F447432

General Info

Members Datasets Scaffolds Average Seq Length
454 213 452 235

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0080831|Ga0466968_0080831_627_1379
Length 250
Sequence MVFCIIATKSALMLKCIAVDDEPLALELLEDNISKVPYLQLVAKCNNAFEAIEVLQKEPIDLIFLDIQMPGLTGLQFLQSLANKPMVILITAYEKYALDGFNLDVTDYLVKPVALERFIKACNKAFELFQLKAASRAGREPQAPEFFFVNVDYSLFKVVLDDIEWIEGLKDYVRIHLKNSTKPVVTRMSIKSMEEQLPANRFLRVHKSYIVAVSCITAIRKNSIFLDELELPVGDTYRDSLQALTGKTGF

Samples

Sample ID Description Type Environment
1 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
2 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
170 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
171 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
172 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
209 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.39
Nodule 0
Rhizoplane 0.66
Rhizosphere 90.09
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10031075 3300002077 Bacteria 1022
2 JGI25157J39369_1013946 3300002741 Bacteria 1004
3 JGI25153J46596_10015745 3300003215 Bacteria 3062
4 JGI25153J46596_10024360 3300003215 Bacteria 2184
5 rootH1_10110650 3300003316 Bacteria 2170
6 rootH2_10020070 3300003320 Bacteria 4236
7 rootH2_10150096 3300003320 Bacteria 2209
8 rootL2_10097428 3300003322 Bacteria 5528
9 rootL2_10126313 3300003322 Bacteria 3239
10 rootH1_10210526 3300003323 Bacteria 3979
11 Ga0055528_1000698 3300003790 Bacteria 23873
12 Ga0055528_1001196 3300003790 Bacteria 16730
13 Ga0055530_10003193 3300003791 Bacteria 9608
14 Ga0055531_10036078 3300003794 Bacteria 1534
15 Ga0065165_1000012 3300005262 Bacteria 303241
16 Ga0065704_10115764 3300005289 Bacteria 1866
17 Ga0065712_10073717 3300005290 Bacteria 4300
18 Ga0070658_10172155 3300005327 Bacteria 1819
19 Ga0070658_10194245 3300005327 Bacteria 1711
20 Ga0070676_10018452 3300005328 Bacteria 3867
21 Ga0070683_100005727 3300005329 Bacteria 10386
22 Ga0070690_100633424 3300005330 Unclassified 815
23 Ga0070670_100013962 3300005331 Bacteria 6889
24 Ga0070670_100029489 3300005331 Bacteria 4724
25 Ga0070670_100030934 3300005331 Bacteria 4610
26 Ga0070670_100039660 3300005331 Bacteria 4049
27 Ga0070670_100053001 3300005331 Bacteria 3484
28 Ga0070677_10006668 3300005333 Bacteria 3839
29 Ga0068869_100200722 3300005334 Bacteria 1572
30 Ga0070666_10083972 3300005335 Bacteria 2179
31 Ga0070666_10384805 3300005335 Bacteria 1007
32 Ga0070682_100104255 3300005337 Bacteria 1878
33 Ga0070682_100380419 3300005337 Bacteria 1061
34 Ga0068868_100098237 3300005338 Bacteria 2367
35 Ga0068868_100143745 3300005338 Bacteria 1960
36 Ga0070660_100010731 3300005339 Bacteria 6483
37 Ga0070689_100025063 3300005340 Bacteria 4479
38 Ga0070689_100068514 3300005340 Bacteria 2768
39 Ga0070689_100306173 3300005340 Bacteria 1324
40 Ga0070661_100073359 3300005344 Bacteria 2520
41 Ga0070661_100264361 3300005344 Unclassified 1331
42 Ga0070668_100083379 3300005347 Bacteria 2509
43 Ga0070668_100131958 3300005347 Bacteria 2005
44 Ga0070668_100460507 3300005347 Bacteria 1095
45 Ga0070669_100004896 3300005353 Bacteria 9666
46 Ga0070669_100067464 3300005353 Bacteria 2639
47 Ga0070669_100172406 3300005353 Unclassified 1687
48 Ga0070675_100017274 3300005354 Bacteria 5732
49 Ga0070675_100043491 3300005354 Bacteria 3671
50 Ga0070675_100122325 3300005354 Bacteria 2212
51 Ga0070675_100135441 3300005354 Bacteria 2102
52 Ga0070675_100286315 3300005354 Unclassified 1449
53 Ga0070671_100041014 3300005355 Unclassified 3846
54 Ga0070671_100281602 3300005355 Bacteria 1414
55 Ga0070674_100464201 3300005356 Bacteria 1048
56 Ga0070673_100005984 3300005364 Bacteria 7869
57 Ga0070673_100024789 3300005364 Bacteria 4403
58 Ga0070673_100115016 3300005364 Bacteria 2236
59 Ga0070673_100539342 3300005364 Bacteria 1059
60 Ga0070688_100009911 3300005365 Bacteria 5235
61 Ga0070688_100021280 3300005365 Bacteria 3786
62 Ga0070659_100038342 3300005366 Bacteria 3737
63 Ga0070659_100209262 3300005366 Bacteria 1607
64 Ga0070659_100743308 3300005366 Unclassified 850
65 Ga0070667_100023628 3300005367 Bacteria 5102
66 Ga0070667_100167357 3300005367 Bacteria 1939
67 Ga0070700_100054288 3300005441 Bacteria 2503
68 Ga0070663_100532830 3300005455 Unclassified 979
69 Ga0070678_100152640 3300005456 Bacteria 1862
70 Ga0070662_100006870 3300005457 Bacteria 7363
71 Ga0070662_100055394 3300005457 Bacteria 2876
72 Ga0070681_10224424 3300005458 Bacteria 1794
73 Ga0070681_10284355 3300005458 Bacteria 1565
74 Ga0068867_100014476 3300005459 Bacteria 5590
75 Ga0068867_100059218 3300005459 Unclassified 2839
76 Ga0068867_100093796 3300005459 Bacteria 2282
77 Ga0068867_100114070 3300005459 Bacteria 2080
78 Ga0068867_100474523 3300005459 Bacteria 1070
79 Ga0070685_10010908 3300005466 Bacteria 4737
80 Ga0070685_10146866 3300005466 Bacteria 1490
81 Ga0070679_100027399 3300005530 Bacteria 5608
82 Ga0070679_100198215 3300005530 Bacteria 1974
83 Ga0070679_100200738 3300005530 Unclassified 1960
84 Ga0070684_100010799 3300005535 Bacteria 7252
85 Ga0070684_100032241 3300005535 Bacteria 4465
86 Ga0068853_100052338 3300005539 Bacteria 3517
87 Ga0068853_100109075 3300005539 Bacteria 2456
88 Ga0068853_100120342 3300005539 Bacteria 2341
89 Ga0068853_100166731 3300005539 Unclassified 1991
90 Ga0070672_100030045 3300005543 Bacteria 4078
91 Ga0070672_100265813 3300005543 Unclassified 1447
92 Ga0070672_100679785 3300005543 Bacteria 900
93 Ga0070693_100115617 3300005547 Bacteria 1657
94 Ga0070665_100000006 3300005548 Bacteria 718034
95 Ga0070665_100025670 3300005548 Bacteria 5935
96 Ga0070665_100218129 3300005548 Unclassified 1908
97 Ga0070704_100112498 3300005549 Bacteria 2074
98 Ga0068855_100031956 3300005563 Bacteria 6284
99 Ga0068855_100117547 3300005563 Bacteria 3046
100 Ga0068855_100343666 3300005563 Unclassified 1645
101 Ga0070664_100239812 3300005564 Bacteria 1627
102 Ga0070664_100291892 3300005564 Bacteria 1472
103 Ga0068857_100002131 3300005577 Bacteria 16088
104 Ga0068857_100011432 3300005577 Bacteria 7724
105 Ga0068857_100072559 3300005577 Bacteria 3068
106 Ga0068857_100432630 3300005577 Bacteria 1228
107 Ga0068854_100017324 3300005578 Unclassified 4820
108 Ga0068856_100000112 3300005614 Bacteria 80466
109 Ga0068856_100023414 3300005614 Bacteria 6005
110 Ga0068856_100161322 3300005614 Bacteria 2252
111 Ga0068856_100956003 3300005614 Unclassified 875
112 Ga0068852_100000224 3300005616 Bacteria 38305
113 Ga0068852_100075626 3300005616 Bacteria 2971
114 Ga0068852_100134066 3300005616 Bacteria 2284
115 Ga0068852_100162370 3300005616 Bacteria 2087
116 Ga0068852_100257980 3300005616 Bacteria 1673
117 Ga0068852_100355349 3300005616 Bacteria 1432
118 Ga0068852_100747362 3300005616 Bacteria 990
119 Ga0068859_100049512 3300005617 Bacteria 4219
120 Ga0068859_100070937 3300005617 Bacteria 3519
121 Ga0068859_100077133 3300005617 Bacteria 3373
122 Ga0068859_100166421 3300005617 Bacteria 2285
123 Ga0068859_100333273 3300005617 Bacteria 1611
124 Ga0068859_100398881 3300005617 Bacteria 1471
125 Ga0068859_101074941 3300005617 Bacteria 885
126 Ga0068864_100208331 3300005618 Bacteria 1799
127 Ga0068866_10046992 3300005718 Bacteria 2174
128 Ga0068861_100006035 3300005719 Bacteria 8238
129 Ga0068861_100073435 3300005719 Bacteria 2657
130 Ga0068851_10215193 3300005834 Unclassified 1078
131 Ga0068870_10003550 3300005840 Bacteria 6617
132 Ga0068863_100024402 3300005841 Bacteria 5767
133 Ga0068863_100108018 3300005841 Bacteria 2648
134 Ga0068863_100265168 3300005841 Bacteria 1661
135 Ga0068863_100878505 3300005841 Unclassified 896
136 Ga0068858_100567745 3300005842 Unclassified 1099
137 Ga0068860_100000005 3300005843 Bacteria 472349
138 Ga0068860_100001321 3300005843 Bacteria 26887
139 Ga0068860_100015303 3300005843 Bacteria 7492
140 Ga0068860_100042328 3300005843 Bacteria 4351
141 Ga0068862_100037916 3300005844 Bacteria 4086
142 Ga0068862_100055613 3300005844 Bacteria 3389
143 Ga0068862_100196862 3300005844 Unclassified 1816
144 Ga0068862_100349929 3300005844 Unclassified 1371
145 Ga0075366_10005272 3300006195 Bacteria 7003
146 Ga0075366_10036650 3300006195 Unclassified 2892
147 Ga0097621_100003171 3300006237 Bacteria 11298
148 Ga0097621_100004097 3300006237 Bacteria 10111
149 Ga0097621_100061401 3300006237 Bacteria 3082
150 Ga0097621_100221875 3300006237 Bacteria 1647
151 Ga0097621_100318222 3300006237 Bacteria 1378
152 Ga0068871_100000275 3300006358 Bacteria 35449
153 Ga0068871_100013546 3300006358 Bacteria 6053
154 Ga0068871_100067217 3300006358 Bacteria 2940
155 Ga0068871_100185041 3300006358 Bacteria 1792
156 Ga0068871_100677902 3300006358 Bacteria 943
157 Ga0097620_100049506 3300006931 Bacteria 4219
158 Ga0097620_100070941 3300006931 Bacteria 3519
159 Ga0097620_100077131 3300006931 Bacteria 3373
160 Ga0097620_100166421 3300006931 Bacteria 2285
161 Ga0097620_100333277 3300006931 Bacteria 1611
162 Ga0097620_100398873 3300006931 Bacteria 1471
163 Ga0097620_101074875 3300006931 Bacteria 885
164 Ga0105240_10000351 3300009093 Bacteria 86310
165 Ga0105240_10002121 3300009093 Bacteria 32409
166 Ga0105240_10046790 3300009093 Bacteria 5479
167 Ga0105240_10111955 3300009093 Unclassified 3301
168 Ga0111539_10002057 3300009094 Bacteria 26904
169 Ga0111539_10277182 3300009094 Bacteria 1951
170 Ga0111539_10350269 3300009094 Bacteria 1719
171 Ga0105245_10306366 3300009098 Bacteria 1560
172 Ga0105243_10188098 3300009148 Bacteria 1801
173 Ga0105241_10003535 3300009174 Bacteria 11622
174 Ga0105241_10091950 3300009174 Bacteria 2395
175 Ga0105241_10158193 3300009174 Bacteria 1860
176 Ga0105242_10015452 3300009176 Bacteria 5928
177 Ga0105242_10032231 3300009176 Bacteria 4190
178 Ga0105242_10038570 3300009176 Bacteria 3842
179 Ga0105242_10142479 3300009176 Bacteria 2081
180 Ga0105242_10222441 3300009176 Bacteria 1688
181 Ga0105242_10600359 3300009176 Unclassified 1063
182 Ga0105248_10035245 3300009177 Bacteria 5598
183 Ga0105237_10001047 3300009545 Bacteria 37145
184 Ga0105237_10256552 3300009545 Bacteria 1751
185 Ga0105238_10013859 3300009551 Bacteria 8150
186 Ga0105238_10086223 3300009551 Unclassified 3127
187 Ga0105238_10368409 3300009551 Bacteria 1427
188 Ga0105249_10008714 3300009553 Bacteria 8844
189 Ga0105249_10012537 3300009553 Bacteria 7470
190 Ga0105249_10103430 3300009553 Bacteria 2682
191 Ga0105249_10358655 3300009553 Unclassified 1479
192 Ga0105239_10005129 3300010375 Bacteria 15463
193 Ga0105239_10139067 3300010375 Bacteria 2705
194 Ga0105239_10622296 3300010375 Unclassified 1232
195 Ga0105239_10716430 3300010375 Bacteria 1144
196 Ga0105239_10872747 3300010375 Bacteria 1032
197 Ga0105246_10023285 3300011119 Bacteria 4006
198 Ga0157373_10000018 3300013100 Bacteria 169293
199 Ga0157373_10009480 3300013100 Bacteria 7193
200 Ga0157373_10028643 3300013100 Unclassified 4018
201 Ga0157371_10004770 3300013102 Bacteria 11689
202 Ga0157371_10010926 3300013102 Bacteria 7038
203 Ga0157371_10089093 3300013102 Bacteria 2185
204 Ga0157371_10157090 3300013102 Bacteria 1623
205 Ga0157370_10004426 3300013104 Bacteria 16098
206 Ga0157370_10032011 3300013104 Bacteria 5139
207 Ga0157369_10012393 3300013105 Bacteria 9680
208 Ga0157374_10030990 3300013296 Bacteria 4856
209 Ga0157374_11015689 3300013296 Bacteria 849
210 Ga0157378_10015762 3300013297 Bacteria 6618
211 Ga0157378_10027762 3300013297 Bacteria 4992
212 Ga0157378_10045062 3300013297 Bacteria 3918
213 Ga0157378_10141996 3300013297 Unclassified 2230
214 Ga0157378_10214373 3300013297 Unclassified 1827
215 Ga0157378_10342109 3300013297 Bacteria 1459
216 Ga0157378_10635102 3300013297 Bacteria 1082
217 Ga0157378_10951193 3300013297 Bacteria 892
218 Ga0163162_10000804 3300013306 Bacteria 29215
219 Ga0163162_10002715 3300013306 Bacteria 16793
220 Ga0163162_10004373 3300013306 Bacteria 13603
221 Ga0163162_10006583 3300013306 Bacteria 11257
222 Ga0163162_10020865 3300013306 Bacteria 6442
223 Ga0163162_10119608 3300013306 Bacteria 2737
224 Ga0163162_10366193 3300013306 Unclassified 1574
225 Ga0163162_10529456 3300013306 Bacteria 1308
226 Ga0157372_10000299 3300013307 Bacteria 55280
227 Ga0157372_10023618 3300013307 Bacteria 6670
228 Ga0157372_10042938 3300013307 Bacteria 5004
229 Ga0157372_10058435 3300013307 Bacteria 4311
230 Ga0157375_10004723 3300013308 Bacteria 11845
231 Ga0157375_10014678 3300013308 Bacteria 6997
232 Ga0157375_10124370 3300013308 Bacteria 2692
233 Ga0157375_10244982 3300013308 Bacteria 1952
234 Ga0157375_10516414 3300013308 Bacteria 1358
235 Ga0157375_10579257 3300013308 Bacteria 1283
236 Ga0163163_10002864 3300014325 Bacteria 14590
237 Ga0163163_10905889 3300014325 Bacteria 945
238 Ga0157380_10033957 3300014326 Bacteria 3931
239 Ga0157380_10041781 3300014326 Bacteria 3581
240 Ga0157377_10001182 3300014745 Bacteria 11091
241 Ga0157377_10056787 3300014745 Bacteria 2224
242 Ga0157377_10063796 3300014745 Bacteria 2111
243 Ga0157379_10060570 3300014968 Bacteria 3384
244 Ga0157379_10143793 3300014968 Bacteria 2151
245 Ga0157379_10520999 3300014968 Bacteria 1104
246 Ga0157379_10557409 3300014968 Bacteria 1067
247 Ga0157376_10000076 3300014969 Bacteria 75313
248 Ga0157376_10303521 3300014969 Bacteria 1512
249 Ga0157376_10963279 3300014969 Bacteria 874
250 Ga0163161_10108628 3300017792 Bacteria 2071
251 Ga0163161_10125758 3300017792 Bacteria 1930
252 Ga0163161_10131326 3300017792 Bacteria 1889
253 Ga0163161_10284696 3300017792 Bacteria 1298
254 Ga0209673_1000016 3300025273 Bacteria 506202
255 Ga0209673_1000111 3300025273 Bacteria 180094
256 Ga0209564_1007751 3300025295 Bacteria 5460
257 Ga0209564_1015941 3300025295 Bacteria 3029
258 Ga0209564_1042497 3300025295 Bacteria 1205
259 Ga0209758_1003887 3300025297 Bacteria 13070
260 Ga0209758_1009602 3300025297 Bacteria 5974
261 Ga0209050_1000444 3300025298 Bacteria 74945
262 Ga0209257_1002226 3300025304 Bacteria 19949
263 Ga0207697_10014627 3300025315 Bacteria 3253
264 Ga0207697_10018862 3300025315 Bacteria 2827
265 Ga0207656_10074085 3300025321 Bacteria 1519
266 Ga0207682_10013895 3300025893 Bacteria 3135
267 Ga0207642_10069294 3300025899 Bacteria 1672
268 Ga0207688_10038923 3300025901 Bacteria 2641
269 Ga0207688_10121870 3300025901 Bacteria 1522
270 Ga0207680_10230593 3300025903 Bacteria 1273
271 Ga0207680_10439064 3300025903 Unclassified 926
272 Ga0207647_10038674 3300025904 Unclassified 3015
273 Ga0207645_10000088 3300025907 Bacteria 65894
274 Ga0207643_10003479 3300025908 Bacteria 8476
275 Ga0207643_10016321 3300025908 Bacteria 4050
276 Ga0207654_10000954 3300025911 Bacteria 15883
277 Ga0207654_10030514 3300025911 Unclassified 2960
278 Ga0207654_10137940 3300025911 Bacteria 1552
279 Ga0207707_10217185 3300025912 Bacteria 1665
280 Ga0207695_10001744 3300025913 Bacteria 34548
281 Ga0207695_10002161 3300025913 Bacteria 29747
282 Ga0207695_10080419 3300025913 Unclassified 3300
283 Ga0207695_10265750 3300025913 Bacteria 1612
284 Ga0207671_10003764 3300025914 Bacteria 14924
285 Ga0207671_10005175 3300025914 Bacteria 12124
286 Ga0207662_10016126 3300025918 Bacteria 4212
287 Ga0207657_10007579 3300025919 Bacteria 11123
288 Ga0207649_10058059 3300025920 Bacteria 2422
289 Ga0207652_10089244 3300025921 Bacteria 2707
290 Ga0207652_10134790 3300025921 Bacteria 2205
291 Ga0207681_10004054 3300025923 Bacteria 9088
292 Ga0207681_10492741 3300025923 Unclassified 1002
293 Ga0207694_10009536 3300025924 Bacteria 7321
294 Ga0207694_10040150 3300025924 Bacteria 3602
295 Ga0207650_10061916 3300025925 Bacteria 2795
296 Ga0207650_10103369 3300025925 Bacteria 2197
297 Ga0207650_10114222 3300025925 Bacteria 2094
298 Ga0207650_10424938 3300025925 Unclassified 1103
299 Ga0207659_10016752 3300025926 Bacteria 4775
300 Ga0207659_10027214 3300025926 Bacteria 3868
301 Ga0207690_10050678 3300025932 Bacteria 2772
302 Ga0207690_10175715 3300025932 Bacteria 1608
303 Ga0207706_10005992 3300025933 Bacteria 11304
304 Ga0207706_10011729 3300025933 Bacteria 7987
305 Ga0207706_10121838 3300025933 Bacteria 2293
306 Ga0207686_10000722 3300025934 Bacteria 20514
307 Ga0207686_10160289 3300025934 Unclassified 1576
308 Ga0207686_10188207 3300025934 Unclassified 1469
309 Ga0207670_10013403 3300025936 Bacteria 4832
310 Ga0207670_10035554 3300025936 Bacteria 3231
311 Ga0207670_10581699 3300025936 Bacteria 918
312 Ga0207691_10011128 3300025940 Bacteria 8636
313 Ga0207691_10014497 3300025940 Bacteria 7517
314 Ga0207691_10637817 3300025940 Bacteria 900
315 Ga0207711_10018626 3300025941 Bacteria 5773
316 Ga0207689_10004872 3300025942 Bacteria 12099
317 Ga0207689_10016235 3300025942 Bacteria 6307
318 Ga0207689_10046252 3300025942 Bacteria 3597
319 Ga0207689_10080075 3300025942 Bacteria 2684
320 Ga0207661_10055245 3300025944 Bacteria 3184
321 Ga0207679_10443952 3300025945 Bacteria 1149
322 Ga0207667_10000378 3300025949 Bacteria 60324
323 Ga0207667_10117884 3300025949 Bacteria 2736
324 Ga0207667_10292592 3300025949 Unclassified 1664
325 Ga0207651_10023765 3300025960 Bacteria 3778
326 Ga0207651_10223342 3300025960 Bacteria 1524
327 Ga0207651_10429537 3300025960 Bacteria 1129
328 Ga0207651_10499335 3300025960 Unclassified 1051
329 Ga0207712_10009931 3300025961 Bacteria 6033
330 Ga0207712_10013068 3300025961 Bacteria 5319
331 Ga0207712_10282524 3300025961 Bacteria 1355
332 Ga0207712_10288059 3300025961 Unclassified 1343
333 Ga0207668_10145449 3300025972 Bacteria 1828
334 Ga0207640_10019924 3300025981 Unclassified 3973
335 Ga0207640_10074261 3300025981 Bacteria 2301
336 Ga0207640_10103989 3300025981 Unclassified 1998
337 Ga0207658_10012707 3300025986 Bacteria 5750
338 Ga0207658_10261956 3300025986 Unclassified 1474
339 Ga0207677_10346766 3300026023 Bacteria 1243
340 Ga0207703_10535631 3300026035 Unclassified 1103
341 Ga0207639_10023182 3300026041 Unclassified 4480
342 Ga0207639_10042241 3300026041 Bacteria 3416
343 Ga0207639_10204377 3300026041 Unclassified 1696
344 Ga0207639_10377333 3300026041 Bacteria 1273
345 Ga0207708_10071831 3300026075 Bacteria 2651
346 Ga0207702_10001415 3300026078 Bacteria 23965
347 Ga0207641_10000783 3300026088 Bacteria 33947
348 Ga0207641_10014439 3300026088 Bacteria 6472
349 Ga0207648_10014460 3300026089 Bacteria 7292
350 Ga0207648_10021773 3300026089 Bacteria 5759
351 Ga0207648_10026671 3300026089 Bacteria 5131
352 Ga0207648_10059282 3300026089 Bacteria 3338
353 Ga0207648_10229847 3300026089 Bacteria 1650
354 Ga0207648_10288820 3300026089 Unclassified 1468
355 Ga0207676_10338438 3300026095 Bacteria 1387
356 Ga0207674_10004846 3300026116 Bacteria 16113
357 Ga0207674_10039960 3300026116 Bacteria 4861
358 Ga0207674_10160551 3300026116 Bacteria 2202
359 Ga0207674_10339841 3300026116 Bacteria 1452
360 Ga0207675_100001641 3300026118 Bacteria 22422
361 Ga0207675_100054459 3300026118 Bacteria 3731
362 Ga0207683_10084270 3300026121 Bacteria 2825
363 Ga0207683_10174839 3300026121 Bacteria 1946
364 Ga0207683_10386565 3300026121 Bacteria 1287
365 Ga0207698_10000535 3300026142 Bacteria 22044
366 Ga0207698_10042541 3300026142 Bacteria 3395
367 Ga0207698_10047910 3300026142 Bacteria 3241
368 Ga0207698_10320277 3300026142 Bacteria 1452
369 Ga0207428_10220851 3300027907 Unclassified 1420
370 Ga0268266_10000010 3300028379 Bacteria 1030233
371 Ga0268266_10000024 3300028379 Bacteria 490820
372 Ga0268266_10176820 3300028379 Unclassified 1941
373 Ga0268266_10393914 3300028379 Unclassified 1308
374 Ga0268265_10039904 3300028380 Bacteria 3463
375 Ga0268265_10126074 3300028380 Bacteria 2119
376 Ga0268265_10298541 3300028380 Bacteria 1449
377 Ga0268264_10000012 3300028381 Bacteria 521740
378 Ga0268264_10003337 3300028381 Bacteria 13871
379 Ga0268264_10029807 3300028381 Bacteria 4472
380 Ga0268264_10208008 3300028381 Bacteria 1794
381 Ga0268264_10278544 3300028381 Bacteria 1565
382 Ga0307517_10271136 3300028786 Bacteria 976
383 Ga0307511_10000754 3300030521 Bacteria 34559
384 Ga0265331_10125339 3300031250 Bacteria 1173
385 Ga0265327_10000905 3300031251 Bacteria 43620
386 Ga0265327_10038414 3300031251 Bacteria 2612
387 Ga0307513_10308174 3300031456 Bacteria 1347
388 Ga0307516_10176614 3300031730 Bacteria 1872
389 Ga0307413_10354737 3300031824 Bacteria 1133
390 Ga0307411_10356102 3300032005 Bacteria 1195
391 Ga0395901_0134663 3300038443 Bacteria 2597
392 Ga0436365_0363641 3300039437 Bacteria 1186
393 Ga0439439_0080964 3300041406 Bacteria 878
394 Ga0439432_061473 3300042006 Bacteria 1158
395 Ga0439449_0002212 3300042007 Bacteria 7656
396 Ga0439454_012814 3300042011 Bacteria 1142
397 Ga0439457_006869 3300042014 Unclassified 2755
398 Ga0450898_010180 3300042134 Bacteria 1518
399 Ga0450899_005911 3300042135 Unclassified 1319
400 Ga0466972_0010664 3300044658 Bacteria 4610
401 Ga0466968_0005521 3300044735 Bacteria 4736
402 Ga0466968_0080831 3300044735 Bacteria 1428
403 Ga0466967_0122080 3300045976 Bacteria 2409
404 Ga0495650_0000025 3300046471 Bacteria 486001
405 Ga0495585_0000164 3300046492 Bacteria 71539
406 Ga0495583_0014107 3300046506 Bacteria 4422
407 Ga0495606_0000035 3300046507 Bacteria 243820
408 Ga0495606_0045201 3300046507 Bacteria 2921
409 Ga0495610_0001524 3300046512 Bacteria 20409
410 Ga0495616_0001397 3300046513 Bacteria 16818
411 Ga0495637_0044739 3300046520 Bacteria 1883
412 Ga0495648_0001260 3300046524 Bacteria 25264
413 Ga0495648_0002890 3300046524 Bacteria 15450
414 Ga0495609_0029519 3300046538 Bacteria 2497
415 Ga0495622_0124179 3300046557 Bacteria 1178
416 Ga0495633_0042573 3300046558 Bacteria 2156
417 Ga0495625_0000063 3300046660 Bacteria 176435
418 Ga0495661_0007010 3300046665 Bacteria 7879
419 Ga0495649_0000006 3300046694 Bacteria 542188
420 Ga0495683_0081292 3300047323 Bacteria 1580
421 Ga0495687_000009 3300047443 Bacteria 419317
422 Ga0495687_008344 3300047443 Bacteria 5943
423 Ga0495686_0047809 3300047472 Bacteria 2700
424 Ga0495686_0051409 3300047472 Bacteria 2586
425 Ga0495686_0126503 3300047472 Bacteria 1519
426 Ga0495686_0327043 3300047472 Bacteria 839
427 Ga0496101_0029567 3300048904 Bacteria 3833
428 Ga0496102_0233244 3300048905 Bacteria 1735
429 Ga0496114_0025542 3300048917 Bacteria 4829
430 Ga0501031_0008613 3300049568 Bacteria 6634
431 Ga0501036_0001958 3300049572 Bacteria 15990
432 Ga0501038_0023799 3300049574 Bacteria 5471
433 Ga0501039_0187733 3300049575 Bacteria 1625
434 Ga0501046_0121380 3300049580 Bacteria 1988
435 Ga0501047_0129084 3300049581 Bacteria 2408
436 Ga0501072_0162640 3300049588 Unclassified 1781
437 Ga0501035_0181394 3300049822 Bacteria 1814
438 Ga0501044_0040984 3300049823 Unclassified 4822
439 Ga0501044_0194495 3300049823 Unclassified 1989
440 nmdc:mga0k408_1333_c1 3300050493 Bacteria 7020
441 nmdc:mga0k408_16161_c1 3300050493 Bacteria 4137
442 nmdc:mga07m45_129733_c1 3300050496 Bacteria 1458
443 nmdc:mga08y16_16851_c1 3300050511 Bacteria 7692
444 nmdc:mga08y16_58081_c1 3300050511 Bacteria 4042
445 Ga0500583_0009136 3300053092 Bacteria 3604
446 Ga0500583_0035179 3300053092 Bacteria 2233
447 Ga0500651_0325274 3300053093 Unclassified 877
448 Ga0500568_0039978 3300053139 Bacteria 1890
449 Ga0500616_0125760 3300053153 Bacteria 1218
450 Ga0500622_0001926 3300053156 Bacteria 15649
451 Ga0500622_0005243 3300053156 Bacteria 7831
452 Ga0500637_0071273 3300053178 Unclassified 1999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0194495 Ga0501044_0194495_1335_1976 212
2 3300031824 Ga0307413_10354737 Ga0307413_103547371 218
3 3300032005 Ga0307411_10356102 Ga0307411_103561022 220
4 3300050496 nmdc:mga07m45_129733_c1 nmdc:mga07m45_129733_c1_261_938 220
5 3300005289 Ga0065704_10115764 Ga0065704_101157642 223
6 3300005366 Ga0070659_100743308 Ga0070659_1007433081 223
7 3300002741 JGI25157J39369_1013946 JGI25157J39369_10139462 225
8 3300003323 rootH1_10210526 rootH1_102105262 225
9 3300005535 Ga0070684_100032241 Ga0070684_1000322414 225
10 3300013100 Ga0157373_10000018 Ga0157373_1000001817 225
11 3300013296 Ga0157374_11015689 Ga0157374_110156892 225
12 3300013307 Ga0157372_10023618 Ga0157372_100236185 225
13 3300005539 Ga0068853_100120342 Ga0068853_1001203422 226
14 3300005548 Ga0070665_100000006 Ga0070665_100000006263 226
15 3300005577 Ga0068857_100432630 Ga0068857_1004326302 226
16 3300005616 Ga0068852_100162370 Ga0068852_1001623702 226
17 3300005616 Ga0068852_100747362 Ga0068852_1007473621 226
18 3300005843 Ga0068860_100000005 Ga0068860_100000005205 226
19 3300009093 Ga0105240_10000351 Ga0105240_100003515 226
20 3300009174 Ga0105241_10003535 Ga0105241_1000353511 226
21 3300009551 Ga0105238_10013859 Ga0105238_100138592 226
22 3300013297 Ga0157378_10214373 Ga0157378_102143732 226
23 3300013306 Ga0163162_10004373 Ga0163162_100043735 226
24 3300013307 Ga0157372_10058435 Ga0157372_100584353 226
25 3300025903 Ga0207680_10230593 Ga0207680_102305931 226
26 3300025911 Ga0207654_10000954 Ga0207654_1000095411 226
27 3300025913 Ga0207695_10002161 Ga0207695_1000216123 226
28 3300025914 Ga0207671_10005175 Ga0207671_100051756 226
29 3300025924 Ga0207694_10040150 Ga0207694_100401502 226
30 3300026142 Ga0207698_10320277 Ga0207698_103202772 226
31 3300028379 Ga0268266_10000010 Ga0268266_10000010344 226
32 3300028381 Ga0268264_10000012 Ga0268264_10000012187 226
33 3300028786 Ga0307517_10271136 Ga0307517_102711362 226
34 3300044658 Ga0466972_0010664 Ga0466972_0010664_2127_2807 226
35 3300044735 Ga0466968_0005521 Ga0466968_0005521_2282_2962 226
36 3300046524 Ga0495648_0001260 Ga0495648_0001260_11157_11837 226
37 3300047443 Ga0495687_000009 Ga0495687_000009_104416_105096 226
38 3300053092 Ga0500583_0009136 Ga0500583_0009136_2077_2757 226
39 3300053139 Ga0500568_0039978 Ga0500568_0039978_475_1155 226
40 3300053153 Ga0500616_0125760 Ga0500616_0125760_302_982 226
41 3300053156 Ga0500622_0005243 Ga0500622_0005243_6183_6863 226
42 3300009553 Ga0105249_10358655 Ga0105249_103586552 227
43 3300005617 Ga0068859_100398881 Ga0068859_1003988812 228
44 3300006931 Ga0097620_100398873 Ga0097620_1003988732 228
45 iso_pu_bacteria 2896109856 2896114449 228
46 3300005327 Ga0070658_10172155 Ga0070658_101721552 229
47 3300005344 Ga0070661_100264361 Ga0070661_1002643612 229
48 3300005614 Ga0068856_100956003 Ga0068856_1009560032 229
49 3300003322 rootL2_10126313 rootL2_101263132 230
50 iso_pu_bacteria 2884791551 2884795336 230
51 3300003320 rootH2_10020070 rootH2_100200702 231
52 3300005366 Ga0070659_100209262 Ga0070659_1002092621 231
53 3300005563 Ga0068855_100117547 Ga0068855_1001175472 231
54 3300005577 Ga0068857_100002131 Ga0068857_1000021317 231
55 3300005578 Ga0068854_100017324 Ga0068854_1000173243 231
56 3300005614 Ga0068856_100023414 Ga0068856_1000234144 231
57 3300005616 Ga0068852_100000224 Ga0068852_10000022414 231
58 3300009093 Ga0105240_10111955 Ga0105240_101119552 231
59 3300009174 Ga0105241_10091950 Ga0105241_100919502 231
60 3300009551 Ga0105238_10368409 Ga0105238_103684092 231
61 3300013105 Ga0157369_10012393 Ga0157369_100123939 231
62 3300013307 Ga0157372_10000299 Ga0157372_1000029916 231
63 3300025904 Ga0207647_10038674 Ga0207647_100386742 231
64 3300025911 Ga0207654_10030514 Ga0207654_100305142 231
65 3300025913 Ga0207695_10080419 Ga0207695_100804192 231
66 3300025924 Ga0207694_10009536 Ga0207694_100095362 231
67 3300025932 Ga0207690_10175715 Ga0207690_101757151 231
68 3300025949 Ga0207667_10000378 Ga0207667_1000037820 231
69 3300025981 Ga0207640_10019924 Ga0207640_100199243 231
70 3300026041 Ga0207639_10023182 Ga0207639_100231824 231
71 3300026116 Ga0207674_10004846 Ga0207674_100048467 231
72 3300026142 Ga0207698_10000535 Ga0207698_100005354 231
73 3300005614 Ga0068856_100000112 Ga0068856_10000011218 232
74 3300013297 Ga0157378_10951193 Ga0157378_109511931 232
75 3300026078 Ga0207702_10001415 Ga0207702_100014155 232
76 3300039437 Ga0436365_0363641 Ga0436365_0363641_306_1007 232
77 3300005563 Ga0068855_100343666 Ga0068855_1003436662 233
78 3300005843 Ga0068860_100001321 Ga0068860_10000132117 233
79 3300006358 Ga0068871_100677902 Ga0068871_1006779021 233
80 3300009093 Ga0105240_10002121 Ga0105240_1000212124 233
81 3300009093 Ga0105240_10046790 Ga0105240_100467904 233
82 3300009545 Ga0105237_10001047 Ga0105237_100010477 233
83 3300009551 Ga0105238_10086223 Ga0105238_100862232 233
84 3300010375 Ga0105239_10005129 Ga0105239_100051293 233
85 3300010375 Ga0105239_10622296 Ga0105239_106222962 233
86 3300013306 Ga0163162_10366193 Ga0163162_103661931 233
87 3300025903 Ga0207680_10439064 Ga0207680_104390642 233
88 3300025913 Ga0207695_10001744 Ga0207695_1000174420 233
89 3300025913 Ga0207695_10265750 Ga0207695_102657502 233
90 3300025914 Ga0207671_10003764 Ga0207671_100037647 233
91 3300025949 Ga0207667_10292592 Ga0207667_102925922 233
92 3300026089 Ga0207648_10288820 Ga0207648_102888202 233
93 3300028381 Ga0268264_10003337 Ga0268264_100033376 233
94 3300003316 rootH1_10110650 rootH1_101106502 234
95 3300005327 Ga0070658_10194245 Ga0070658_101942451 234
96 3300005330 Ga0070690_100633424 Ga0070690_1006334241 234
97 3300005441 Ga0070700_100054288 Ga0070700_1000542882 234
98 3300005616 Ga0068852_100355349 Ga0068852_1003553492 234
99 3300006195 Ga0075366_10036650 Ga0075366_100366502 234
100 3300014325 Ga0163163_10905889 Ga0163163_109058892 234
101 3300025949 Ga0207667_10117884 Ga0207667_101178842 234
102 3300031250 Ga0265331_10125339 Ga0265331_101253391 234
103 3300042006 Ga0439432_061473 Ga0439432_061473_107_814 234
104 3300042134 Ga0450898_010180 Ga0450898_010180_84_791 234
105 3300042135 Ga0450899_005911 Ga0450899_005911_571_1278 234
106 3300047472 Ga0495686_0051409 Ga0495686_0051409_814_1521 234
107 3300049822 Ga0501035_0181394 Ga0501035_0181394_559_1266 234
108 3300050493 nmdc:mga0k408_16161_c1 nmdc:mga0k408_16161_c1_2281_2988 234
109 3300003322 rootL2_10097428 rootL2_100974284 235
110 3300005290 Ga0065712_10073717 Ga0065712_100737172 235
111 3300005328 Ga0070676_10018452 Ga0070676_100184522 235
112 3300005331 Ga0070670_100029489 Ga0070670_1000294892 235
113 3300005331 Ga0070670_100030934 Ga0070670_1000309344 235
114 3300005331 Ga0070670_100039660 Ga0070670_1000396602 235
115 3300005335 Ga0070666_10083972 Ga0070666_100839723 235
116 3300005337 Ga0070682_100380419 Ga0070682_1003804191 235
117 3300005340 Ga0070689_100025063 Ga0070689_1000250632 235
118 3300005340 Ga0070689_100068514 Ga0070689_1000685142 235
119 3300005340 Ga0070689_100306173 Ga0070689_1003061731 235
120 3300005347 Ga0070668_100460507 Ga0070668_1004605071 235
121 3300005353 Ga0070669_100004896 Ga0070669_1000048966 235
122 3300005353 Ga0070669_100172406 Ga0070669_1001724062 235
123 3300005354 Ga0070675_100017274 Ga0070675_1000172745 235
124 3300005354 Ga0070675_100043491 Ga0070675_1000434913 235
125 3300005354 Ga0070675_100286315 Ga0070675_1002863151 235
126 3300005355 Ga0070671_100041014 Ga0070671_1000410143 235
127 3300005356 Ga0070674_100464201 Ga0070674_1004642012 235
128 3300005364 Ga0070673_100024789 Ga0070673_1000247893 235
129 3300005364 Ga0070673_100115016 Ga0070673_1001150163 235
130 3300005364 Ga0070673_100539342 Ga0070673_1005393422 235
131 3300005365 Ga0070688_100009911 Ga0070688_1000099112 235
132 3300005365 Ga0070688_100021280 Ga0070688_1000212803 235
133 3300005367 Ga0070667_100023628 Ga0070667_1000236285 235
134 3300005455 Ga0070663_100532830 Ga0070663_1005328301 235
135 3300005458 Ga0070681_10224424 Ga0070681_102244242 235
136 3300005459 Ga0068867_100014476 Ga0068867_1000144764 235
137 3300005459 Ga0068867_100059218 Ga0068867_1000592182 235
138 3300005466 Ga0070685_10010908 Ga0070685_100109084 235
139 3300005466 Ga0070685_10146866 Ga0070685_101468662 235
140 3300005530 Ga0070679_100198215 Ga0070679_1001982152 235
141 3300005539 Ga0068853_100166731 Ga0068853_1001667313 235
142 3300005543 Ga0070672_100030045 Ga0070672_1000300452 235
143 3300005548 Ga0070665_100218129 Ga0070665_1002181291 235
144 3300005549 Ga0070704_100112498 Ga0070704_1001124982 235
145 3300005564 Ga0070664_100291892 Ga0070664_1002918922 235
146 3300005577 Ga0068857_100011432 Ga0068857_1000114325 235
147 3300005614 Ga0068856_100161322 Ga0068856_1001613222 235
148 3300005616 Ga0068852_100134066 Ga0068852_1001340663 235
149 3300005616 Ga0068852_100257980 Ga0068852_1002579802 235
150 3300005617 Ga0068859_100049512 Ga0068859_1000495124 235
151 3300005617 Ga0068859_100070937 Ga0068859_1000709372 235
152 3300005617 Ga0068859_100077133 Ga0068859_1000771335 235
153 3300005617 Ga0068859_100333273 Ga0068859_1003332732 235
154 3300005618 Ga0068864_100208331 Ga0068864_1002083312 235
155 3300005719 Ga0068861_100006035 Ga0068861_1000060356 235
156 3300005834 Ga0068851_10215193 Ga0068851_102151931 235
157 3300005841 Ga0068863_100024402 Ga0068863_1000244022 235
158 3300005841 Ga0068863_100108018 Ga0068863_1001080183 235
159 3300005841 Ga0068863_100265168 Ga0068863_1002651682 235
160 3300005842 Ga0068858_100567745 Ga0068858_1005677451 235
161 3300005843 Ga0068860_100015303 Ga0068860_1000153032 235
162 3300005843 Ga0068860_100042328 Ga0068860_1000423282 235
163 3300005844 Ga0068862_100037916 Ga0068862_1000379162 235
164 3300005844 Ga0068862_100055613 Ga0068862_1000556132 235
165 3300005844 Ga0068862_100349929 Ga0068862_1003499292 235
166 3300006237 Ga0097621_100003171 Ga0097621_1000031713 235
167 3300006237 Ga0097621_100004097 Ga0097621_1000040978 235
168 3300006237 Ga0097621_100318222 Ga0097621_1003182222 235
169 3300006358 Ga0068871_100000275 Ga0068871_10000027515 235
170 3300006931 Ga0097620_100049506 Ga0097620_1000495063 235
171 3300006931 Ga0097620_100070941 Ga0097620_1000709412 235
172 3300006931 Ga0097620_100077131 Ga0097620_1000771315 235
173 3300006931 Ga0097620_100333277 Ga0097620_1003332771 235
174 3300009094 Ga0111539_10002057 Ga0111539_1000205719 235
175 3300009094 Ga0111539_10277182 Ga0111539_102771822 235
176 3300009094 Ga0111539_10350269 Ga0111539_103502692 235
177 3300009174 Ga0105241_10158193 Ga0105241_101581932 235
178 3300009176 Ga0105242_10015452 Ga0105242_100154525 235
179 3300009176 Ga0105242_10032231 Ga0105242_100322312 235
180 3300009176 Ga0105242_10222441 Ga0105242_102224412 235
181 3300009176 Ga0105242_10600359 Ga0105242_106003591 235
182 3300009177 Ga0105248_10035245 Ga0105248_100352453 235
183 3300009545 Ga0105237_10256552 Ga0105237_102565522 235
184 3300009553 Ga0105249_10103430 Ga0105249_101034302 235
185 3300010375 Ga0105239_10139067 Ga0105239_101390672 235
186 3300013100 Ga0157373_10028643 Ga0157373_100286432 235
187 3300013102 Ga0157371_10004770 Ga0157371_100047704 235
188 3300013102 Ga0157371_10010926 Ga0157371_100109264 235
189 3300013297 Ga0157378_10027762 Ga0157378_100277624 235
190 3300013306 Ga0163162_10000804 Ga0163162_100008049 235
191 3300013306 Ga0163162_10002715 Ga0163162_100027157 235
192 3300013306 Ga0163162_10119608 Ga0163162_101196082 235
193 3300013308 Ga0157375_10004723 Ga0157375_1000472310 235
194 3300013308 Ga0157375_10124370 Ga0157375_101243704 235
195 3300013308 Ga0157375_10244982 Ga0157375_102449822 235
196 3300013308 Ga0157375_10579257 Ga0157375_105792572 235
197 3300014325 Ga0163163_10002864 Ga0163163_100028645 235
198 3300014326 Ga0157380_10033957 Ga0157380_100339572 235
199 3300014326 Ga0157380_10041781 Ga0157380_100417813 235
200 3300014745 Ga0157377_10001182 Ga0157377_100011826 235
201 3300014745 Ga0157377_10063796 Ga0157377_100637962 235
202 3300014968 Ga0157379_10520999 Ga0157379_105209992 235
203 3300014969 Ga0157376_10000076 Ga0157376_1000007655 235
204 3300014969 Ga0157376_10303521 Ga0157376_103035212 235
205 3300017792 Ga0163161_10108628 Ga0163161_101086282 235
206 3300017792 Ga0163161_10125758 Ga0163161_101257581 235
207 3300017792 Ga0163161_10284696 Ga0163161_102846962 235
208 3300025315 Ga0207697_10018862 Ga0207697_100188622 235
209 3300025893 Ga0207682_10013895 Ga0207682_100138952 235
210 3300025901 Ga0207688_10121870 Ga0207688_101218702 235
211 3300025908 Ga0207643_10003479 Ga0207643_100034793 235
212 3300025908 Ga0207643_10016321 Ga0207643_100163213 235
213 3300025911 Ga0207654_10137940 Ga0207654_101379401 235
214 3300025918 Ga0207662_10016126 Ga0207662_100161262 235
215 3300025923 Ga0207681_10004054 Ga0207681_100040545 235
216 3300025923 Ga0207681_10492741 Ga0207681_104927412 235
217 3300025925 Ga0207650_10061916 Ga0207650_100619163 235
218 3300025925 Ga0207650_10103369 Ga0207650_101033692 235
219 3300025925 Ga0207650_10424938 Ga0207650_104249382 235
220 3300025926 Ga0207659_10016752 Ga0207659_100167525 235
221 3300025926 Ga0207659_10027214 Ga0207659_100272142 235
222 3300025933 Ga0207706_10011729 Ga0207706_100117296 235
223 3300025934 Ga0207686_10000722 Ga0207686_1000072215 235
224 3300025934 Ga0207686_10188207 Ga0207686_101882072 235
225 3300025936 Ga0207670_10013403 Ga0207670_100134032 235
226 3300025936 Ga0207670_10035554 Ga0207670_100355543 235
227 3300025936 Ga0207670_10581699 Ga0207670_105816991 235
228 3300025940 Ga0207691_10014497 Ga0207691_100144974 235
229 3300025941 Ga0207711_10018626 Ga0207711_100186263 235
230 3300025942 Ga0207689_10046252 Ga0207689_100462523 235
231 3300025960 Ga0207651_10023765 Ga0207651_100237653 235
232 3300025960 Ga0207651_10429537 Ga0207651_104295371 235
233 3300025960 Ga0207651_10499335 Ga0207651_104993351 235
234 3300025961 Ga0207712_10009931 Ga0207712_100099313 235
235 3300025961 Ga0207712_10282524 Ga0207712_102825242 235
236 3300025986 Ga0207658_10012707 Ga0207658_100127075 235
237 3300026023 Ga0207677_10346766 Ga0207677_103467662 235
238 3300026035 Ga0207703_10535631 Ga0207703_105356311 235
239 3300026041 Ga0207639_10204377 Ga0207639_102043772 235
240 3300026041 Ga0207639_10377333 Ga0207639_103773332 235
241 3300026075 Ga0207708_10071831 Ga0207708_100718312 235
242 3300026088 Ga0207641_10000783 Ga0207641_1000078313 235
243 3300026088 Ga0207641_10014439 Ga0207641_100144393 235
244 3300026089 Ga0207648_10021773 Ga0207648_100217733 235
245 3300026089 Ga0207648_10026671 Ga0207648_100266713 235
246 3300026089 Ga0207648_10059282 Ga0207648_100592822 235
247 3300026095 Ga0207676_10338438 Ga0207676_103384382 235
248 3300026116 Ga0207674_10039960 Ga0207674_100399602 235
249 3300026118 Ga0207675_100001641 Ga0207675_1000016411 235
250 3300026121 Ga0207683_10084270 Ga0207683_100842703 235
251 3300026121 Ga0207683_10174839 Ga0207683_101748392 235
252 3300026142 Ga0207698_10047910 Ga0207698_100479103 235
253 3300027907 Ga0207428_10220851 Ga0207428_102208512 235
254 3300028379 Ga0268266_10176820 Ga0268266_101768201 235
255 3300028380 Ga0268265_10039904 Ga0268265_100399042 235
256 3300028380 Ga0268265_10298541 Ga0268265_102985412 235
257 3300028381 Ga0268264_10029807 Ga0268264_100298073 235
258 3300030521 Ga0307511_10000754 Ga0307511_1000075411 235
259 3300031730 Ga0307516_10176614 Ga0307516_101766142 235
260 3300038443 Ga0395901_0134663 Ga0395901_0134663_142_858 235
261 3300041406 Ga0439439_0080964 Ga0439439_0080964_39_749 235
262 3300042007 Ga0439449_0002212 Ga0439449_0002212_6551_7261 235
263 3300042014 Ga0439457_006869 Ga0439457_006869_724_1434 235
264 3300046471 Ga0495650_0000025 Ga0495650_0000025_449039_449758 235
265 3300046492 Ga0495585_0000164 Ga0495585_0000164_47941_48660 235
266 3300046506 Ga0495583_0014107 Ga0495583_0014107_3685_4404 235
267 3300046507 Ga0495606_0000035 Ga0495606_0000035_121290_122009 235
268 3300046507 Ga0495606_0045201 Ga0495606_0045201_2071_2790 235
269 3300046512 Ga0495610_0001524 Ga0495610_0001524_3225_3944 235
270 3300046513 Ga0495616_0001397 Ga0495616_0001397_2911_3630 235
271 3300046520 Ga0495637_0044739 Ga0495637_0044739_263_982 235
272 3300046538 Ga0495609_0029519 Ga0495609_0029519_1691_2410 235
273 3300046557 Ga0495622_0124179 Ga0495622_0124179_119_838 235
274 3300046558 Ga0495633_0042573 Ga0495633_0042573_1097_1816 235
275 3300046660 Ga0495625_0000063 Ga0495625_0000063_103413_104132 235
276 3300046665 Ga0495661_0007010 Ga0495661_0007010_4840_5559 235
277 3300046694 Ga0495649_0000006 Ga0495649_0000006_93311_94030 235
278 3300047323 Ga0495683_0081292 Ga0495683_0081292_384_1103 235
279 3300047443 Ga0495687_008344 Ga0495687_008344_2279_2998 235
280 3300047472 Ga0495686_0047809 Ga0495686_0047809_936_1655 235
281 3300047472 Ga0495686_0327043 Ga0495686_0327043_39_752 235
282 3300048904 Ga0496101_0029567 Ga0496101_0029567_550_1260 235
283 3300048905 Ga0496102_0233244 Ga0496102_0233244_155_865 235
284 3300048917 Ga0496114_0025542 Ga0496114_0025542_3873_4583 235
285 3300049581 Ga0501047_0129084 Ga0501047_0129084_508_1218 235
286 3300050511 nmdc:mga08y16_16851_c1 nmdc:mga08y16_16851_c1_5917_6627 235
287 3300050511 nmdc:mga08y16_58081_c1 nmdc:mga08y16_58081_c1_3210_3920 235
288 3300053093 Ga0500651_0325274 Ga0500651_0325274_112_825 235
289 3300053178 Ga0500637_0071273 Ga0500637_0071273_1011_1724 235
290 3300002077 JGI24744J21845_10031075 JGI24744J21845_100310752 236
291 3300003215 JGI25153J46596_10015745 JGI25153J46596_100157454 236
292 3300003215 JGI25153J46596_10024360 JGI25153J46596_100243602 236
293 3300003320 rootH2_10150096 rootH2_101500962 236
294 3300003790 Ga0055528_1000698 Ga0055528_100069822 236
295 3300003790 Ga0055528_1001196 Ga0055528_10011967 236
296 3300003791 Ga0055530_10003193 Ga0055530_100031934 236
297 3300003794 Ga0055531_10036078 Ga0055531_100360781 236
298 3300005262 Ga0065165_1000012 Ga0065165_1000012172 236
299 3300005329 Ga0070683_100005727 Ga0070683_1000057274 236
300 3300005331 Ga0070670_100013962 Ga0070670_1000139628 236
301 3300005331 Ga0070670_100053001 Ga0070670_1000530013 236
302 3300005333 Ga0070677_10006668 Ga0070677_100066684 236
303 3300005334 Ga0068869_100200722 Ga0068869_1002007222 236
304 3300005335 Ga0070666_10384805 Ga0070666_103848051 236
305 3300005337 Ga0070682_100104255 Ga0070682_1001042552 236
306 3300005338 Ga0068868_100098237 Ga0068868_1000982373 236
307 3300005338 Ga0068868_100143745 Ga0068868_1001437451 236
308 3300005339 Ga0070660_100010731 Ga0070660_1000107317 236
309 3300005344 Ga0070661_100073359 Ga0070661_1000733592 236
310 3300005347 Ga0070668_100083379 Ga0070668_1000833792 236
311 3300005347 Ga0070668_100131958 Ga0070668_1001319582 236
312 3300005353 Ga0070669_100067464 Ga0070669_1000674643 236
313 3300005354 Ga0070675_100122325 Ga0070675_1001223252 236
314 3300005354 Ga0070675_100135441 Ga0070675_1001354411 236
315 3300005355 Ga0070671_100281602 Ga0070671_1002816022 236
316 3300005364 Ga0070673_100005984 Ga0070673_1000059848 236
317 3300005366 Ga0070659_100038342 Ga0070659_1000383422 236
318 3300005367 Ga0070667_100167357 Ga0070667_1001673572 236
319 3300005456 Ga0070678_100152640 Ga0070678_1001526402 236
320 3300005457 Ga0070662_100006870 Ga0070662_1000068708 236
321 3300005457 Ga0070662_100055394 Ga0070662_1000553943 236
322 3300005458 Ga0070681_10284355 Ga0070681_102843552 236
323 3300005459 Ga0068867_100093796 Ga0068867_1000937963 236
324 3300005459 Ga0068867_100114070 Ga0068867_1001140702 236
325 3300005459 Ga0068867_100474523 Ga0068867_1004745232 236
326 3300005530 Ga0070679_100027399 Ga0070679_1000273992 236
327 3300005530 Ga0070679_100200738 Ga0070679_1002007383 236
328 3300005535 Ga0070684_100010799 Ga0070684_1000107997 236
329 3300005539 Ga0068853_100052338 Ga0068853_1000523383 236
330 3300005539 Ga0068853_100109075 Ga0068853_1001090752 236
331 3300005543 Ga0070672_100265813 Ga0070672_1002658132 236
332 3300005543 Ga0070672_100679785 Ga0070672_1006797852 236
333 3300005547 Ga0070693_100115617 Ga0070693_1001156172 236
334 3300005548 Ga0070665_100025670 Ga0070665_1000256703 236
335 3300005563 Ga0068855_100031956 Ga0068855_1000319567 236
336 3300005564 Ga0070664_100239812 Ga0070664_1002398121 236
337 3300005577 Ga0068857_100072559 Ga0068857_1000725594 236
338 3300005616 Ga0068852_100075626 Ga0068852_1000756264 236
339 3300005617 Ga0068859_100166421 Ga0068859_1001664212 236
340 3300005617 Ga0068859_101074941 Ga0068859_1010749412 236
341 3300005718 Ga0068866_10046992 Ga0068866_100469922 236
342 3300005719 Ga0068861_100073435 Ga0068861_1000734352 236
343 3300005840 Ga0068870_10003550 Ga0068870_100035508 236
344 3300005841 Ga0068863_100878505 Ga0068863_1008785052 236
345 3300005844 Ga0068862_100196862 Ga0068862_1001968622 236
346 3300006195 Ga0075366_10005272 Ga0075366_100052726 236
347 3300006237 Ga0097621_100061401 Ga0097621_1000614013 236
348 3300006237 Ga0097621_100221875 Ga0097621_1002218751 236
349 3300006358 Ga0068871_100013546 Ga0068871_1000135466 236
350 3300006358 Ga0068871_100067217 Ga0068871_1000672173 236
351 3300006358 Ga0068871_100185041 Ga0068871_1001850412 236
352 3300006931 Ga0097620_100166421 Ga0097620_1001664212 236
353 3300006931 Ga0097620_101074875 Ga0097620_1010748751 236
354 3300009098 Ga0105245_10306366 Ga0105245_103063662 236
355 3300009148 Ga0105243_10188098 Ga0105243_101880982 236
356 3300009176 Ga0105242_10038570 Ga0105242_100385702 236
357 3300009176 Ga0105242_10142479 Ga0105242_101424791 236
358 3300009553 Ga0105249_10008714 Ga0105249_100087143 236
359 3300009553 Ga0105249_10012537 Ga0105249_100125374 236
360 3300010375 Ga0105239_10716430 Ga0105239_107164301 236
361 3300010375 Ga0105239_10872747 Ga0105239_108727471 236
362 3300011119 Ga0105246_10023285 Ga0105246_100232854 236
363 3300013100 Ga0157373_10009480 Ga0157373_100094808 236
364 3300013102 Ga0157371_10089093 Ga0157371_100890931 236
365 3300013102 Ga0157371_10157090 Ga0157371_101570902 236
366 3300013104 Ga0157370_10004426 Ga0157370_1000442614 236
367 3300013104 Ga0157370_10032011 Ga0157370_100320112 236
368 3300013296 Ga0157374_10030990 Ga0157374_100309904 236
369 3300013297 Ga0157378_10015762 Ga0157378_100157625 236
370 3300013297 Ga0157378_10045062 Ga0157378_100450623 236
371 3300013297 Ga0157378_10141996 Ga0157378_101419963 236
372 3300013297 Ga0157378_10342109 Ga0157378_103421093 236
373 3300013297 Ga0157378_10635102 Ga0157378_106351022 236
374 3300013306 Ga0163162_10006583 Ga0163162_100065833 236
375 3300013306 Ga0163162_10020865 Ga0163162_100208653 236
376 3300013306 Ga0163162_10529456 Ga0163162_105294562 236
377 3300013307 Ga0157372_10042938 Ga0157372_100429384 236
378 3300013308 Ga0157375_10014678 Ga0157375_100146781 236
379 3300013308 Ga0157375_10516414 Ga0157375_105164141 236
380 3300014745 Ga0157377_10056787 Ga0157377_100567871 236
381 3300014968 Ga0157379_10060570 Ga0157379_100605702 236
382 3300014968 Ga0157379_10143793 Ga0157379_101437932 236
383 3300014968 Ga0157379_10557409 Ga0157379_105574091 236
384 3300014969 Ga0157376_10963279 Ga0157376_109632792 236
385 3300017792 Ga0163161_10131326 Ga0163161_101313261 236
386 3300025273 Ga0209673_1000016 Ga0209673_1000016398 236
387 3300025273 Ga0209673_1000111 Ga0209673_100011146 236
388 3300025295 Ga0209564_1007751 Ga0209564_10077513 236
389 3300025295 Ga0209564_1015941 Ga0209564_10159413 236
390 3300025295 Ga0209564_1042497 Ga0209564_10424972 236
391 3300025297 Ga0209758_1003887 Ga0209758_10038873 236
392 3300025297 Ga0209758_1009602 Ga0209758_10096023 236
393 3300025298 Ga0209050_1000444 Ga0209050_100044461 236
394 3300025304 Ga0209257_1002226 Ga0209257_10022264 236
395 3300025315 Ga0207697_10014627 Ga0207697_100146273 236
396 3300025321 Ga0207656_10074085 Ga0207656_100740851 236
397 3300025899 Ga0207642_10069294 Ga0207642_100692942 236
398 3300025901 Ga0207688_10038923 Ga0207688_100389232 236
399 3300025907 Ga0207645_10000088 Ga0207645_1000008824 236
400 3300025912 Ga0207707_10217185 Ga0207707_102171852 236
401 3300025919 Ga0207657_10007579 Ga0207657_100075794 236
402 3300025920 Ga0207649_10058059 Ga0207649_100580592 236
403 3300025921 Ga0207652_10089244 Ga0207652_100892442 236
404 3300025921 Ga0207652_10134790 Ga0207652_101347902 236
405 3300025925 Ga0207650_10114222 Ga0207650_101142223 236
406 3300025932 Ga0207690_10050678 Ga0207690_100506782 236
407 3300025933 Ga0207706_10005992 Ga0207706_100059929 236
408 3300025933 Ga0207706_10121838 Ga0207706_101218382 236
409 3300025934 Ga0207686_10160289 Ga0207686_101602891 236
410 3300025940 Ga0207691_10011128 Ga0207691_100111284 236
411 3300025940 Ga0207691_10637817 Ga0207691_106378171 236
412 3300025942 Ga0207689_10004872 Ga0207689_100048726 236
413 3300025942 Ga0207689_10016235 Ga0207689_100162352 236
414 3300025942 Ga0207689_10080075 Ga0207689_100800753 236
415 3300025944 Ga0207661_10055245 Ga0207661_100552453 236
416 3300025945 Ga0207679_10443952 Ga0207679_104439522 236
417 3300025960 Ga0207651_10223342 Ga0207651_102233422 236
418 3300025961 Ga0207712_10013068 Ga0207712_100130682 236
419 3300025961 Ga0207712_10288059 Ga0207712_102880592 236
420 3300025972 Ga0207668_10145449 Ga0207668_101454491 236
421 3300025981 Ga0207640_10074261 Ga0207640_100742612 236
422 3300025981 Ga0207640_10103989 Ga0207640_101039892 236
423 3300025986 Ga0207658_10261956 Ga0207658_102619562 236
424 3300026041 Ga0207639_10042241 Ga0207639_100422412 236
425 3300026089 Ga0207648_10014460 Ga0207648_100144606 236
426 3300026089 Ga0207648_10229847 Ga0207648_102298472 236
427 3300026116 Ga0207674_10160551 Ga0207674_101605511 236
428 3300026116 Ga0207674_10339841 Ga0207674_103398411 236
429 3300026118 Ga0207675_100054459 Ga0207675_1000544592 236
430 3300026121 Ga0207683_10386565 Ga0207683_103865652 236
431 3300026142 Ga0207698_10042541 Ga0207698_100425412 236
432 3300028379 Ga0268266_10000024 Ga0268266_10000024312 236
433 3300028379 Ga0268266_10393914 Ga0268266_103939142 236
434 3300028380 Ga0268265_10126074 Ga0268265_101260742 236
435 3300028381 Ga0268264_10208008 Ga0268264_102080082 236
436 3300028381 Ga0268264_10278544 Ga0268264_102785442 236
437 3300031251 Ga0265327_10000905 Ga0265327_1000090518 236
438 3300031251 Ga0265327_10038414 Ga0265327_100384142 236
439 3300031456 Ga0307513_10308174 Ga0307513_103081742 236
440 3300042011 Ga0439454_012814 Ga0439454_012814_410_1123 236
441 3300044735 Ga0466968_0080831 Ga0466968_0080831_627_1379 236
442 3300045976 Ga0466967_0122080 Ga0466967_0122080_1248_1964 236
443 3300046524 Ga0495648_0002890 Ga0495648_0002890_5234_5947 236
444 3300047472 Ga0495686_0126503 Ga0495686_0126503_12_758 236
445 3300049568 Ga0501031_0008613 Ga0501031_0008613_4423_5136 236
446 3300049572 Ga0501036_0001958 Ga0501036_0001958_13142_13855 236
447 3300049574 Ga0501038_0023799 Ga0501038_0023799_1875_2588 236
448 3300049575 Ga0501039_0187733 Ga0501039_0187733_381_1094 236
449 3300049580 Ga0501046_0121380 Ga0501046_0121380_1259_1972 236
450 3300049588 Ga0501072_0162640 Ga0501072_0162640_197_910 236
451 3300049823 Ga0501044_0040984 Ga0501044_0040984_2090_2803 236
452 3300050493 nmdc:mga0k408_1333_c1 nmdc:mga0k408_1333_c1_722_1468 236
453 3300053092 Ga0500583_0035179 Ga0500583_0035179_1361_2074 236
454 3300053156 Ga0500622_0001926 Ga0500622_0001926_3065_3778 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

16

123

0.94

PF04397

LytTR

LytTr DNA-binding domain

153

246

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m8o-assembly1.cif.gz_A crystal structure of the receiver domain of lytr from staphylococcus aureus 0.9256 2 113
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9123 1 112
2qv0-assembly1.cif.gz_A crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae 0.9114 2 119
3rvj-assembly1.cif.gz_A structure of the chey-bef3 complex with substitutions at 59 and 89: n59d and e89q 0.9057 2 117
3ffx-assembly2.cif.gz_B crystal structure of chey triple mutant f14e, n59r, e89h complexed with bef3- and mn2+ 0.9052 2 117
ID Description Score Start End Superfamily
6m8oA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9256 2 113 3.40.50.2300
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9136 132 199 2.40.50.40
af_P0A9Q1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9086 4 79 3.40.50.2300
2qv0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9081 2 119 3.40.50.2300
af_I1NCE1_621_722_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9054 2 68 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1G8F6E8-F1-model_v4 Response regulator receiver domain-containing protein 0.9943 2 122 GO:0000160
AF-A0A520C3L2-F1-model_v4 Response regulator 0.9884 2 100 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1G7PZ04-F1-model_v4 Response regulator receiver domain-containing protein 0.9824 1 108 GO:0000156
GO:0003677
GO:0005737
AF-A0A256WLE8-F1-model_v4 Response regulatory domain-containing protein 0.9803 2 106 GO:0000156
GO:0003677
GO:0005737
AF-A0A4Q5YUE0-F1-model_v4 LytTR family transcriptional regulator 0.9705 133 231 GO:0000156
GO:0003677

Feature Viewer

pLDDT pTM Quality
89.03 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map