F447472

General Info

Members Datasets Scaffolds Average Seq Length
454 194 908 132

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_337440_c2|nmdc:mga0n895_337440_c2_379_858
Length 159
Sequence MFSAGTRVCRNTHLVVVLPDDVGDGVRNRRFSKAETRILERCWKLGVCSVREILDSLPEDERVAYTTVQTLVYRLEQKGALRRVKKIGNAQMFEPALDQQQYRSGLVRDLLDLFGGSSRLLVSNLLETGALTLKDLKALESTPRRGKSSRRGQGGKRND

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
117 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
121 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 8.15
Rhizosphere 89.87
Stem 0
Stem Tuber 0
Unclassified 39.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_337440_c2 3300050512 Unclassified 994
2 MBSR1b_contig_297530 2162886012 Unclassified 908
3 MBSR1b_contig_4117783 2162886012 Unclassified 850
4 Ga0065715_10045757 3300005293 Unclassified 1370
5 Ga0070666_10049568 3300005335 Unclassified 2822
6 Ga0068868_100093962 3300005338 Bacteria 2419
7 Ga0070671_100103198 3300005355 Unclassified 2392
8 Ga0070673_101004693 3300005364 Unclassified 777
9 Ga0070667_100123941 3300005367 Bacteria 2250
10 Ga0070667_100429312 3300005367 Bacteria 1205
11 Ga0070709_10124976 3300005434 Bacteria 1749
12 Ga0070709_10485779 3300005434 Unclassified 936
13 Ga0070709_10959530 3300005434 Unclassified 678
14 Ga0070709_11042018 3300005434 Unclassified 652
15 Ga0070714_100011162 3300005435 Bacteria 7120
16 Ga0070714_100632191 3300005435 Bacteria 1029
17 Ga0070714_100771973 3300005435 Unclassified 930
18 Ga0070713_100004645 3300005436 Bacteria 9264
19 Ga0070713_100016558 3300005436 Bacteria 5544
20 Ga0070713_100022025 3300005436 Bacteria 4916
21 Ga0070713_100028159 3300005436 Unclassified 4434
22 Ga0070713_100061753 3300005436 Bacteria 3136
23 Ga0070713_100091332 3300005436 Bacteria 2619
24 Ga0070713_100107138 3300005436 Bacteria 2431
25 Ga0070713_100218314 3300005436 Bacteria 1729
26 Ga0070713_100334524 3300005436 Unclassified 1401
27 Ga0070713_102219344 3300005436 Unclassified 532
28 Ga0070710_10076307 3300005437 Bacteria 1945
29 Ga0070710_10230574 3300005437 Unclassified 1182
30 Ga0070710_10332363 3300005437 Unclassified 1001
31 Ga0070710_10489373 3300005437 Unclassified 840
32 Ga0070711_100007260 3300005439 Bacteria 6732
33 Ga0070711_100095957 3300005439 Bacteria 2147
34 Ga0070711_100110228 3300005439 Unclassified 2019
35 Ga0070711_100125652 3300005439 Bacteria 1903
36 Ga0070711_100126493 3300005439 Bacteria 1898
37 Ga0070711_100593934 3300005439 Unclassified 923
38 Ga0070711_100594024 3300005439 Bacteria 923
39 Ga0070705_100237928 3300005440 Unclassified 1271
40 Ga0070705_100250453 3300005440 Bacteria 1243
41 Ga0070694_100092946 3300005444 Bacteria 2120
42 Ga0070694_100235040 3300005444 Bacteria 1380
43 Ga0070694_101493791 3300005444 Unclassified 572
44 Ga0070708_100010242 3300005445 Bacteria 7590
45 Ga0070678_100153876 3300005456 Bacteria 1855
46 Ga0070681_10005961 3300005458 Bacteria 11799
47 Ga0070706_100038440 3300005467 Bacteria 4416
48 Ga0070706_100286071 3300005467 Unclassified 1538
49 Ga0070706_100435726 3300005467 Unclassified 1220
50 Ga0070707_100002475 3300005468 Bacteria 17599
51 Ga0070707_100629435 3300005468 Bacteria 1035
52 Ga0070699_100025802 3300005518 Bacteria 5065
53 Ga0070699_100451618 3300005518 Bacteria 1165
54 Ga0070697_100002758 3300005536 Bacteria 13523
55 Ga0070697_100026789 3300005536 Unclassified 4609
56 Ga0070697_100028167 3300005536 Bacteria 4497
57 Ga0070697_100196572 3300005536 Unclassified 1713
58 Ga0070697_100458203 3300005536 Unclassified 1111
59 Ga0070697_100673730 3300005536 Bacteria 912
60 Ga0068853_100028265 3300005539 Bacteria 4715
61 Ga0068853_100344974 3300005539 Bacteria 1384
62 Ga0070686_100151041 3300005544 Bacteria 1627
63 Ga0070686_101134727 3300005544 Unclassified 647
64 Ga0070695_100010359 3300005545 Bacteria 5565
65 Ga0070695_100036972 3300005545 Unclassified 3075
66 Ga0070665_100031286 3300005548 Bacteria 5356
67 Ga0070665_100123006 3300005548 Bacteria 2596
68 Ga0070704_100038720 3300005549 Bacteria 3269
69 Ga0068855_100123109 3300005563 Bacteria 2967
70 Ga0068855_101076788 3300005563 Unclassified 841
71 Ga0068854_101934730 3300005578 Unclassified 542
72 Ga0068856_100097887 3300005614 Bacteria 2923
73 Ga0068856_100239801 3300005614 Unclassified 1828
74 Ga0068856_100337049 3300005614 Bacteria 1526
75 Ga0070702_100463457 3300005615 Bacteria 922
76 Ga0070702_101836032 3300005615 Unclassified 507
77 Ga0068852_100171686 3300005616 Bacteria 2033
78 Ga0068859_100417484 3300005617 Bacteria 1438
79 Ga0068861_100204035 3300005719 Bacteria 1661
80 Ga0068863_100119640 3300005841 Unclassified 2510
81 Ga0068858_100081033 3300005842 Unclassified 3016
82 Ga0068858_100111862 3300005842 Bacteria 2550
83 Ga0068858_100858042 3300005842 Unclassified 887
84 Ga0068860_100019477 3300005843 Bacteria 6579
85 Ga0068860_100041721 3300005843 Bacteria 4383
86 Ga0068860_100123517 3300005843 Unclassified 2480
87 Ga0068860_101355833 3300005843 Unclassified 732
88 Ga0070717_10099855 3300006028 Bacteria 2463
89 Ga0070717_10101344 3300006028 Bacteria 2445
90 Ga0070717_10112015 3300006028 Bacteria 2329
91 Ga0070717_10210549 3300006028 Bacteria 1706
92 Ga0070717_11769931 3300006028 Unclassified 559
93 Ga0070715_10040453 3300006163 Bacteria 1949
94 Ga0070715_10043760 3300006163 Bacteria 1890
95 Ga0070715_10352042 3300006163 Unclassified 805
96 Ga0070715_10441280 3300006163 Unclassified 733
97 Ga0070716_100008459 3300006173 Bacteria 5104
98 Ga0070716_100034807 3300006173 Bacteria 2764
99 Ga0070716_100046573 3300006173 Bacteria 2441
100 Ga0070716_100322498 3300006173 Bacteria 1083
101 Ga0070716_100697455 3300006173 Bacteria 775
102 Ga0070716_100810528 3300006173 Bacteria 726
103 Ga0070716_100859173 3300006173 Bacteria 707
104 Ga0070716_100888997 3300006173 Bacteria 697
105 Ga0070716_100981619 3300006173 Bacteria 667
106 Ga0070712_100004423 3300006175 Bacteria 8668
107 Ga0070712_100011279 3300006175 Bacteria 5662
108 Ga0070712_100025817 3300006175 Bacteria 3908
109 Ga0070712_100055047 3300006175 Bacteria 2784
110 Ga0070712_100101790 3300006175 Bacteria 2126
111 Ga0070712_100229072 3300006175 Unclassified 1475
112 Ga0070712_101140196 3300006175 Bacteria 677
113 Ga0097621_100002000 3300006237 Bacteria 13908
114 Ga0097621_100271461 3300006237 Unclassified 1490
115 Ga0068871_100000420 3300006358 Bacteria 29371
116 Ga0068871_100204910 3300006358 Bacteria 1704
117 Ga0068871_100482655 3300006358 Unclassified 1115
118 Ga0068871_100825092 3300006358 Bacteria 856
119 Ga0075434_100071864 3300006871 Bacteria 3452
120 Ga0075434_100619529 3300006871 Unclassified 1101
121 Ga0075434_100998095 3300006871 Bacteria 851
122 Ga0068865_100009180 3300006881 Bacteria 6121
123 Ga0075436_100030044 3300006914 Bacteria 3739
124 Ga0075436_100326581 3300006914 Unclassified 1103
125 Ga0075436_100394444 3300006914 Unclassified 1002
126 Ga0097620_100417415 3300006931 Bacteria 1438
127 Ga0075435_100008980 3300007076 Bacteria 7207
128 Ga0075435_100021929 3300007076 Bacteria 4922
129 Ga0075435_100056055 3300007076 Bacteria 3185
130 Ga0075435_101847928 3300007076 Unclassified 530
131 Ga0099795_10029639 3300007788 Bacteria 1872
132 Ga0099795_10254610 3300007788 Bacteria 758
133 Ga0099795_10622717 3300007788 Unclassified 515
134 Ga0105250_10152191 3300009092 Bacteria 963
135 Ga0105240_10004870 3300009093 Bacteria 20201
136 Ga0105240_10018036 3300009093 Bacteria 9492
137 Ga0105240_10275451 3300009093 Bacteria 1936
138 Ga0105240_10883311 3300009093 Bacteria 963
139 Ga0105240_11314211 3300009093 Unclassified 762
140 Ga0105245_10017176 3300009098 Bacteria 6312
141 Ga0105245_10029261 3300009098 Bacteria 4866
142 Ga0105245_10499253 3300009098 Bacteria 1233
143 Ga0105247_10007916 3300009101 Bacteria 6498
144 Ga0105247_10054324 3300009101 Unclassified 2472
145 Ga0105247_10585663 3300009101 Unclassified 825
146 Ga0114129_10034673 3300009147 Bacteria 7129
147 Ga0114129_10120149 3300009147 Bacteria 3619
148 Ga0105243_10761409 3300009148 Bacteria 950
149 Ga0105241_10016454 3300009174 Bacteria 5425
150 Ga0105241_10041043 3300009174 Bacteria 3494
151 Ga0105241_11740534 3300009174 Bacteria 607
152 Ga0105242_10013066 3300009176 Bacteria 6406
153 Ga0105248_10047048 3300009177 Bacteria 4837
154 Ga0105248_10317900 3300009177 Unclassified 1753
155 Ga0105248_10672718 3300009177 Bacteria 1168
156 Ga0105248_10750225 3300009177 Bacteria 1101
157 Ga0105237_10023794 3300009545 Bacteria 6270
158 Ga0105237_10287321 3300009545 Bacteria 1647
159 Ga0105238_10511063 3300009551 Unclassified 1203
160 Ga0105238_10733784 3300009551 Bacteria 1001
161 Ga0105238_12347156 3300009551 Unclassified 569
162 Ga0105249_10166051 3300009553 Bacteria 2137
163 Ga0099796_10305350 3300010159 Unclassified 675
164 Ga0105239_10073271 3300010375 Bacteria 3765
165 Ga0157370_10809663 3300013104 Unclassified 852
166 Ga0157370_11857676 3300013104 Unclassified 540
167 Ga0157369_10000432 3300013105 Bacteria 55626
168 Ga0157374_10004401 3300013296 Bacteria 11851
169 Ga0157374_10202702 3300013296 Bacteria 1943
170 Ga0157374_10296003 3300013296 Unclassified 1600
171 Ga0157374_10938362 3300013296 Unclassified 884
172 Ga0157378_10002089 3300013297 Bacteria 17841
173 Ga0157378_10139425 3300013297 Unclassified 2251
174 Ga0157378_11095922 3300013297 Bacteria 833
175 Ga0157378_11507090 3300013297 Unclassified 717
176 Ga0163162_10052314 3300013306 Bacteria 4101
177 Ga0163162_10267514 3300013306 Bacteria 1841
178 Ga0163162_10314184 3300013306 Bacteria 1699
179 Ga0163162_11061090 3300013306 Unclassified 917
180 Ga0157372_10091424 3300013307 Bacteria 3461
181 Ga0157372_10433679 3300013307 Unclassified 1532
182 Ga0157372_10505910 3300013307 Bacteria 1408
183 Ga0157372_10903985 3300013307 Unclassified 1024
184 Ga0157375_10610416 3300013308 Unclassified 1249
185 Ga0163163_10027058 3300014325 Bacteria 5488
186 Ga0157379_10018006 3300014968 Bacteria 6226
187 Ga0157379_10085555 3300014968 Unclassified 2826
188 Ga0157379_10342207 3300014968 Bacteria 1368
189 Ga0157379_12414704 3300014968 Unclassified 525
190 Ga0157376_10000051 3300014969 Bacteria 102604
191 Ga0157376_10217775 3300014969 Bacteria 1766
192 Ga0213873_10032748 3300021358 Unclassified 1301
193 Ga0213876_10025390 3300021384 Bacteria 3126
194 Ga0228598_1032622 3300024227 Bacteria 1026
195 Ga0207692_10136995 3300025898 Bacteria 1389
196 Ga0207692_10139892 3300025898 Bacteria 1376
197 Ga0207692_10434647 3300025898 Unclassified 824
198 Ga0207710_10033056 3300025900 Unclassified 2268
199 Ga0207710_10255841 3300025900 Unclassified 876
200 Ga0207680_10285721 3300025903 Bacteria 1147
201 Ga0207685_10076014 3300025905 Bacteria 1376
202 Ga0207685_10097076 3300025905 Bacteria 1253
203 Ga0207685_10280156 3300025905 Bacteria 818
204 Ga0207685_10330362 3300025905 Unclassified 763
205 Ga0207699_10021707 3300025906 Bacteria 3466
206 Ga0207699_10028296 3300025906 Unclassified 3113
207 Ga0207699_10147649 3300025906 Bacteria 1552
208 Ga0207699_10261315 3300025906 Bacteria 1197
209 Ga0207699_10442330 3300025906 Unclassified 931
210 Ga0207699_10485677 3300025906 Bacteria 890
211 Ga0207699_10949254 3300025906 Bacteria 635
212 Ga0207699_10958403 3300025906 Unclassified 632
213 Ga0207684_10006421 3300025910 Bacteria 10717
214 Ga0207684_10006479 3300025910 Bacteria 10673
215 Ga0207684_10094780 3300025910 Unclassified 2546
216 Ga0207684_10197235 3300025910 Bacteria 1736
217 Ga0207654_10043277 3300025911 Plasmid 2552
218 Ga0207707_10004860 3300025912 Bacteria 11789
219 Ga0207707_10109010 3300025912 Unclassified 2421
220 Ga0207695_10004359 3300025913 Bacteria 19377
221 Ga0207695_10422791 3300025913 Bacteria 1216
222 Ga0207671_10251332 3300025914 Bacteria 1390
223 Ga0207671_10260537 3300025914 Bacteria 1365
224 Ga0207693_10001611 3300025915 Bacteria 19946
225 Ga0207693_10003415 3300025915 Bacteria 13558
226 Ga0207693_10011098 3300025915 Bacteria 7299
227 Ga0207693_10028408 3300025915 Bacteria 4420
228 Ga0207693_10235892 3300025915 Unclassified 1436
229 Ga0207693_10754417 3300025915 Unclassified 752
230 Ga0207663_10003279 3300025916 Bacteria 7895
231 Ga0207663_10007761 3300025916 Bacteria 5587
232 Ga0207663_10030925 3300025916 Bacteria 3163
233 Ga0207663_10095824 3300025916 Bacteria 1980
234 Ga0207663_10276687 3300025916 Bacteria 1245
235 Ga0207663_10549303 3300025916 Bacteria 903
236 Ga0207660_10542505 3300025917 Unclassified 945
237 Ga0207649_10784351 3300025920 Unclassified 743
238 Ga0207646_10002174 3300025922 Bacteria 23395
239 Ga0207646_10762837 3300025922 Bacteria 863
240 Ga0207687_10123686 3300025927 Bacteria 1939
241 Ga0207687_10191406 3300025927 Bacteria 1592
242 Ga0207700_10007604 3300025928 Bacteria 6644
243 Ga0207700_10089453 3300025928 Bacteria 2427
244 Ga0207700_10099818 3300025928 Unclassified 2312
245 Ga0207700_10126212 3300025928 Bacteria 2082
246 Ga0207700_10451368 3300025928 Bacteria 1133
247 Ga0207700_10471619 3300025928 Bacteria 1108
248 Ga0207664_10011514 3300025929 Bacteria 6293
249 Ga0207664_10087334 3300025929 Unclassified 2549
250 Ga0207664_10415390 3300025929 Unclassified 1198
251 Ga0207664_10441677 3300025929 Bacteria 1160
252 Ga0207664_10629063 3300025929 Unclassified 964
253 Ga0207644_10098045 3300025931 Bacteria 2196
254 Ga0207644_10609708 3300025931 Unclassified 907
255 Ga0207686_10035589 3300025934 Unclassified 2990
256 Ga0207686_10070848 3300025934 Bacteria 2241
257 Ga0207709_10495942 3300025935 Unclassified 952
258 Ga0207665_10003482 3300025939 Bacteria 10512
259 Ga0207665_10021448 3300025939 Bacteria 4247
260 Ga0207665_10119527 3300025939 Bacteria 1860
261 Ga0207665_10264713 3300025939 Bacteria 1275
262 Ga0207665_10270342 3300025939 Bacteria 1262
263 Ga0207665_10303043 3300025939 Bacteria 1195
264 Ga0207665_10476261 3300025939 Unclassified 961
265 Ga0207665_10629846 3300025939 Bacteria 839
266 Ga0207665_10808852 3300025939 Unclassified 741
267 Ga0207665_10811005 3300025939 Unclassified 740
268 Ga0207665_11424368 3300025939 Bacteria 551
269 Ga0207711_10030934 3300025941 Bacteria 4516
270 Ga0207711_10568240 3300025941 Bacteria 1058
271 Ga0207689_10226074 3300025942 Bacteria 1547
272 Ga0207667_10030456 3300025949 Bacteria 5837
273 Ga0207667_10486332 3300025949 Unclassified 1253
274 Ga0207651_10159473 3300025960 Bacteria 1767
275 Ga0207712_10388068 3300025961 Bacteria 1170
276 Ga0207640_10832991 3300025981 Unclassified 801
277 Ga0207658_10419328 3300025986 Bacteria 1180
278 Ga0207703_10035663 3300026035 Unclassified 3953
279 Ga0207703_10605944 3300026035 Bacteria 1036
280 Ga0207639_10000005 3300026041 Bacteria 579948
281 Ga0207702_10084320 3300026078 Bacteria 2766
282 Ga0207702_10164217 3300026078 Unclassified 2030
283 Ga0207702_10274879 3300026078 Bacteria 1590
284 Ga0207641_10030399 3300026088 Bacteria 4475
285 Ga0207641_11503273 3300026088 Unclassified 675
286 Ga0207675_100418695 3300026118 Bacteria 1323
287 Ga0207683_10015303 3300026121 Bacteria 6531
288 Ga0207698_10180503 3300026142 Bacteria 1869
289 Ga0265356_1012938 3300028017 Bacteria 914
290 Ga0268266_10034146 3300028379 Unclassified 4325
291 Ga0268266_10288197 3300028379 Bacteria 1528
292 Ga0268264_10014108 3300028381 Bacteria 6570
293 Ga0268264_10049788 3300028381 Bacteria 3487
294 Ga0268264_10633992 3300028381 Bacteria 1056
295 Ga0268264_11320271 3300028381 Unclassified 732
296 Ga0307511_10044772 3300030521 Unclassified 3669
297 Ga0265762_1000154 3300030760 Bacteria 10728
298 Ga0265760_10123995 3300031090 Unclassified 831
299 Ga0373934_0167246 3300035086 Bacteria 902
300 Ga0373944_0203323 3300035089 Unclassified 718
301 Ga0373932_0337345 3300035112 Unclassified 570
302 Ga0373954_0461842 3300035118 Unclassified 629
303 Ga0373956_0018588 3300035119 Bacteria 2944
304 Ga0373956_0097557 3300035119 Unclassified 1360
305 Ga0373943_0367289 3300035170 Unclassified 827
306 Ga0373943_0480654 3300035170 Unclassified 724
307 Ga0373943_0695695 3300035170 Unclassified 602
308 Ga0373955_0036861 3300035172 Bacteria 2598
309 Ga0373955_0193679 3300035172 Unclassified 1209
310 Ga0373955_0259575 3300035172 Unclassified 1043
311 Ga0373931_0057564 3300035691 Unclassified 2085
312 Ga0373935_0288154 3300035692 Unclassified 1158
313 Ga0373935_0743735 3300035692 Unclassified 722
314 Ga0373927_0002916 3300035695 Bacteria 12441
315 Ga0373933_0010319 3300035724 Bacteria 5119
316 Ga0373933_0209557 3300035724 Bacteria 1248
317 Ga0373933_0340433 3300035724 Viruses 974
318 Ga0373947_0057922 3300035725 Unclassified 2346
319 Ga0373947_0394529 3300035725 Unclassified 933
320 Ga0373947_0688565 3300035725 Unclassified 697
321 Ga0373937_0087093 3300036401 Unclassified 2890
322 Ga0373937_0090715 3300036401 Bacteria 2830
323 Ga0373937_0193567 3300036401 Unclassified 1911
324 Ga0373925_0307054 3300037068 Unclassified 1282
325 Ga0373925_0389956 3300037068 Unclassified 1135
326 Ga0373925_0484981 3300037068 Unclassified 1014
327 Ga0373925_0873576 3300037068 Unclassified 741
328 Ga0395900_0428907 3300037418 Bacteria 1282
329 Ga0395898_0081221 3300037466 Bacteria 3126
330 Ga0436364_0837200 3300037853 Unclassified 664
331 Ga0436365_0678905 3300039437 Bacteria 1033
332 Ga0436365_1043451 3300039437 Bacteria 5015
333 Ga0436365_1157401 3300039437 Bacteria 526
334 Ga0436361_0779106 3300039447 Unclassified 787
335 Ga0436363_0170048 3300039450 Bacteria 611
336 Ga0436362_0001144 3300039453 Bacteria 2041
337 Ga0436362_0190854 3300039453 Bacteria 1816
338 Ga0466964_0081045 3300044706 Bacteria 1393
339 Ga0451576_2604880 3300045051 Unclassified 516
340 Ga0466967_0124762 3300045976 Bacteria 2384
341 Ga0495592_0554979 3300046454 Unclassified 706
342 Ga0495629_0430921 3300046459 Bacteria 894
343 Ga0495651_0097897 3300046462 Unclassified 2190
344 Ga0495651_0283196 3300046462 Unclassified 1119
345 Ga0495653_0859920 3300046463 Unclassified 542
346 Ga0495580_0000109 3300046472 Bacteria 55386
347 Ga0495580_0008007 3300046472 Bacteria 8446
348 Ga0495580_0027002 3300046472 Unclassified 4181
349 Ga0495580_0032424 3300046472 Bacteria 3771
350 Ga0495580_0062791 3300046472 Unclassified 2606
351 Ga0495580_0231404 3300046472 Unclassified 1269
352 Ga0495580_0267542 3300046472 Bacteria 1168
353 Ga0495580_0896428 3300046472 Bacteria 570
354 Ga0495582_0265084 3300046473 Unclassified 985
355 Ga0495639_0661295 3300046475 Unclassified 539
356 Ga0495662_0251847 3300046476 Unclassified 870
357 Ga0495664_0021092 3300046477 Bacteria 3763
358 Ga0495664_0238673 3300046477 Unclassified 1100
359 Ga0495628_0442868 3300046516 Bacteria 944
360 Ga0495628_0573986 3300046516 Bacteria 808
361 Ga0495628_0700408 3300046516 Unclassified 715
362 Ga0495628_0771949 3300046516 Bacteria 674
363 Ga0495630_0084290 3300046517 Unclassified 2400
364 Ga0495630_0117552 3300046517 Bacteria 2016
365 Ga0495652_0287631 3300046529 Bacteria 1201
366 Ga0495652_0345875 3300046529 Bacteria 1067
367 Ga0495665_0053169 3300046531 Unclassified 2143
368 Ga0495665_0254914 3300046531 Unclassified 903
369 Ga0495665_0391975 3300046531 Unclassified 705
370 Ga0495665_0608031 3300046531 Bacteria 546
371 Ga0495587_0079250 3300046536 Unclassified 1905
372 Ga0495645_0228263 3300046543 Bacteria 1248
373 Ga0495645_0323782 3300046543 Unclassified 1000
374 Ga0495645_0688339 3300046543 Unclassified 622
375 Ga0495667_0290930 3300046559 Unclassified 1036
376 Ga0495667_0348985 3300046559 Unclassified 935
377 Ga0495667_0846805 3300046559 Bacteria 562
378 Ga0495635_0703266 3300046663 Unclassified 655
379 Ga0495657_0690794 3300046675 Unclassified 587
380 Ga0495599_0375949 3300046678 Bacteria 849
381 Ga0495623_0097093 3300046679 Bacteria 1800
382 Ga0495623_0113401 3300046679 Bacteria 1640
383 Ga0495646_0327918 3300046680 Unclassified 805
384 Ga0495647_0027723 3300046681 Unclassified 2083
385 Ga0495647_0068353 3300046681 Bacteria 1417
386 Ga0495658_0015535 3300046683 Unclassified 3906
387 Ga0495658_0193158 3300046683 Unclassified 1266
388 Ga0495658_0400457 3300046683 Bacteria 875
389 Ga0495600_0156749 3300046809 Bacteria 1473
390 Ga0495604_0291760 3300047317 Unclassified 1098
391 Ga0495604_0357746 3300047317 Bacteria 969
392 Ga0495604_0449322 3300047317 Unclassified 842
393 Ga0495674_0027377 3300047319 Bacteria 5210
394 Ga0495674_0046743 3300047319 Unclassified 3842
395 Ga0495674_0118742 3300047319 Bacteria 2236
396 Ga0495674_0291021 3300047319 Unclassified 1336
397 Ga0495675_0008148 3300047444 Bacteria 6486
398 Ga0495675_0127900 3300047444 Unclassified 1580
399 Ga0495675_0265588 3300047444 Unclassified 1027
400 Ga0495684_0094636 3300047471 Unclassified 2262
401 Ga0495602_0007463 3300048088 Bacteria 11438
402 Ga0495602_0124406 3300048088 Bacteria 2069
403 Ga0495602_0138947 3300048088 Bacteria 1926
404 Ga0496100_0077939 3300048903 Bacteria 2229
405 Ga0496100_0232584 3300048903 Bacteria 1357
406 Ga0496101_0047006 3300048904 Bacteria 3097
407 Ga0496101_0583545 3300048904 Bacteria 884
408 Ga0496102_0005480 3300048905 Bacteria 10766
409 Ga0496102_0006110 3300048905 Bacteria 10265
410 Ga0496102_0063985 3300048905 Bacteria 3368
411 Ga0496103_0059529 3300048906 Bacteria 2373
412 Ga0496103_0234718 3300048906 Unclassified 1180
413 Ga0496104_0083793 3300048907 Unclassified 3041
414 Ga0496104_0166608 3300048907 Unclassified 2113
415 Ga0496104_0215335 3300048907 Bacteria 1832
416 Ga0496104_0277893 3300048907 Bacteria 1588
417 Ga0496105_0112682 3300048908 Unclassified 2245
418 Ga0496105_0214666 3300048908 Bacteria 1567
419 Ga0496106_0068952 3300048909 Unclassified 2698
420 Ga0496106_0267477 3300048909 Unclassified 1368
421 Ga0496106_0337581 3300048909 Bacteria 1210
422 Ga0496107_0249981 3300048910 Bacteria 1319
423 Ga0496107_0277759 3300048910 Bacteria 1247
424 Ga0496108_0078332 3300048911 Bacteria 2797
425 Ga0496109_0193635 3300048912 Bacteria 1910
426 Ga0496109_0722907 3300048912 Unclassified 933
427 Ga0496109_0949944 3300048912 Unclassified 797
428 Ga0496110_0136275 3300048913 Bacteria 2218
429 Ga0496111_0213754 3300048914 Bacteria 1432
430 Ga0496112_0176505 3300048915 Bacteria 2101
431 Ga0496112_0240799 3300048915 Bacteria 1762
432 Ga0496112_0922624 3300048915 Bacteria 795
433 Ga0496113_0052015 3300048916 Unclassified 3058
434 Ga0496114_0024023 3300048917 Unclassified 4974
435 Ga0496114_0031814 3300048917 Bacteria 4340
436 Ga0496115_0008870 3300048918 Bacteria 7453
437 Ga0496115_0039603 3300048918 Unclassified 3744
438 Ga0496115_0170232 3300048918 Bacteria 1801
439 Ga0496115_0263781 3300048918 Unclassified 1416
440 Ga0496115_1255184 3300048918 Unclassified 554
441 nmdc:mga05p37_103504_c1 3300050507 Unclassified 3504
442 nmdc:mga0n895_1402501_c1 3300050512 Bacteria 667
443 nmdc:mga0n895_691115_c1 3300050512 Unclassified 1017
444 nmdc:mga0rr50_65299_c1 3300050513 Unclassified 2756
445 nmdc:mga0rr50_96259_c1 3300050513 Bacteria 2316
446 nmdc:mga08x19_1145335_c1 3300050514 Unclassified 552
447 nmdc:mga08x19_81397_c1 3300050514 Bacteria 2126
448 nmdc:mga08x19_973695_c1 3300050514 Unclassified 603
449 Ga0495601_0307081 3300053077 Bacteria 1033
450 Ga0495612_0510207 3300053078 Unclassified 552
451 Ga0495612_0607904 3300053078 Unclassified 505
452 Ga0495619_0202645 3300053085 Bacteria 1374
453 Ga0500637_0099180 3300053178 Unclassified 1689
454 Ga0500637_0241002 3300053178 Unclassified 1013
455 nmdc:mga0n895_337440_c2
456 MBSR1b_contig_297530
457 MBSR1b_contig_4117783
458 Ga0065715_10045757
459 Ga0070666_10049568
460 Ga0068868_100093962
461 Ga0070671_100103198
462 Ga0070673_101004693
463 Ga0070667_100123941
464 Ga0070667_100429312
465 Ga0070709_10124976
466 Ga0070709_10485779
467 Ga0070709_10959530
468 Ga0070709_11042018
469 Ga0070714_100011162
470 Ga0070714_100632191
471 Ga0070714_100771973
472 Ga0070713_100004645
473 Ga0070713_100016558
474 Ga0070713_100022025
475 Ga0070713_100028159
476 Ga0070713_100061753
477 Ga0070713_100091332
478 Ga0070713_100107138
479 Ga0070713_100218314
480 Ga0070713_100334524
481 Ga0070713_102219344
482 Ga0070710_10076307
483 Ga0070710_10230574
484 Ga0070710_10332363
485 Ga0070710_10489373
486 Ga0070711_100007260
487 Ga0070711_100095957
488 Ga0070711_100110228
489 Ga0070711_100125652
490 Ga0070711_100126493
491 Ga0070711_100593934
492 Ga0070711_100594024
493 Ga0070705_100237928
494 Ga0070705_100250453
495 Ga0070694_100092946
496 Ga0070694_100235040
497 Ga0070694_101493791
498 Ga0070708_100010242
499 Ga0070678_100153876
500 Ga0070681_10005961
501 Ga0070706_100038440
502 Ga0070706_100286071
503 Ga0070706_100435726
504 Ga0070707_100002475
505 Ga0070707_100629435
506 Ga0070699_100025802
507 Ga0070699_100451618
508 Ga0070697_100002758
509 Ga0070697_100026789
510 Ga0070697_100028167
511 Ga0070697_100196572
512 Ga0070697_100458203
513 Ga0070697_100673730
514 Ga0068853_100028265
515 Ga0068853_100344974
516 Ga0070686_100151041
517 Ga0070686_101134727
518 Ga0070695_100010359
519 Ga0070695_100036972
520 Ga0070665_100031286
521 Ga0070665_100123006
522 Ga0070704_100038720
523 Ga0068855_100123109
524 Ga0068855_101076788
525 Ga0068854_101934730
526 Ga0068856_100097887
527 Ga0068856_100239801
528 Ga0068856_100337049
529 Ga0070702_100463457
530 Ga0070702_101836032
531 Ga0068852_100171686
532 Ga0068859_100417484
533 Ga0068861_100204035
534 Ga0068863_100119640
535 Ga0068858_100081033
536 Ga0068858_100111862
537 Ga0068858_100858042
538 Ga0068860_100019477
539 Ga0068860_100041721
540 Ga0068860_100123517
541 Ga0068860_101355833
542 Ga0070717_10099855
543 Ga0070717_10101344
544 Ga0070717_10112015
545 Ga0070717_10210549
546 Ga0070717_11769931
547 Ga0070715_10040453
548 Ga0070715_10043760
549 Ga0070715_10352042
550 Ga0070715_10441280
551 Ga0070716_100008459
552 Ga0070716_100034807
553 Ga0070716_100046573
554 Ga0070716_100322498
555 Ga0070716_100697455
556 Ga0070716_100810528
557 Ga0070716_100859173
558 Ga0070716_100888997
559 Ga0070716_100981619
560 Ga0070712_100004423
561 Ga0070712_100011279
562 Ga0070712_100025817
563 Ga0070712_100055047
564 Ga0070712_100101790
565 Ga0070712_100229072
566 Ga0070712_101140196
567 Ga0097621_100002000
568 Ga0097621_100271461
569 Ga0068871_100000420
570 Ga0068871_100204910
571 Ga0068871_100482655
572 Ga0068871_100825092
573 Ga0075434_100071864
574 Ga0075434_100619529
575 Ga0075434_100998095
576 Ga0068865_100009180
577 Ga0075436_100030044
578 Ga0075436_100326581
579 Ga0075436_100394444
580 Ga0097620_100417415
581 Ga0075435_100008980
582 Ga0075435_100021929
583 Ga0075435_100056055
584 Ga0075435_101847928
585 Ga0099795_10029639
586 Ga0099795_10254610
587 Ga0099795_10622717
588 Ga0105250_10152191
589 Ga0105240_10004870
590 Ga0105240_10018036
591 Ga0105240_10275451
592 Ga0105240_10883311
593 Ga0105240_11314211
594 Ga0105245_10017176
595 Ga0105245_10029261
596 Ga0105245_10499253
597 Ga0105247_10007916
598 Ga0105247_10054324
599 Ga0105247_10585663
600 Ga0114129_10034673
601 Ga0114129_10120149
602 Ga0105243_10761409
603 Ga0105241_10016454
604 Ga0105241_10041043
605 Ga0105241_11740534
606 Ga0105242_10013066
607 Ga0105248_10047048
608 Ga0105248_10317900
609 Ga0105248_10672718
610 Ga0105248_10750225
611 Ga0105237_10023794
612 Ga0105237_10287321
613 Ga0105238_10511063
614 Ga0105238_10733784
615 Ga0105238_12347156
616 Ga0105249_10166051
617 Ga0099796_10305350
618 Ga0105239_10073271
619 Ga0157370_10809663
620 Ga0157370_11857676
621 Ga0157369_10000432
622 Ga0157374_10004401
623 Ga0157374_10202702
624 Ga0157374_10296003
625 Ga0157374_10938362
626 Ga0157378_10002089
627 Ga0157378_10139425
628 Ga0157378_11095922
629 Ga0157378_11507090
630 Ga0163162_10052314
631 Ga0163162_10267514
632 Ga0163162_10314184
633 Ga0163162_11061090
634 Ga0157372_10091424
635 Ga0157372_10433679
636 Ga0157372_10505910
637 Ga0157372_10903985
638 Ga0157375_10610416
639 Ga0163163_10027058
640 Ga0157379_10018006
641 Ga0157379_10085555
642 Ga0157379_10342207
643 Ga0157379_12414704
644 Ga0157376_10000051
645 Ga0157376_10217775
646 Ga0213873_10032748
647 Ga0213876_10025390
648 Ga0228598_1032622
649 Ga0207692_10136995
650 Ga0207692_10139892
651 Ga0207692_10434647
652 Ga0207710_10033056
653 Ga0207710_10255841
654 Ga0207680_10285721
655 Ga0207685_10076014
656 Ga0207685_10097076
657 Ga0207685_10280156
658 Ga0207685_10330362
659 Ga0207699_10021707
660 Ga0207699_10028296
661 Ga0207699_10147649
662 Ga0207699_10261315
663 Ga0207699_10442330
664 Ga0207699_10485677
665 Ga0207699_10949254
666 Ga0207699_10958403
667 Ga0207684_10006421
668 Ga0207684_10006479
669 Ga0207684_10094780
670 Ga0207684_10197235
671 Ga0207654_10043277
672 Ga0207707_10004860
673 Ga0207707_10109010
674 Ga0207695_10004359
675 Ga0207695_10422791
676 Ga0207671_10251332
677 Ga0207671_10260537
678 Ga0207693_10001611
679 Ga0207693_10003415
680 Ga0207693_10011098
681 Ga0207693_10028408
682 Ga0207693_10235892
683 Ga0207693_10754417
684 Ga0207663_10003279
685 Ga0207663_10007761
686 Ga0207663_10030925
687 Ga0207663_10095824
688 Ga0207663_10276687
689 Ga0207663_10549303
690 Ga0207660_10542505
691 Ga0207649_10784351
692 Ga0207646_10002174
693 Ga0207646_10762837
694 Ga0207687_10123686
695 Ga0207687_10191406
696 Ga0207700_10007604
697 Ga0207700_10089453
698 Ga0207700_10099818
699 Ga0207700_10126212
700 Ga0207700_10451368
701 Ga0207700_10471619
702 Ga0207664_10011514
703 Ga0207664_10087334
704 Ga0207664_10415390
705 Ga0207664_10441677
706 Ga0207664_10629063
707 Ga0207644_10098045
708 Ga0207644_10609708
709 Ga0207686_10035589
710 Ga0207686_10070848
711 Ga0207709_10495942
712 Ga0207665_10003482
713 Ga0207665_10021448
714 Ga0207665_10119527
715 Ga0207665_10264713
716 Ga0207665_10270342
717 Ga0207665_10303043
718 Ga0207665_10476261
719 Ga0207665_10629846
720 Ga0207665_10808852
721 Ga0207665_10811005
722 Ga0207665_11424368
723 Ga0207711_10030934
724 Ga0207711_10568240
725 Ga0207689_10226074
726 Ga0207667_10030456
727 Ga0207667_10486332
728 Ga0207651_10159473
729 Ga0207712_10388068
730 Ga0207640_10832991
731 Ga0207658_10419328
732 Ga0207703_10035663
733 Ga0207703_10605944
734 Ga0207639_10000005
735 Ga0207702_10084320
736 Ga0207702_10164217
737 Ga0207702_10274879
738 Ga0207641_10030399
739 Ga0207641_11503273
740 Ga0207675_100418695
741 Ga0207683_10015303
742 Ga0207698_10180503
743 Ga0265356_1012938
744 Ga0268266_10034146
745 Ga0268266_10288197
746 Ga0268264_10014108
747 Ga0268264_10049788
748 Ga0268264_10633992
749 Ga0268264_11320271
750 Ga0307511_10044772
751 Ga0265762_1000154
752 Ga0265760_10123995
753 Ga0373934_0167246
754 Ga0373944_0203323
755 Ga0373932_0337345
756 Ga0373954_0461842
757 Ga0373956_0018588
758 Ga0373956_0097557
759 Ga0373943_0367289
760 Ga0373943_0480654
761 Ga0373943_0695695
762 Ga0373955_0036861
763 Ga0373955_0193679
764 Ga0373955_0259575
765 Ga0373931_0057564
766 Ga0373935_0288154
767 Ga0373935_0743735
768 Ga0373927_0002916
769 Ga0373933_0010319
770 Ga0373933_0209557
771 Ga0373933_0340433
772 Ga0373947_0057922
773 Ga0373947_0394529
774 Ga0373947_0688565
775 Ga0373937_0087093
776 Ga0373937_0090715
777 Ga0373937_0193567
778 Ga0373925_0307054
779 Ga0373925_0389956
780 Ga0373925_0484981
781 Ga0373925_0873576
782 Ga0395900_0428907
783 Ga0395898_0081221
784 Ga0436364_0837200
785 Ga0436365_0678905
786 Ga0436365_1043451
787 Ga0436365_1157401
788 Ga0436361_0779106
789 Ga0436363_0170048
790 Ga0436362_0001144
791 Ga0436362_0190854
792 Ga0466964_0081045
793 Ga0451576_2604880
794 Ga0466967_0124762
795 Ga0495592_0554979
796 Ga0495629_0430921
797 Ga0495651_0097897
798 Ga0495651_0283196
799 Ga0495653_0859920
800 Ga0495580_0000109
801 Ga0495580_0008007
802 Ga0495580_0027002
803 Ga0495580_0032424
804 Ga0495580_0062791
805 Ga0495580_0231404
806 Ga0495580_0267542
807 Ga0495580_0896428
808 Ga0495582_0265084
809 Ga0495639_0661295
810 Ga0495662_0251847
811 Ga0495664_0021092
812 Ga0495664_0238673
813 Ga0495628_0442868
814 Ga0495628_0573986
815 Ga0495628_0700408
816 Ga0495628_0771949
817 Ga0495630_0084290
818 Ga0495630_0117552
819 Ga0495652_0287631
820 Ga0495652_0345875
821 Ga0495665_0053169
822 Ga0495665_0254914
823 Ga0495665_0391975
824 Ga0495665_0608031
825 Ga0495587_0079250
826 Ga0495645_0228263
827 Ga0495645_0323782
828 Ga0495645_0688339
829 Ga0495667_0290930
830 Ga0495667_0348985
831 Ga0495667_0846805
832 Ga0495635_0703266
833 Ga0495657_0690794
834 Ga0495599_0375949
835 Ga0495623_0097093
836 Ga0495623_0113401
837 Ga0495646_0327918
838 Ga0495647_0027723
839 Ga0495647_0068353
840 Ga0495658_0015535
841 Ga0495658_0193158
842 Ga0495658_0400457
843 Ga0495600_0156749
844 Ga0495604_0291760
845 Ga0495604_0357746
846 Ga0495604_0449322
847 Ga0495674_0027377
848 Ga0495674_0046743
849 Ga0495674_0118742
850 Ga0495674_0291021
851 Ga0495675_0008148
852 Ga0495675_0127900
853 Ga0495675_0265588
854 Ga0495684_0094636
855 Ga0495602_0007463
856 Ga0495602_0124406
857 Ga0495602_0138947
858 Ga0496100_0077939
859 Ga0496100_0232584
860 Ga0496101_0047006
861 Ga0496101_0583545
862 Ga0496102_0005480
863 Ga0496102_0006110
864 Ga0496102_0063985
865 Ga0496103_0059529
866 Ga0496103_0234718
867 Ga0496104_0083793
868 Ga0496104_0166608
869 Ga0496104_0215335
870 Ga0496104_0277893
871 Ga0496105_0112682
872 Ga0496105_0214666
873 Ga0496106_0068952
874 Ga0496106_0267477
875 Ga0496106_0337581
876 Ga0496107_0249981
877 Ga0496107_0277759
878 Ga0496108_0078332
879 Ga0496109_0193635
880 Ga0496109_0722907
881 Ga0496109_0949944
882 Ga0496110_0136275
883 Ga0496111_0213754
884 Ga0496112_0176505
885 Ga0496112_0240799
886 Ga0496112_0922624
887 Ga0496113_0052015
888 Ga0496114_0024023
889 Ga0496114_0031814
890 Ga0496115_0008870
891 Ga0496115_0039603
892 Ga0496115_0170232
893 Ga0496115_0263781
894 Ga0496115_1255184
895 nmdc:mga05p37_103504_c1
896 nmdc:mga0n895_1402501_c1
897 nmdc:mga0n895_691115_c1
898 nmdc:mga0rr50_65299_c1
899 nmdc:mga0rr50_96259_c1
900 nmdc:mga08x19_1145335_c1
901 nmdc:mga08x19_81397_c1
902 nmdc:mga08x19_973695_c1
903 Ga0495601_0307081
904 Ga0495612_0510207
905 Ga0495612_0607904
906 Ga0495619_0202645
907 Ga0500637_0099180
908 Ga0500637_0241002

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

31

143

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8886 5 70
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8853 5 70
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8746 8 72
1sd6-assembly1.cif.gz_B crystal structure of native meci at 2.65 a 0.8726 5 116
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8657 8 72
ID Description Score Start End Superfamily
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9015 7 70 1.10.10.10
1sd4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8894 8 70 1.10.10.10
2d45D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8774 7 70 1.10.10.10
2d45B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8769 7 70 1.10.10.10
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8763 7 70 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7U9N9Q2-F1-model_v4 Penicillinase repressor 0.9414 5 116 GO:0003677
GO:0045892
AF-A0A416UAX6-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9375 5 116 GO:0003677
GO:0005737
GO:0045892
AF-B3C5A4-F1-model_v4 Transcriptional regulator, BlaI/MecI/CopY family 0.9375 5 116 GO:0003677
GO:0005737
GO:0045892
AF-A0A840EQZ5-F1-model_v4 Putative transcriptional regulator 0.937 5 116 GO:0003677
GO:0005737
GO:0045892
AF-A0A355VMH9-F1-model_v4 Transcriptional regulator 0.9364 5 116 GO:0003677
GO:0005737
GO:0045892

Map