 | Bacteria | 11438 |
| 402 | Ga0495602_0124406 | 3300048088 | Bacteria | 2069 |
| 403 | Ga0495602_0138947 | 3300048088 | Bacteria | 1926 |
| 404 | Ga0496100_0077939 | 3300048903 | Bacteria | 2229 |
| 405 | Ga0496100_0232584 | 3300048903 | Bacteria | 1357 |
| 406 | Ga0496101_0047006 | 3300048904 | Bacteria | 3097 |
| 407 | Ga0496101_0583545 | 3300048904 | Bacteria | 884 |
| 408 | Ga0496102_0005480 | 3300048905 | Bacteria | 10766 |
| 409 | Ga0496102_0006110 | 3300048905 | Bacteria | 10265 |
| 410 | Ga0496102_0063985 | 3300048905 | Bacteria | 3368 |
| 411 | Ga0496103_0059529 | 3300048906 | Bacteria | 2373 |
| 412 | Ga0496103_0234718 | 3300048906 | Unclassified | 1180 |
| 413 | Ga0496104_0083793 | 3300048907 | Unclassified | 3041 |
| 414 | Ga0496104_0166608 | 3300048907 | Unclassified | 2113 |
| 415 | Ga0496104_0215335 | 3300048907 | Bacteria | 1832 |
| 416 | Ga0496104_0277893 | 3300048907 | Bacteria | 1588 |
| 417 | Ga0496105_0112682 | 3300048908 | Unclassified | 2245 |
| 418 | Ga0496105_0214666 | 3300048908 | Bacteria | 1567 |
| 419 | Ga0496106_0068952 | 3300048909 | Unclassified | 2698 |
| 420 | Ga0496106_0267477 | 3300048909 | Unclassified | 1368 |
| 421 | Ga0496106_0337581 | 3300048909 | Bacteria | 1210 |
| 422 | Ga0496107_0249981 | 3300048910 | Bacteria | 1319 |
| 423 | Ga0496107_0277759 | 3300048910 | Bacteria | 1247 |
| 424 | Ga0496108_0078332 | 3300048911 | Bacteria | 2797 |
| 425 | Ga0496109_0193635 | 3300048912 | Bacteria | 1910 |
| 426 | Ga0496109_0722907 | 3300048912 | Unclassified | 933 |
| 427 | Ga0496109_0949944 | 3300048912 | Unclassified | 797 |
| 428 | Ga0496110_0136275 | 3300048913 | Bacteria | 2218 |
| 429 | Ga0496111_0213754 | 3300048914 | Bacteria | 1432 |
| 430 | Ga0496112_0176505 | 3300048915 | Bacteria | 2101 |
| 431 | Ga0496112_0240799 | 3300048915 | Bacteria | 1762 |
| 432 | Ga0496112_0922624 | 3300048915 | Bacteria | 795 |
| 433 | Ga0496113_0052015 | 3300048916 | Unclassified | 3058 |
| 434 | Ga0496114_0024023 | 3300048917 | Unclassified | 4974 |
| 435 | Ga0496114_0031814 | 3300048917 | Bacteria | 4340 |
| 436 | Ga0496115_0008870 | 3300048918 | Bacteria | 7453 |
| 437 | Ga0496115_0039603 | 3300048918 | Unclassified | 3744 |
| 438 | Ga0496115_0170232 | 3300048918 | Bacteria | 1801 |
| 439 | Ga0496115_0263781 | 3300048918 | Unclassified | 1416 |
| 440 | Ga0496115_1255184 | 3300048918 | Unclassified | 554 |
| 441 | nmdc:mga05p37_103504_c1 | 3300050507 | Unclassified | 3504 |
| 442 | nmdc:mga0n895_1402501_c1 | 3300050512 | Bacteria | 667 |
| 443 | nmdc:mga0n895_691115_c1 | 3300050512 | Unclassified | 1017 |
| 444 | nmdc:mga0rr50_65299_c1 | 3300050513 | Unclassified | 2756 |
| 445 | nmdc:mga0rr50_96259_c1 | 3300050513 | Bacteria | 2316 |
| 446 | nmdc:mga08x19_1145335_c1 | 3300050514 | Unclassified | 552 |
| 447 | nmdc:mga08x19_81397_c1 | 3300050514 | Bacteria | 2126 |
| 448 | nmdc:mga08x19_973695_c1 | 3300050514 | Unclassified | 603 |
| 449 | Ga0495601_0307081 | 3300053077 | Bacteria | 1033 |
| 450 | Ga0495612_0510207 | 3300053078 | Unclassified | 552 |
| 451 | Ga0495612_0607904 | 3300053078 | Unclassified | 505 |
| 452 | Ga0495619_0202645 | 3300053085 | Bacteria | 1374 |
| 453 | Ga0500637_0099180 | 3300053178 | Unclassified | 1689 |
| 454 | Ga0500637_0241002 | 3300053178 | Unclassified | 1013 |
| 455 | nmdc:mga0n895_337440_c2 | |||
| 456 | MBSR1b_contig_297530 | |||
| 457 | MBSR1b_contig_4117783 | |||
| 458 | Ga0065715_10045757 | |||
| 459 | Ga0070666_10049568 | |||
| 460 | Ga0068868_100093962 | |||
| 461 | Ga0070671_100103198 | |||
| 462 | Ga0070673_101004693 | |||
| 463 | Ga0070667_100123941 | |||
| 464 | Ga0070667_100429312 | |||
| 465 | Ga0070709_10124976 | |||
| 466 | Ga0070709_10485779 | |||
| 467 | Ga0070709_10959530 | |||
| 468 | Ga0070709_11042018 | |||
| 469 | Ga0070714_100011162 | |||
| 470 | Ga0070714_100632191 | |||
| 471 | Ga0070714_100771973 | |||
| 472 | Ga0070713_100004645 | |||
| 473 | Ga0070713_100016558 | |||
| 474 | Ga0070713_100022025 | |||
| 475 | Ga0070713_100028159 | |||
| 476 | Ga0070713_100061753 | |||
| 477 | Ga0070713_100091332 | |||
| 478 | Ga0070713_100107138 | |||
| 479 | Ga0070713_100218314 | |||
| 480 | Ga0070713_100334524 | |||
| 481 | Ga0070713_102219344 | |||
| 482 | Ga0070710_10076307 | |||
| 483 | Ga0070710_10230574 | |||
| 484 | Ga0070710_10332363 | |||
| 485 | Ga0070710_10489373 | |||
| 486 | Ga0070711_100007260 | |||
| 487 | Ga0070711_100095957 | |||
| 488 | Ga0070711_100110228 | |||
| 489 | Ga0070711_100125652 | |||
| 490 | Ga0070711_100126493 | |||
| 491 | Ga0070711_100593934 | |||
| 492 | Ga0070711_100594024 | |||
| 493 | Ga0070705_100237928 | |||
| 494 | Ga0070705_100250453 | |||
| 495 | Ga0070694_100092946 | |||
| 496 | Ga0070694_100235040 | |||
| 497 | Ga0070694_101493791 | |||
| 498 | Ga0070708_100010242 | |||
| 499 | Ga0070678_100153876 | |||
| 500 | Ga0070681_10005961 | |||
| 501 | Ga0070706_100038440 | |||
| 502 | Ga0070706_100286071 | |||
| 503 | Ga0070706_100435726 | |||
| 504 | Ga0070707_100002475 | |||
| 505 | Ga0070707_100629435 | |||
| 506 | Ga0070699_100025802 | |||
| 507 | Ga0070699_100451618 | |||
| 508 | Ga0070697_100002758 | |||
| 509 | Ga0070697_100026789 | |||
| 510 | Ga0070697_100028167 | |||
| 511 | Ga0070697_100196572 | |||
| 512 | Ga0070697_100458203 | |||
| 513 | Ga0070697_100673730 | |||
| 514 | Ga0068853_100028265 | |||
| 515 | Ga0068853_100344974 | |||
| 516 | Ga0070686_100151041 | |||
| 517 | Ga0070686_101134727 | |||
| 518 | Ga0070695_100010359 | |||
| 519 | Ga0070695_100036972 | |||
| 520 | Ga0070665_100031286 | |||
| 521 | Ga0070665_100123006 | |||
| 522 | Ga0070704_100038720 | |||
| 523 | Ga0068855_100123109 | |||
| 524 | Ga0068855_101076788 | |||
| 525 | Ga0068854_101934730 | |||
| 526 | Ga0068856_100097887 | |||
| 527 | Ga0068856_100239801 | |||
| 528 | Ga0068856_100337049 | |||
| 529 | Ga0070702_100463457 | |||
| 530 | Ga0070702_101836032 | |||
| 531 | Ga0068852_100171686 | |||
| 532 | Ga0068859_100417484 | |||
| 533 | Ga0068861_100204035 | |||
| 534 | Ga0068863_100119640 | |||
| 535 | Ga0068858_100081033 | |||
| 536 | Ga0068858_100111862 | |||
| 537 | Ga0068858_100858042 | |||
| 538 | Ga0068860_100019477 | |||
| 539 | Ga0068860_100041721 | |||
| 540 | Ga0068860_100123517 | |||
| 541 | Ga0068860_101355833 | |||
| 542 | Ga0070717_10099855 | |||
| 543 | Ga0070717_10101344 | |||
| 544 | Ga0070717_10112015 | |||
| 545 | Ga0070717_10210549 | |||
| 546 | Ga0070717_11769931 | |||
| 547 | Ga0070715_10040453 | |||
| 548 | Ga0070715_10043760 | |||
| 549 | Ga0070715_10352042 | |||
| 550 | Ga0070715_10441280 | |||
| 551 | Ga0070716_100008459 | |||
| 552 | Ga0070716_100034807 | |||
| 553 | Ga0070716_100046573 | |||
| 554 | Ga0070716_100322498 | |||
| 555 | Ga0070716_100697455 | |||
| 556 | Ga0070716_100810528 | |||
| 557 | Ga0070716_100859173 | |||
| 558 | Ga0070716_100888997 | |||
| 559 | Ga0070716_100981619 | |||
| 560 | Ga0070712_100004423 | |||
| 561 | Ga0070712_100011279 | |||
| 562 | Ga0070712_100025817 | |||
| 563 | Ga0070712_100055047 | |||
| 564 | Ga0070712_100101790 | |||
| 565 | Ga0070712_100229072 | |||
| 566 | Ga0070712_101140196 | |||
| 567 | Ga0097621_100002000 | |||
| 568 | Ga0097621_100271461 | |||
| 569 | Ga0068871_100000420 | |||
| 570 | Ga0068871_100204910 | |||
| 571 | Ga0068871_100482655 | |||
| 572 | Ga0068871_100825092 | |||
| 573 | Ga0075434_100071864 | |||
| 574 | Ga0075434_100619529 | |||
| 575 | Ga0075434_100998095 | |||
| 576 | Ga0068865_100009180 | |||
| 577 | Ga0075436_100030044 | |||
| 578 | Ga0075436_100326581 | |||
| 579 | Ga0075436_100394444 | |||
| 580 | Ga0097620_100417415 | |||
| 581 | Ga0075435_100008980 | |||
| 582 | Ga0075435_100021929 | |||
| 583 | Ga0075435_100056055 | |||
| 584 | Ga0075435_101847928 | |||
| 585 | Ga0099795_10029639 | |||
| 586 | Ga0099795_10254610 | |||
| 587 | Ga0099795_10622717 | |||
| 588 | Ga0105250_10152191 | |||
| 589 | Ga0105240_10004870 | |||
| 590 | Ga0105240_10018036 | |||
| 591 | Ga0105240_10275451 | |||
| 592 | Ga0105240_10883311 | |||
| 593 | Ga0105240_11314211 | |||
| 594 | Ga0105245_10017176 | |||
| 595 | Ga0105245_10029261 | |||
| 596 | Ga0105245_10499253 | |||
| 597 | Ga0105247_10007916 | |||
| 598 | Ga0105247_10054324 | |||
| 599 | Ga0105247_10585663 | |||
| 600 | Ga0114129_10034673 | |||
| 601 | Ga0114129_10120149 | |||
| 602 | Ga0105243_10761409 | |||
| 603 | Ga0105241_10016454 | |||
| 604 | Ga0105241_10041043 | |||
| 605 | Ga0105241_11740534 | |||
| 606 | Ga0105242_10013066 | |||
| 607 | Ga0105248_10047048 | |||
| 608 | Ga0105248_10317900 | |||
| 609 | Ga0105248_10672718 | |||
| 610 | Ga0105248_10750225 | |||
| 611 | Ga0105237_10023794 | |||
| 612 | Ga0105237_10287321 | |||
| 613 | Ga0105238_10511063 | |||
| 614 | Ga0105238_10733784 | |||
| 615 | Ga0105238_12347156 | |||
| 616 | Ga0105249_10166051 | |||
| 617 | Ga0099796_10305350 | |||
| 618 | Ga0105239_10073271 | |||
| 619 | Ga0157370_10809663 | |||
| 620 | Ga0157370_11857676 | |||
| 621 | Ga0157369_10000432 | |||
| 622 | Ga0157374_10004401 | |||
| 623 | Ga0157374_10202702 | |||
| 624 | Ga0157374_10296003 | |||
| 625 | Ga0157374_10938362 | |||
| 626 | Ga0157378_10002089 | |||
| 627 | Ga0157378_10139425 | |||
| 628 | Ga0157378_11095922 | |||
| 629 | Ga0157378_11507090 | |||
| 630 | Ga0163162_10052314 | |||
| 631 | Ga0163162_10267514 | |||
| 632 | Ga0163162_10314184 | |||
| 633 | Ga0163162_11061090 | |||
| 634 | Ga0157372_10091424 | |||
| 635 | Ga0157372_10433679 | |||
| 636 | Ga0157372_10505910 | |||
| 637 | Ga0157372_10903985 | |||
| 638 | Ga0157375_10610416 | |||
| 639 | Ga0163163_10027058 | |||
| 640 | Ga0157379_10018006 | |||
| 641 | Ga0157379_10085555 | |||
| 642 | Ga0157379_10342207 | |||
| 643 | Ga0157379_12414704 | |||
| 644 | Ga0157376_10000051 | |||
| 645 | Ga0157376_10217775 | |||
| 646 | Ga0213873_10032748 | |||
| 647 | Ga0213876_10025390 | |||
| 648 | Ga0228598_1032622 | |||
| 649 | Ga0207692_10136995 | |||
| 650 | Ga0207692_10139892 | |||
| 651 | Ga0207692_10434647 | |||
| 652 | Ga0207710_10033056 | |||
| 653 | Ga0207710_10255841 | |||
| 654 | Ga0207680_10285721 | |||
| 655 | Ga0207685_10076014 | |||
| 656 | Ga0207685_10097076 | |||
| 657 | Ga0207685_10280156 | |||
| 658 | Ga0207685_10330362 | |||
| 659 | Ga0207699_10021707 | |||
| 660 | Ga0207699_10028296 | |||
| 661 | Ga0207699_10147649 | |||
| 662 | Ga0207699_10261315 | |||
| 663 | Ga0207699_10442330 | |||
| 664 | Ga0207699_10485677 | |||
| 665 | Ga0207699_10949254 | |||
| 666 | Ga0207699_10958403 | |||
| 667 | Ga0207684_10006421 | |||
| 668 | Ga0207684_10006479 | |||
| 669 | Ga0207684_10094780 | |||
| 670 | Ga0207684_10197235 | |||
| 671 | Ga0207654_10043277 | |||
| 672 | Ga0207707_10004860 | |||
| 673 | Ga0207707_10109010 | |||
| 674 | Ga0207695_10004359 | |||
| 675 | Ga0207695_10422791 | |||
| 676 | Ga0207671_10251332 | |||
| 677 | Ga0207671_10260537 | |||
| 678 | Ga0207693_10001611 | |||
| 679 | Ga0207693_10003415 | |||
| 680 | Ga0207693_10011098 | |||
| 681 | Ga0207693_10028408 | |||
| 682 | Ga0207693_10235892 | |||
| 683 | Ga0207693_10754417 | |||
| 684 | Ga0207663_10003279 | |||
| 685 | Ga0207663_10007761 | |||
| 686 | Ga0207663_10030925 | |||
| 687 | Ga0207663_10095824 | |||
| 688 | Ga0207663_10276687 | |||
| 689 | Ga0207663_10549303 | |||
| 690 | Ga0207660_10542505 | |||
| 691 | Ga0207649_10784351 | |||
| 692 | Ga0207646_10002174 | |||
| 693 | Ga0207646_10762837 | |||
| 694 | Ga0207687_10123686 | |||
| 695 | Ga0207687_10191406 | |||
| 696 | Ga0207700_10007604 | |||
| 697 | Ga0207700_10089453 | |||
| 698 | Ga0207700_10099818 | |||
| 699 | Ga0207700_10126212 | |||
| 700 | Ga0207700_10451368 | |||
| 701 | Ga0207700_10471619 | |||
| 702 | Ga0207664_10011514 | |||
| 703 | Ga0207664_10087334 | |||
| 704 | Ga0207664_10415390 | |||
| 705 | Ga0207664_10441677 | |||
| 706 | Ga0207664_10629063 | |||
| 707 | Ga0207644_10098045 | |||
| 708 | Ga0207644_10609708 | |||
| 709 | Ga0207686_10035589 | |||
| 710 | Ga0207686_10070848 | |||
| 711 | Ga0207709_10495942 | |||
| 712 | Ga0207665_10003482 | |||
| 713 | Ga0207665_10021448 | |||
| 714 | Ga0207665_10119527 | |||
| 715 | Ga0207665_10264713 | |||
| 716 | Ga0207665_10270342 | |||
| 717 | Ga0207665_10303043 | |||
| 718 | Ga0207665_10476261 | |||
| 719 | Ga0207665_10629846 | |||
| 720 | Ga0207665_10808852 | |||
| 721 | Ga0207665_10811005 | |||
| 722 | Ga0207665_11424368 | |||
| 723 | Ga0207711_10030934 | |||
| 724 | Ga0207711_10568240 | |||
| 725 | Ga0207689_10226074 | |||
| 726 | Ga0207667_10030456 | |||
| 727 | Ga0207667_10486332 | |||
| 728 | Ga0207651_10159473 | |||
| 729 | Ga0207712_10388068 | |||
| 730 | Ga0207640_10832991 | |||
| 731 | Ga0207658_10419328 | |||
| 732 | Ga0207703_10035663 | |||
| 733 | Ga0207703_10605944 | |||
| 734 | Ga0207639_10000005 | |||
| 735 | Ga0207702_10084320 | |||
| 736 | Ga0207702_10164217 | |||
| 737 | Ga0207702_10274879 | |||
| 738 | Ga0207641_10030399 | |||
| 739 | Ga0207641_11503273 | |||
| 740 | Ga0207675_100418695 | |||
| 741 | Ga0207683_10015303 | |||
| 742 | Ga0207698_10180503 | |||
| 743 | Ga0265356_1012938 | |||
| 744 | Ga0268266_10034146 | |||
| 745 | Ga0268266_10288197 | |||
| 746 | Ga0268264_10014108 | |||
| 747 | Ga0268264_10049788 | |||
| 748 | Ga0268264_10633992 | |||
| 749 | Ga0268264_11320271 | |||
| 750 | Ga0307511_10044772 | |||
| 751 | Ga0265762_1000154 | |||
| 752 | Ga0265760_10123995 | |||
| 753 | Ga0373934_0167246 | |||
| 754 | Ga0373944_0203323 | |||
| 755 | Ga0373932_0337345 | |||
| 756 | Ga0373954_0461842 | |||
| 757 | Ga0373956_0018588 | |||
| 758 | Ga0373956_0097557 | |||
| 759 | Ga0373943_0367289 | |||
| 760 | Ga0373943_0480654 | |||
| 761 | Ga0373943_0695695 | |||
| 762 | Ga0373955_0036861 | |||
| 763 | Ga0373955_0193679 | |||
| 764 | Ga0373955_0259575 | |||
| 765 | Ga0373931_0057564 | |||
| 766 | Ga0373935_0288154 | |||
| 767 | Ga0373935_0743735 | |||
| 768 | Ga0373927_0002916 | |||
| 769 | Ga0373933_0010319 | |||
| 770 | Ga0373933_0209557 | |||
| 771 | Ga0373933_0340433 | |||
| 772 | Ga0373947_0057922 | |||
| 773 | Ga0373947_0394529 | |||
| 774 | Ga0373947_0688565 | |||
| 775 | Ga0373937_0087093 | |||
| 776 | Ga0373937_0090715 | |||
| 777 | Ga0373937_0193567 | |||
| 778 | Ga0373925_0307054 | |||
| 779 | Ga0373925_0389956 | |||
| 780 | Ga0373925_0484981 | |||
| 781 | Ga0373925_0873576 | |||
| 782 | Ga0395900_0428907 | |||
| 783 | Ga0395898_0081221 | |||
| 784 | Ga0436364_0837200 | |||
| 785 | Ga0436365_0678905 | |||
| 786 | Ga0436365_1043451 | |||
| 787 | Ga0436365_1157401 | |||
| 788 | Ga0436361_0779106 | |||
| 789 | Ga0436363_0170048 | |||
| 790 | Ga0436362_0001144 | |||
| 791 | Ga0436362_0190854 | |||
| 792 | Ga0466964_0081045 | |||
| 793 | Ga0451576_2604880 | |||
| 794 | Ga0466967_0124762 | |||
| 795 | Ga0495592_0554979 | |||
| 796 | Ga0495629_0430921 | |||
| 797 | Ga0495651_0097897 | |||
| 798 | Ga0495651_0283196 | |||
| 799 | Ga0495653_0859920 | |||
| 800 | Ga0495580_0000109 | |||
| 801 | Ga0495580_0008007 | |||
| 802 | Ga0495580_0027002 | |||
| 803 | Ga0495580_0032424 | |||
| 804 | Ga0495580_0062791 | |||
| 805 | Ga0495580_0231404 | |||
| 806 | Ga0495580_0267542 | |||
| 807 | Ga0495580_0896428 | |||
| 808 | Ga0495582_0265084 | |||
| 809 | Ga0495639_0661295 | |||
| 810 | Ga0495662_0251847 | |||
| 811 | Ga0495664_0021092 | |||
| 812 | Ga0495664_0238673 | |||
| 813 | Ga0495628_0442868 | |||
| 814 | Ga0495628_0573986 | |||
| 815 | Ga0495628_0700408 | |||
| 816 | Ga0495628_0771949 | |||
| 817 | Ga0495630_0084290 | |||
| 818 | Ga0495630_0117552 | |||
| 819 | Ga0495652_0287631 | |||
| 820 | Ga0495652_0345875 | |||
| 821 | Ga0495665_0053169 | |||
| 822 | Ga0495665_0254914 | |||
| 823 | Ga0495665_0391975 | |||
| 824 | Ga0495665_0608031 | |||
| 825 | Ga0495587_0079250 | |||
| 826 | Ga0495645_0228263 | |||
| 827 | Ga0495645_0323782 | |||
| 828 | Ga0495645_0688339 | |||
| 829 | Ga0495667_0290930 | |||
| 830 | Ga0495667_0348985 | |||
| 831 | Ga0495667_0846805 | |||
| 832 | Ga0495635_0703266 | |||
| 833 | Ga0495657_0690794 | |||
| 834 | Ga0495599_0375949 | |||
| 835 | Ga0495623_0097093 | |||
| 836 | Ga0495623_0113401 | |||
| 837 | Ga0495646_0327918 | |||
| 838 | Ga0495647_0027723 | |||
| 839 | Ga0495647_0068353 | |||
| 840 | Ga0495658_0015535 | |||
| 841 | Ga0495658_0193158 | |||
| 842 | Ga0495658_0400457 | |||
| 843 | Ga0495600_0156749 | |||
| 844 | Ga0495604_0291760 | |||
| 845 | Ga0495604_0357746 | |||
| 846 | Ga0495604_0449322 | |||
| 847 | Ga0495674_0027377 | |||
| 848 | Ga0495674_0046743 | |||
| 849 | Ga0495674_0118742 | |||
| 850 | Ga0495674_0291021 | |||
| 851 | Ga0495675_0008148 | |||
| 852 | Ga0495675_0127900 | |||
| 853 | Ga0495675_0265588 | |||
| 854 | Ga0495684_0094636 | |||
| 855 | Ga0495602_0007463 | |||
| 856 | Ga0495602_0124406 | |||
| 857 | Ga0495602_0138947 | |||
| 858 | Ga0496100_0077939 | |||
| 859 | Ga0496100_0232584 | |||
| 860 | Ga0496101_0047006 | |||
| 861 | Ga0496101_0583545 | |||
| 862 | Ga0496102_0005480 | |||
| 863 | Ga0496102_0006110 | |||
| 864 | Ga0496102_0063985 | |||
| 865 | Ga0496103_0059529 | |||
| 866 | Ga0496103_0234718 | |||
| 867 | Ga0496104_0083793 | |||
| 868 | Ga0496104_0166608 | |||
| 869 | Ga0496104_0215335 | |||
| 870 | Ga0496104_0277893 | |||
| 871 | Ga0496105_0112682 | |||
| 872 | Ga0496105_0214666 | |||
| 873 | Ga0496106_0068952 | |||
| 874 | Ga0496106_0267477 | |||
| 875 | Ga0496106_0337581 | |||
| 876 | Ga0496107_0249981 | |||
| 877 | Ga0496107_0277759 | |||
| 878 | Ga0496108_0078332 | |||
| 879 | Ga0496109_0193635 | |||
| 880 | Ga0496109_0722907 | |||
| 881 | Ga0496109_0949944 | |||
| 882 | Ga0496110_0136275 | |||
| 883 | Ga0496111_0213754 | |||
| 884 | Ga0496112_0176505 | |||
| 885 | Ga0496112_0240799 | |||
| 886 | Ga0496112_0922624 | |||
| 887 | Ga0496113_0052015 | |||
| 888 | Ga0496114_0024023 | |||
| 889 | Ga0496114_0031814 | |||
| 890 | Ga0496115_0008870 | |||
| 891 | Ga0496115_0039603 | |||
| 892 | Ga0496115_0170232 | |||
| 893 | Ga0496115_0263781 | |||
| 894 | Ga0496115_1255184 | |||
| 895 | nmdc:mga05p37_103504_c1 | |||
| 896 | nmdc:mga0n895_1402501_c1 | |||
| 897 | nmdc:mga0n895_691115_c1 | |||
| 898 | nmdc:mga0rr50_65299_c1 | |||
| 899 | nmdc:mga0rr50_96259_c1 | |||
| 900 | nmdc:mga08x19_1145335_c1 | |||
| 901 | nmdc:mga08x19_81397_c1 | |||
| 902 | nmdc:mga08x19_973695_c1 | |||
| 903 | Ga0495601_0307081 | |||
| 904 | Ga0495612_0510207 | |||
| 905 | Ga0495612_0607904 | |||
| 906 | Ga0495619_0202645 | |||
| 907 | Ga0500637_0099180 | |||
| 908 | Ga0500637_0241002 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ne9-assembly1.cif.gz_CCC | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.8886 | 5 | 70 |
| 7ne9-assembly1.cif.gz_DDD | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.8853 | 5 | 70 |
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.8746 | 8 | 72 |
| 1sd6-assembly1.cif.gz_B | crystal structure of native meci at 2.65 a | 0.8726 | 5 | 116 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.8657 | 8 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1saxB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9015 | 7 | 70 | 1.10.10.10 |
| 1sd4B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8894 | 8 | 70 | 1.10.10.10 |
| 2d45D01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8774 | 7 | 70 | 1.10.10.10 |
| 2d45B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8769 | 7 | 70 | 1.10.10.10 |
| 1sd6A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8763 | 7 | 70 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U9N9Q2-F1-model_v4 | Penicillinase repressor | 0.9414 | 5 | 116 |
GO:0003677
GO:0045892 |
| AF-A0A416UAX6-F1-model_v4 | BlaI/MecI/CopY family transcriptional regulator | 0.9375 | 5 | 116 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-B3C5A4-F1-model_v4 | Transcriptional regulator, BlaI/MecI/CopY family | 0.9375 | 5 | 116 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-A0A840EQZ5-F1-model_v4 | Putative transcriptional regulator | 0.937 | 5 | 116 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-A0A355VMH9-F1-model_v4 | Transcriptional regulator | 0.9364 | 5 | 116 |
GO:0003677
GO:0005737 GO:0045892 |