F447176

General Info

Members Datasets Scaffolds Average Seq Length
453 214 453 223

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10001210|Ga0114129_1000121015
Length 260
Sequence MTAPAGSGCLVRDRHGDKYESNCGWSFLGKVQGFCRVARLRVRARFAQFTIDSDTRQLLRGDSEVHLSPKAFDLLCTLIQNRPKVVEKADLYARIWPDTHVVDANLNILIGEVRRAVGDTAQRQELIRTVHGVGYAFCGAVDAHAATRDALFCWVAWGGNTTPLAEGDNIVGRDPRSAVWLDADGVSRRHATIRVDSANRRVALEDLGSTNGTFLRRVPVHGAVELTDGDSIHVGTVELTVHLWAADKVPETRRIRRKNR

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
146 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
147 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
148 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
172 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
194 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.87
Nodule 0
Rhizoplane 1.99
Rhizosphere 95.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4961617 2162886011 Bacteria 849
2 MRS1b_contig_7116904 2162886011 Unclassified 1421
3 MBSR1b_contig_11948967 2162886012 Eukaryota 1305
4 MBSR1b_contig_6464369 2162886012 Bacteria 828
5 Ga0065704_10094601 3300005289 Bacteria 2535
6 Ga0065715_10149698 3300005293 Bacteria 1744
7 Ga0065707_10084224 3300005295 Bacteria 7493
8 Ga0070676_10027049 3300005328 Bacteria 3251
9 Ga0070676_10111549 3300005328 Unclassified 1703
10 Ga0070676_10164806 3300005328 Bacteria 1429
11 Ga0070690_100010592 3300005330 Bacteria 5370
12 Ga0070690_100040783 3300005330 Bacteria 2937
13 Ga0068869_100077351 3300005334 Unclassified 2475
14 Ga0068869_100574043 3300005334 Bacteria 950
15 Ga0070666_10005588 3300005335 Bacteria 7713
16 Ga0070666_10058706 3300005335 Unclassified 2602
17 Ga0070666_10204197 3300005335 Bacteria 1390
18 Ga0070666_10480003 3300005335 Bacteria 900
19 Ga0070680_100430259 3300005336 Unclassified 1126
20 Ga0068868_100081198 3300005338 Bacteria 2599
21 Ga0068868_100081588 3300005338 Unclassified 2593
22 Ga0068868_100127912 3300005338 Bacteria 2077
23 Ga0068868_100337531 3300005338 Bacteria 1288
24 Ga0070660_100235235 3300005339 Bacteria 1491
25 Ga0070689_100059410 3300005340 Unclassified 2971
26 Ga0070689_100071576 3300005340 Bacteria 2709
27 Ga0070691_10023709 3300005341 Bacteria 2851
28 Ga0070687_100069908 3300005343 Bacteria 1881
29 Ga0070687_100105959 3300005343 Unclassified 1583
30 Ga0070661_100286953 3300005344 Unclassified 1278
31 Ga0070692_10312765 3300005345 Bacteria 963
32 Ga0070668_100050080 3300005347 Bacteria 3215
33 Ga0070668_100184467 3300005347 Bacteria 1706
34 Ga0070669_100007313 3300005353 Bacteria 7919
35 Ga0070669_100009452 3300005353 Bacteria 6942
36 Ga0070669_100121483 3300005353 Bacteria 1993
37 Ga0070669_100324838 3300005353 Unclassified 1243
38 Ga0070675_100151780 3300005354 Bacteria 1987
39 Ga0070675_100363872 3300005354 Unclassified 1285
40 Ga0070675_100576293 3300005354 Bacteria 1019
41 Ga0070671_100004720 3300005355 Bacteria 10823
42 Ga0070671_100017234 3300005355 Bacteria 5848
43 Ga0070674_100002430 3300005356 Bacteria 10300
44 Ga0070674_100087458 3300005356 Unclassified 2241
45 Ga0070674_100567968 3300005356 Bacteria 954
46 Ga0070673_100000903 3300005364 Bacteria 16778
47 Ga0070673_100093716 3300005364 Bacteria 2460
48 Ga0070673_100842764 3300005364 Bacteria 848
49 Ga0070688_100035212 3300005365 Unclassified 3040
50 Ga0070688_100236427 3300005365 Bacteria 1295
51 Ga0070667_100287022 3300005367 Bacteria 1479
52 Ga0070667_100724743 3300005367 Unclassified 921
53 Ga0070713_100037425 3300005436 Bacteria 3923
54 Ga0070701_10033057 3300005438 Bacteria 2581
55 Ga0070705_100160272 3300005440 Unclassified 1503
56 Ga0070700_100437950 3300005441 Unclassified 991
57 Ga0070694_100046958 3300005444 Bacteria 2901
58 Ga0070694_100218727 3300005444 Bacteria 1428
59 Ga0070708_100097025 3300005445 Bacteria 2694
60 Ga0070708_100119684 3300005445 Unclassified 2428
61 Ga0070708_100485217 3300005445 Bacteria 1166
62 Ga0070678_100115941 3300005456 Unclassified 2104
63 Ga0070678_100116147 3300005456 Bacteria 2102
64 Ga0070662_100064992 3300005457 Bacteria 2673
65 Ga0070662_100137130 3300005457 Bacteria 1893
66 Ga0070662_100757656 3300005457 Bacteria 824
67 Ga0068867_100004488 3300005459 Bacteria 9805
68 Ga0068867_100055579 3300005459 Bacteria 2927
69 Ga0068867_100075723 3300005459 Bacteria 2525
70 Ga0068867_100199339 3300005459 Bacteria 1602
71 Ga0068867_100477985 3300005459 Unclassified 1067
72 Ga0070685_10646377 3300005466 Bacteria 766
73 Ga0070707_100287117 3300005468 Viruses 1599
74 Ga0070698_100163395 3300005471 Unclassified 2170
75 Ga0070698_100464586 3300005471 Unclassified 1202
76 Ga0070699_100058715 3300005518 Bacteria 3333
77 Ga0070697_100024862 3300005536 Bacteria 4770
78 Ga0068853_100131414 3300005539 Bacteria 2241
79 Ga0068853_100140982 3300005539 Unclassified 2164
80 Ga0070672_100086957 3300005543 Unclassified 2514
81 Ga0070672_100310704 3300005543 Bacteria 1338
82 Ga0070686_100000820 3300005544 Bacteria 17977
83 Ga0070696_100114976 3300005546 Bacteria 1941
84 Ga0070696_100779922 3300005546 Bacteria 785
85 Ga0070693_100027150 3300005547 Unclassified 3099
86 Ga0070665_100004460 3300005548 Bacteria 14709
87 Ga0070665_100010872 3300005548 Bacteria 9206
88 Ga0070704_100021997 3300005549 Bacteria 4143
89 Ga0070704_100082546 3300005549 Bacteria 2370
90 Ga0068855_100254467 3300005563 Bacteria 1958
91 Ga0068855_101000024 3300005563 Unclassified 879
92 Ga0070664_100683186 3300005564 Unclassified 955
93 Ga0070664_100705300 3300005564 Unclassified 940
94 Ga0068857_100694982 3300005577 Bacteria 966
95 Ga0068854_100018811 3300005578 Bacteria 4644
96 Ga0068854_100136328 3300005578 Bacteria 1879
97 Ga0068854_100340614 3300005578 Bacteria 1224
98 Ga0070702_100052914 3300005615 Bacteria 2330
99 Ga0070702_100129047 3300005615 Unclassified 1594
100 Ga0068852_100187638 3300005616 Bacteria 1948
101 Ga0068859_100260066 3300005617 Bacteria 1827
102 Ga0068859_100397734 3300005617 Bacteria 1473
103 Ga0068859_100484034 3300005617 Bacteria 1333
104 Ga0068864_100220387 3300005618 Bacteria 1750
105 Ga0068866_10092905 3300005718 Bacteria 1647
106 Ga0068866_10100973 3300005718 Bacteria 1591
107 Ga0068866_10117599 3300005718 Bacteria 1493
108 Ga0068861_100019324 3300005719 Bacteria 4868
109 Ga0068861_100055374 3300005719 Bacteria 3024
110 Ga0068861_100637537 3300005719 Unclassified 983
111 Ga0068863_100008892 3300005841 Bacteria 9808
112 Ga0068863_100087181 3300005841 Bacteria 2958
113 Ga0068858_100094860 3300005842 Bacteria 2779
114 Ga0068858_100423908 3300005842 Bacteria 1280
115 Ga0068860_100048459 3300005843 Unclassified 4050
116 Ga0068860_100055479 3300005843 Bacteria 3767
117 Ga0068860_100239244 3300005843 Bacteria 1765
118 Ga0068862_100018117 3300005844 Bacteria 5863
119 Ga0068862_100028538 3300005844 Unclassified 4700
120 Ga0068862_100182479 3300005844 Unclassified 1884
121 Ga0081455_10036567 3300005937 Bacteria 4370
122 Ga0070717_10773966 3300006028 Unclassified 873
123 Ga0075365_10405247 3300006038 Bacteria 962
124 Ga0075362_10022530 3300006177 Bacteria 2655
125 Ga0075366_10087444 3300006195 Bacteria 1865
126 Ga0097621_100092654 3300006237 Bacteria 2531
127 Ga0068871_100002008 3300006358 Bacteria 13775
128 Ga0068871_100117775 3300006358 Bacteria 2240
129 Ga0068871_100278120 3300006358 Bacteria 1464
130 Ga0068871_100673834 3300006358 Bacteria 946
131 Ga0075428_100000716 3300006844 Bacteria 34355
132 Ga0075428_100007218 3300006844 Bacteria 12308
133 Ga0075428_100047286 3300006844 Bacteria 4727
134 Ga0075430_100001311 3300006846 Bacteria 20068
135 Ga0075430_100006847 3300006846 Bacteria 9608
136 Ga0075430_100015196 3300006846 Bacteria 6554
137 Ga0075430_100021391 3300006846 Bacteria 5499
138 Ga0075430_100072889 3300006846 Bacteria 2880
139 Ga0075430_100127468 3300006846 Bacteria 2122
140 Ga0075430_100143028 3300006846 Unclassified 1992
141 Ga0075431_100014505 3300006847 Bacteria 7972
142 Ga0075431_100061677 3300006847 Unclassified 3869
143 Ga0075431_100159230 3300006847 Bacteria 2322
144 Ga0075431_100192230 3300006847 Bacteria 2091
145 Ga0075431_100204653 3300006847 Bacteria 2018
146 Ga0075431_100282070 3300006847 Bacteria 1682
147 Ga0075431_100495920 3300006847 Bacteria 1213
148 Ga0075433_10002459 3300006852 Bacteria 14091
149 Ga0075433_10022772 3300006852 Bacteria 5263
150 Ga0075433_10137046 3300006852 Unclassified 2176
151 Ga0075434_100061458 3300006871 Bacteria 3737
152 Ga0075429_100003354 3300006880 Bacteria 13653
153 Ga0075429_100021822 3300006880 Bacteria 5551
154 Ga0075429_100158321 3300006880 Unclassified 1983
155 Ga0075429_100177400 3300006880 Bacteria 1867
156 Ga0075429_100599297 3300006880 Bacteria 965
157 Ga0068865_100011919 3300006881 Bacteria 5457
158 Ga0068865_100111028 3300006881 Bacteria 2023
159 Ga0068865_100127890 3300006881 Bacteria 1899
160 Ga0075436_100028741 3300006914 Bacteria 3824
161 Ga0097620_100260050 3300006931 Bacteria 1827
162 Ga0097620_100397747 3300006931 Bacteria 1473
163 Ga0097620_100484084 3300006931 Bacteria 1333
164 Ga0075435_100002724 3300007076 Bacteria 11793
165 Ga0075435_100007233 3300007076 Bacteria 7900
166 Ga0111539_10001075 3300009094 Bacteria 36049
167 Ga0111539_10001829 3300009094 Bacteria 28311
168 Ga0111539_10056306 3300009094 Bacteria 4673
169 Ga0111539_10494937 3300009094 Bacteria 1424
170 Ga0111539_10948441 3300009094 Unclassified 1000
171 Ga0105245_10008195 3300009098 Bacteria 9141
172 Ga0105245_10017557 3300009098 Bacteria 6245
173 Ga0105245_10031604 3300009098 Bacteria 4686
174 Ga0105245_10108775 3300009098 Bacteria 2575
175 Ga0105245_10534561 3300009098 Bacteria 1193
176 Ga0114129_10001210 3300009147 Bacteria 34271
177 Ga0114129_10002446 3300009147 Bacteria 25786
178 Ga0114129_10004972 3300009147 Bacteria 18734
179 Ga0114129_10007456 3300009147 Bacteria 15580
180 Ga0114129_10061439 3300009147 Bacteria 5250
181 Ga0114129_10084671 3300009147 Bacteria 4402
182 Ga0114129_10145105 3300009147 Bacteria 3252
183 Ga0114129_10259558 3300009147 Bacteria 2329
184 Ga0114129_10319312 3300009147 Unclassified 2065
185 Ga0114129_10329306 3300009147 Bacteria 2028
186 Ga0114129_10620310 3300009147 Bacteria 1399
187 Ga0114129_10650484 3300009147 Bacteria 1360
188 Ga0105243_10048117 3300009148 Bacteria 3360
189 Ga0105243_10124843 3300009148 Bacteria 2176
190 Ga0105243_10814402 3300009148 Unclassified 922
191 Ga0105241_10030908 3300009174 Unclassified 4005
192 Ga0105241_10043826 3300009174 Bacteria 3389
193 Ga0105242_10006216 3300009176 Bacteria 9201
194 Ga0105242_10008976 3300009176 Bacteria 7678
195 Ga0105242_10017192 3300009176 Bacteria 5631
196 Ga0105242_10061616 3300009176 Bacteria 3086
197 Ga0105242_10083213 3300009176 Bacteria 2679
198 Ga0105242_10164615 3300009176 Unclassified 1944
199 Ga0105242_10832518 3300009176 Bacteria 916
200 Ga0105248_10004221 3300009177 Bacteria 15895
201 Ga0105248_10027939 3300009177 Bacteria 6282
202 Ga0105248_10039102 3300009177 Bacteria 5312
203 Ga0105248_10047650 3300009177 Bacteria 4807
204 Ga0105248_10094366 3300009177 Bacteria 3369
205 Ga0105248_10207400 3300009177 Bacteria 2208
206 Ga0105248_10253353 3300009177 Bacteria 1981
207 Ga0105248_11012806 3300009177 Unclassified 938
208 Ga0105238_10099504 3300009551 Bacteria 2891
209 Ga0105249_10051744 3300009553 Bacteria 3748
210 Ga0105249_10195418 3300009553 Unclassified 1977
211 Ga0105249_10456031 3300009553 Bacteria 1318
212 Ga0105249_11069757 3300009553 Bacteria 876
213 Ga0105239_11049046 3300010375 Unclassified 938
214 Ga0157324_1004228 3300012506 Bacteria 984
215 Ga0157374_10021748 3300013296 Bacteria 5712
216 Ga0157374_10549265 3300013296 Unclassified 1163
217 Ga0157378_10025364 3300013297 Bacteria 5221
218 Ga0157378_10315828 3300013297 Bacteria 1517
219 Ga0163162_10073035 3300013306 Bacteria 3486
220 Ga0163162_10133964 3300013306 Unclassified 2588
221 Ga0163162_11090909 3300013306 Bacteria 904
222 Ga0163163_10165262 3300014325 Unclassified 2259
223 Ga0157380_10331356 3300014326 Bacteria 1416
224 Ga0157379_10022039 3300014968 Bacteria 5645
225 Ga0157379_10032598 3300014968 Bacteria 4645
226 Ga0157379_10180478 3300014968 Bacteria 1907
227 Ga0157376_10006901 3300014969 Bacteria 8044
228 Ga0157376_10111426 3300014969 Unclassified 2409
229 Ga0163161_10208735 3300017792 Bacteria 1508
230 Ga0207697_10042165 3300025315 Bacteria 1874
231 Ga0207656_10097559 3300025321 Bacteria 1343
232 Ga0207653_10031998 3300025885 Bacteria 1700
233 Ga0207642_10060680 3300025899 Bacteria 1755
234 Ga0207642_10186929 3300025899 Bacteria 1133
235 Ga0207680_10024239 3300025903 Bacteria 3327
236 Ga0207680_10041556 3300025903 Unclassified 2684
237 Ga0207680_10285955 3300025903 Bacteria 1147
238 Ga0207645_10043855 3300025907 Bacteria 2862
239 Ga0207645_10220890 3300025907 Bacteria 1249
240 Ga0207695_10617555 3300025913 Bacteria 965
241 Ga0207662_10012816 3300025918 Bacteria 4677
242 Ga0207662_10083452 3300025918 Bacteria 1953
243 Ga0207657_10687680 3300025919 Bacteria 795
244 Ga0207681_10076662 3300025923 Bacteria 2348
245 Ga0207681_10173209 3300025923 Bacteria 1637
246 Ga0207681_10312204 3300025923 Bacteria 1247
247 Ga0207687_10007613 3300025927 Bacteria 7121
248 Ga0207687_10018202 3300025927 Bacteria 4634
249 Ga0207687_10059189 3300025927 Bacteria 2698
250 Ga0207700_10148444 3300025928 Bacteria 1935
251 Ga0207644_10024956 3300025931 Unclassified 4107
252 Ga0207644_10039918 3300025931 Bacteria 3315
253 Ga0207690_10042736 3300025932 Unclassified 2979
254 Ga0207690_10082417 3300025932 Bacteria 2250
255 Ga0207706_10003106 3300025933 Bacteria 15969
256 Ga0207686_10001069 3300025934 Bacteria 16128
257 Ga0207686_10034567 3300025934 Bacteria 3026
258 Ga0207686_10050599 3300025934 Bacteria 2584
259 Ga0207686_10112978 3300025934 Bacteria 1835
260 Ga0207709_10135778 3300025935 Bacteria 1684
261 Ga0207670_10440556 3300025936 Unclassified 1049
262 Ga0207670_10677332 3300025936 Bacteria 852
263 Ga0207669_10033816 3300025937 Bacteria 2890
264 Ga0207669_10411769 3300025937 Bacteria 1062
265 Ga0207669_10428986 3300025937 Bacteria 1042
266 Ga0207669_10698049 3300025937 Bacteria 834
267 Ga0207704_10002402 3300025938 Bacteria 8417
268 Ga0207704_10149786 3300025938 Bacteria 1645
269 Ga0207704_10376580 3300025938 Bacteria 1113
270 Ga0207691_10076326 3300025940 Unclassified 3020
271 Ga0207711_10125288 3300025941 Bacteria 2297
272 Ga0207711_10168473 3300025941 Bacteria 1986
273 Ga0207711_10406305 3300025941 Unclassified 1266
274 Ga0207711_10446381 3300025941 Bacteria 1204
275 Ga0207711_10506447 3300025941 Bacteria 1125
276 Ga0207689_10079849 3300025942 Unclassified 2689
277 Ga0207679_10652393 3300025945 Unclassified 952
278 Ga0207679_11065911 3300025945 Unclassified 741
279 Ga0207667_10482026 3300025949 Bacteria 1259
280 Ga0207651_10124216 3300025960 Unclassified 1963
281 Ga0207651_10204405 3300025960 Bacteria 1585
282 Ga0207712_10066640 3300025961 Bacteria 2574
283 Ga0207668_10165982 3300025972 Bacteria 1726
284 Ga0207640_10008787 3300025981 Bacteria 5622
285 Ga0207640_10080778 3300025981 Bacteria 2220
286 Ga0207658_10187700 3300025986 Bacteria 1716
287 Ga0207677_10006290 3300026023 Bacteria 6498
288 Ga0207677_10081455 3300026023 Bacteria 2323
289 Ga0207677_10098382 3300026023 Bacteria 2146
290 Ga0207677_10875719 3300026023 Bacteria 808
291 Ga0207703_10167803 3300026035 Bacteria 1928
292 Ga0207708_10076647 3300026075 Bacteria 2565
293 Ga0207641_10004310 3300026088 Bacteria 12351
294 Ga0207641_10034434 3300026088 Bacteria 4214
295 Ga0207648_10027939 3300026089 Bacteria 5005
296 Ga0207648_10084956 3300026089 Bacteria 2761
297 Ga0207648_10147485 3300026089 Unclassified 2075
298 Ga0207674_10114425 3300026116 Bacteria 2670
299 Ga0207675_100009910 3300026118 Bacteria 8916
300 Ga0207675_100068800 3300026118 Bacteria 3309
301 Ga0207675_100268067 3300026118 Bacteria 1656
302 Ga0207683_10079918 3300026121 Bacteria 2900
303 Ga0207683_10216540 3300026121 Bacteria 1744
304 Ga0207683_10272651 3300026121 Bacteria 1546
305 Ga0207428_10001640 3300027907 Bacteria 23285
306 Ga0207428_10002731 3300027907 Bacteria 17583
307 Ga0207428_10101466 3300027907 Bacteria 2223
308 Ga0268266_10015346 3300028379 Bacteria 6574
309 Ga0268266_10035831 3300028379 Bacteria 4220
310 Ga0268266_10070643 3300028379 Bacteria 3025
311 Ga0268265_10018485 3300028380 Unclassified 4831
312 Ga0268265_10080592 3300028380 Unclassified 2568
313 Ga0268265_10286610 3300028380 Bacteria 1476
314 Ga0268264_10048850 3300028381 Bacteria 3519
315 Ga0268264_10747064 3300028381 Unclassified 974
316 Ga0307408_100013353 3300031548 Bacteria 5448
317 Ga0307408_100095259 3300031548 Bacteria 2256
318 Ga0307408_100442814 3300031548 Unclassified 1125
319 Ga0307410_10259392 3300031852 Bacteria 1355
320 Ga0307406_10079713 3300031901 Bacteria 2172
321 Ga0307406_10087735 3300031901 Bacteria 2086
322 Ga0307406_10418083 3300031901 Bacteria 1067
323 Ga0307412_10202581 3300031911 Unclassified 1508
324 Ga0307416_100036350 3300032002 Bacteria 3776
325 Ga0307416_100235449 3300032002 Bacteria 1769
326 Ga0307416_101368610 3300032002 Unclassified 813
327 Ga0307416_101454901 3300032002 Unclassified 791
328 Ga0307411_10504892 3300032005 Unclassified 1023
329 Ga0373930_0074685 3300034816 Bacteria 776
330 Ga0373948_0010100 3300034817 Unclassified 1642
331 Ga0373958_0002844 3300034819 Bacteria 2463
332 Ga0373938_0016108 3300034957 Unclassified 1457
333 Ga0373929_0000507 3300035085 Bacteria 7443
334 Ga0373934_0081533 3300035086 Bacteria 1300
335 Ga0373940_0053528 3300035088 Bacteria 1139
336 Ga0373944_0146791 3300035089 Unclassified 829
337 Ga0373951_0003439 3300035091 Unclassified 3839
338 Ga0373952_0002405 3300035092 Unclassified 3374
339 Ga0373952_0010430 3300035092 Bacteria 1796
340 Ga0373923_0032541 3300035111 Unclassified 2107
341 Ga0373932_0001066 3300035112 Bacteria 7896
342 Ga0373932_0042682 3300035112 Bacteria 1316
343 Ga0373939_0005527 3300035114 Unclassified 3012
344 Ga0373939_0006260 3300035114 Bacteria 2864
345 Ga0373939_0052254 3300035114 Unclassified 1273
346 Ga0373939_0061265 3300035114 Bacteria 1199
347 Ga0373941_0001546 3300035115 Unclassified 4881
348 Ga0373941_0019722 3300035115 Bacteria 1882
349 Ga0373957_0034691 3300035120 Bacteria 1871
350 Ga0373960_0001422 3300035121 Bacteria 5292
351 Ga0373943_0237669 3300035170 Bacteria 1020
352 Ga0373943_0307989 3300035170 Unclassified 900
353 Ga0373955_0242010 3300035172 Bacteria 1081
354 Ga0373961_0014619 3300035241 Unclassified 1995
355 Ga0373961_0014864 3300035241 Bacteria 1982
356 Ga0373962_0009910 3300035242 Unclassified 2368
357 Ga0373962_0015403 3300035242 Bacteria 1960
358 Ga0373931_0053963 3300035691 Unclassified 2146
359 Ga0373935_0212530 3300035692 Bacteria 1341
360 Ga0373933_0145384 3300035724 Bacteria 1499
361 Ga0373933_0211779 3300035724 Bacteria 1242
362 Ga0373947_0052362 3300035725 Bacteria 2459
363 Ga0373937_0103575 3300036401 Bacteria 2643
364 Ga0373937_0262716 3300036401 Bacteria 1628
365 Ga0373925_0005714 3300037068 Bacteria 9247
366 Ga0439450_002885 3300042008 Bacteria 2770
367 Ga0439440_0084888 3300042993 Unclassified 842
368 Ga0451576_0020375 3300045051 Bacteria 7223
369 Ga0451576_1329771 3300045051 Unclassified 749
370 Ga0495653_0182626 3300046463 Bacteria 1438
371 Ga0495608_0170041 3300046511 Bacteria 1383
372 Ga0495630_0348967 3300046517 Unclassified 1133
373 Ga0495667_0058131 3300046559 Bacteria 2541
374 Ga0495635_0034631 3300046663 Bacteria 3503
375 Ga0495647_0035964 3300046681 Bacteria 1862
376 Ga0495658_0025671 3300046683 Bacteria 3152
377 Ga0495613_0193460 3300046689 Unclassified 1437
378 Ga0495674_0082466 3300047319 Bacteria 2757
379 Ga0496101_0474309 3300048904 Bacteria 988
380 Ga0496102_0125523 3300048905 Unclassified 2399
381 Ga0496104_0072119 3300048907 Bacteria 3284
382 Ga0496104_0232364 3300048907 Bacteria 1756
383 Ga0496106_0236268 3300048909 Bacteria 1460
384 Ga0496106_0511641 3300048909 Bacteria 964
385 Ga0496107_0076724 3300048910 Bacteria 2434
386 Ga0496109_0443181 3300048912 Bacteria 1227
387 Ga0496114_0265549 3300048917 Bacteria 1512
388 Ga0501299_014200 3300049522 Bacteria 1382
389 Ga0501031_0504175 3300049568 Bacteria 780
390 Ga0501071_0648204 3300049587 Bacteria 812
391 Ga0501249_011036 3300049679 Bacteria 1894
392 Ga0501261_027425 3300049690 Unclassified 847
393 Ga0501079_0329491 3300049741 Unclassified 1196
394 nmdc:mga03683_80124_c1 3300050489 Bacteria 1409
395 nmdc:mga00v17_20858_c1 3300050491 Unclassified 3760
396 nmdc:mga00v17_93212_c1 3300050491 Bacteria 1894
397 nmdc:mga00v17_9892_c1 3300050491 Bacteria 5186
398 nmdc:mga0yw44_25812_c1 3300050492 Unclassified 3347
399 nmdc:mga0k408_14233_c1 3300050493 Bacteria 4379
400 nmdc:mga06z11_145025_c1 3300050494 Unclassified 1345
401 nmdc:mga06z11_71070_c1 3300050494 Unclassified 1842
402 nmdc:mga07m45_13165_c1 3300050496 Unclassified 4382
403 nmdc:mga05p37_10423_c1 3300050507 Bacteria 11031
404 nmdc:mga05p37_10958_c1 3300050507 Bacteria 10766
405 nmdc:mga05p37_114528_c1 3300050507 Bacteria 3315
406 nmdc:mga05p37_155805_c1 3300050507 Bacteria 2792
407 nmdc:mga05p37_26853_c1 3300050507 Bacteria 7005
408 nmdc:mga05p37_3101_c1 3300050507 Bacteria 19316
409 nmdc:mga05p37_395761_c1 3300050507 Bacteria 1614
410 nmdc:mga05p37_689909_c1 3300050507 Bacteria 1136
411 nmdc:mga05p37_99480_c1 3300050507 Bacteria 3582
412 nmdc:mga05p37_99665_c1 3300050507 Unclassified 3578
413 nmdc:mga09592_168337_c1 3300050508 Bacteria 1894
414 nmdc:mga09592_198078_c1 3300050508 Unclassified 1739
415 nmdc:mga09592_3091_c1 3300050508 Bacteria 13506
416 nmdc:mga09592_33536_c1 3300050508 Bacteria 4286
417 nmdc:mga09592_433832_c1 3300050508 Bacteria 1134
418 nmdc:mga0qj67_12694_c1 3300050509 Bacteria 6353
419 nmdc:mga0qj67_18407_c1 3300050509 Bacteria 5323
420 nmdc:mga0qj67_23970_c1 3300050509 Bacteria 4701
421 nmdc:mga0qj67_55587_c1 3300050509 Bacteria 3136
422 nmdc:mga0qj67_69430_c1 3300050509 Bacteria 2810
423 nmdc:mga0qj67_85558_c1 3300050509 Unclassified 2529
424 nmdc:mga06r32_149292_c1 3300050510 Bacteria 2315
425 nmdc:mga06r32_18864_c1 3300050510 Bacteria 6323
426 nmdc:mga06r32_43055_c1 3300050510 Bacteria 4295
427 nmdc:mga06r32_56482_c1 3300050510 Unclassified 3769
428 nmdc:mga06r32_69041_c1 3300050510 Unclassified 3415
429 nmdc:mga08y16_138917_c1 3300050511 Bacteria 2526
430 nmdc:mga08y16_217610_c1 3300050511 Bacteria 1978
431 nmdc:mga08y16_2335_c1 3300050511 Bacteria 19452
432 nmdc:mga08y16_367860_c1 3300050511 Bacteria 1475
433 nmdc:mga08y16_813402_c1 3300050511 Unclassified 926
434 nmdc:mga08y16_982_c1 3300050511 Bacteria 27774
435 nmdc:mga0n895_21289_c1 3300050512 Bacteria 6059
436 nmdc:mga0n895_213332_c1 3300050512 Unclassified 1960
437 nmdc:mga0n895_231920_c1 3300050512 Bacteria 1873
438 nmdc:mga0n895_815369_c1 3300050512 Bacteria 923
439 nmdc:mga0rr50_300241_c1 3300050513 Bacteria 1343
440 nmdc:mga0rr50_473203_c1 3300050513 Bacteria 1064
441 nmdc:mga0rr50_63078_c1 3300050513 Unclassified 2798
442 nmdc:mga0rr50_85974_c1 3300050513 Bacteria 2438
443 nmdc:mga08x19_22154_c1 3300050514 Bacteria 3932
444 nmdc:mga08x19_72690_c1 3300050514 Bacteria 2244
445 nmdc:mga0a205_115034_c1 3300050515 Unclassified 2588
446 nmdc:mga0a205_171471_c1 3300050515 Unclassified 2066
447 nmdc:mga0a205_372639_c1 3300050515 Bacteria 1293
448 nmdc:mga0a205_50530_c1 3300050515 Unclassified 4014
449 nmdc:mga0a205_88552_c1 3300050515 Unclassified 2992
450 Ga0495601_0059943 3300053077 Bacteria 2414
451 Ga0495619_0602177 3300053085 Unclassified 752
452 Ga0500658_0038389 3300053134 Bacteria 1909
453 Ga0501082_0683533 3300060353 Bacteria 898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0348967 Ga0495630_0348967_12_551 179
2 3300050511 nmdc:mga08y16_813402_c1 nmdc:mga08y16_813402_c1_27_581 184
3 3300026118 Ga0207675_100268067 Ga0207675_1002680672 185
4 3300050494 nmdc:mga06z11_145025_c1 nmdc:mga06z11_145025_c1_14_574 186
5 3300050494 nmdc:mga06z11_71070_c1 nmdc:mga06z11_71070_c1_11_571 186
6 3300050512 nmdc:mga0n895_213332_c1 nmdc:mga0n895_213332_c1_28_588 186
7 3300009094 Ga0111539_10948441 Ga0111539_109484412 198
8 3300012506 Ga0157324_1004228 Ga0157324_10042282 205
9 3300009147 Ga0114129_10007456 Ga0114129_100074566 206
10 3300050507 nmdc:mga05p37_26853_c1 nmdc:mga05p37_26853_c1_2243_2863 206
11 3300050509 nmdc:mga0qj67_23970_c1 nmdc:mga0qj67_23970_c1_420_1040 206
12 3300005353 Ga0070669_100324838 Ga0070669_1003248382 208
13 3300025923 Ga0207681_10312204 Ga0207681_103122042 208
14 3300027907 Ga0207428_10002731 Ga0207428_1000273113 208
15 3300049741 Ga0501079_0329491 Ga0501079_0329491_414_1061 210
16 2162886011 MRS1b_contig_7116904 MRS1b_0202.00003090 211
17 2162886012 MBSR1b_contig_11948967 MBSR1b_0435.00000470 211
18 3300005842 Ga0068858_100423908 Ga0068858_1004239082 211
19 3300006846 Ga0075430_100127468 Ga0075430_1001274682 211
20 3300006847 Ga0075431_100204653 Ga0075431_1002046534 211
21 3300006881 Ga0068865_100111028 Ga0068865_1001110282 211
22 3300025938 Ga0207704_10149786 Ga0207704_101497862 211
23 3300028379 Ga0268266_10035831 Ga0268266_100358312 211
24 3300050507 nmdc:mga05p37_395761_c1 nmdc:mga05p37_395761_c1_305_940 211
25 3300050510 nmdc:mga06r32_56482_c1 nmdc:mga06r32_56482_c1_2374_3009 211
26 3300005354 Ga0070675_100363872 Ga0070675_1003638722 212
27 3300005617 Ga0068859_100260066 Ga0068859_1002600662 212
28 3300006931 Ga0097620_100260050 Ga0097620_1002600502 212
29 3300036401 Ga0373937_0262716 Ga0373937_0262716_570_1226 213
30 3300050509 nmdc:mga0qj67_69430_c1 nmdc:mga0qj67_69430_c1_1383_2024 213
31 3300005466 Ga0070685_10646377 Ga0070685_106463771 214
32 3300005719 Ga0068861_100637537 Ga0068861_1006375372 214
33 3300028380 Ga0268265_10286610 Ga0268265_102866102 214
34 3300048907 Ga0496104_0072119 Ga0496104_0072119_1799_2446 214
35 3300005354 Ga0070675_100576293 Ga0070675_1005762932 215
36 3300005615 Ga0070702_100129047 Ga0070702_1001290472 215
37 3300006844 Ga0075428_100007218 Ga0075428_1000072186 215
38 3300006846 Ga0075430_100015196 Ga0075430_1000151963 215
39 3300006880 Ga0075429_100599297 Ga0075429_1005992972 215
40 3300009147 Ga0114129_10145105 Ga0114129_101451052 215
41 3300031901 Ga0307406_10087735 Ga0307406_100877353 215
42 3300032002 Ga0307416_100235449 Ga0307416_1002354492 215
43 3300050508 nmdc:mga09592_433832_c1 nmdc:mga09592_433832_c1_223_876 215
44 3300050515 nmdc:mga0a205_372639_c1 nmdc:mga0a205_372639_c1_590_1243 215
45 3300006847 Ga0075431_100495920 Ga0075431_1004959201 216
46 3300009094 Ga0111539_10001829 Ga0111539_1000182923 216
47 3300009147 Ga0114129_10650484 Ga0114129_106504842 216
48 3300050507 nmdc:mga05p37_689909_c1 nmdc:mga05p37_689909_c1_268_960 216
49 3300050511 nmdc:mga08y16_2335_c1 nmdc:mga08y16_2335_c1_14415_15107 216
50 3300005347 Ga0070668_100050080 Ga0070668_1000500803 219
51 3300009094 Ga0111539_10056306 Ga0111539_100563064 219
52 3300009147 Ga0114129_10001210 Ga0114129_1000121015 219
53 3300025941 Ga0207711_10506447 Ga0207711_105064471 219
54 3300035120 Ga0373957_0034691 Ga0373957_0034691_388_1047 219
55 3300035172 Ga0373955_0242010 Ga0373955_0242010_275_934 219
56 3300035242 Ga0373962_0015403 Ga0373962_0015403_133_801 219
57 3300045051 Ga0451576_1329771 Ga0451576_1329771_50_715 219
58 3300046511 Ga0495608_0170041 Ga0495608_0170041_406_1065 219
59 3300050507 nmdc:mga05p37_10958_c1 nmdc:mga05p37_10958_c1_2844_3503 219
60 3300050508 nmdc:mga09592_168337_c1 nmdc:mga09592_168337_c1_1054_1713 219
61 3300050510 nmdc:mga06r32_149292_c1 nmdc:mga06r32_149292_c1_692_1351 219
62 3300050510 nmdc:mga06r32_69041_c1 nmdc:mga06r32_69041_c1_730_1398 219
63 3300050511 nmdc:mga08y16_138917_c1 nmdc:mga08y16_138917_c1_563_1231 219
64 3300050511 nmdc:mga08y16_367860_c1 nmdc:mga08y16_367860_c1_748_1437 219
65 3300050515 nmdc:mga0a205_115034_c1 nmdc:mga0a205_115034_c1_1863_2531 219
66 3300053085 Ga0495619_0602177 Ga0495619_0602177_10_669 219
67 3300006844 Ga0075428_100000716 Ga0075428_10000071621 220
68 3300006846 Ga0075430_100006847 Ga0075430_1000068476 220
69 3300006847 Ga0075431_100014505 Ga0075431_1000145055 220
70 3300006880 Ga0075429_100003354 Ga0075429_1000033543 220
71 3300009094 Ga0111539_10001075 Ga0111539_1000107512 220
72 3300009147 Ga0114129_10002446 Ga0114129_100024466 220
73 3300027907 Ga0207428_10001640 Ga0207428_100016402 220
74 3300028380 Ga0268265_10080592 Ga0268265_100805922 220
75 3300031548 Ga0307408_100013353 Ga0307408_1000133534 220
76 3300031548 Ga0307408_100095259 Ga0307408_1000952591 220
77 3300031548 Ga0307408_100442814 Ga0307408_1004428141 220
78 3300031852 Ga0307410_10259392 Ga0307410_102593922 220
79 3300031901 Ga0307406_10079713 Ga0307406_100797132 220
80 3300031901 Ga0307406_10418083 Ga0307406_104180832 220
81 3300031911 Ga0307412_10202581 Ga0307412_102025812 220
82 3300032002 Ga0307416_100036350 Ga0307416_1000363504 220
83 3300032002 Ga0307416_101368610 Ga0307416_1013686101 220
84 3300032002 Ga0307416_101454901 Ga0307416_1014549011 220
85 3300032005 Ga0307411_10504892 Ga0307411_105048922 220
86 3300042008 Ga0439450_002885 Ga0439450_002885_1909_2571 220
87 3300042993 Ga0439440_0084888 Ga0439440_0084888_151_813 220
88 3300049522 Ga0501299_014200 Ga0501299_014200_188_850 220
89 3300049679 Ga0501249_011036 Ga0501249_011036_127_789 220
90 3300049690 Ga0501261_027425 Ga0501261_027425_113_775 220
91 3300050507 nmdc:mga05p37_3101_c1 nmdc:mga05p37_3101_c1_10870_11532 220
92 3300050508 nmdc:mga09592_3091_c1 nmdc:mga09592_3091_c1_6181_6843 220
93 3300050509 nmdc:mga0qj67_12694_c1 nmdc:mga0qj67_12694_c1_3316_3978 220
94 3300050510 nmdc:mga06r32_43055_c1 nmdc:mga06r32_43055_c1_104_766 220
95 3300050511 nmdc:mga08y16_982_c1 nmdc:mga08y16_982_c1_22681_23343 220
96 2162886012 MBSR1b_contig_6464369 MBSR1b_0277.00007120 221
97 3300005293 Ga0065715_10149698 Ga0065715_101496983 221
98 3300005340 Ga0070689_100071576 Ga0070689_1000715761 221
99 3300005364 Ga0070673_100842764 Ga0070673_1008427641 221
100 3300005440 Ga0070705_100160272 Ga0070705_1001602721 221
101 3300005444 Ga0070694_100218727 Ga0070694_1002187271 221
102 3300005445 Ga0070708_100485217 Ga0070708_1004852172 221
103 3300005468 Ga0070707_100287117 Ga0070707_1002871172 221
104 3300005471 Ga0070698_100163395 Ga0070698_1001633952 221
105 3300005543 Ga0070672_100310704 Ga0070672_1003107042 221
106 3300005546 Ga0070696_100779922 Ga0070696_1007799221 221
107 3300005577 Ga0068857_100694982 Ga0068857_1006949822 221
108 3300005617 Ga0068859_100484034 Ga0068859_1004840341 221
109 3300006846 Ga0075430_100021391 Ga0075430_1000213914 221
110 3300006846 Ga0075430_100143028 Ga0075430_1001430282 221
111 3300006847 Ga0075431_100061677 Ga0075431_1000616772 221
112 3300006847 Ga0075431_100192230 Ga0075431_1001922302 221
113 3300006847 Ga0075431_100282070 Ga0075431_1002820702 221
114 3300006852 Ga0075433_10002459 Ga0075433_1000245911 221
115 3300006880 Ga0075429_100177400 Ga0075429_1001774001 221
116 3300006931 Ga0097620_100484084 Ga0097620_1004840841 221
117 3300007076 Ga0075435_100007233 Ga0075435_1000072332 221
118 3300009094 Ga0111539_10494937 Ga0111539_104949372 221
119 3300009147 Ga0114129_10259558 Ga0114129_102595582 221
120 3300009147 Ga0114129_10329306 Ga0114129_103293061 221
121 3300009147 Ga0114129_10620310 Ga0114129_106203102 221
122 3300009176 Ga0105242_10164615 Ga0105242_101646152 221
123 3300009177 Ga0105248_10207400 Ga0105248_102074001 221
124 3300025907 Ga0207645_10220890 Ga0207645_102208902 221
125 3300025936 Ga0207670_10440556 Ga0207670_104405562 221
126 3300025941 Ga0207711_10446381 Ga0207711_104463811 221
127 3300026116 Ga0207674_10114425 Ga0207674_101144252 221
128 3300027907 Ga0207428_10101466 Ga0207428_101014661 221
129 3300035092 Ga0373952_0010430 Ga0373952_0010430_96_761 221
130 3300035114 Ga0373939_0061265 Ga0373939_0061265_113_778 221
131 3300050507 nmdc:mga05p37_114528_c1 nmdc:mga05p37_114528_c1_698_1363 221
132 3300050508 nmdc:mga09592_33536_c1 nmdc:mga09592_33536_c1_1714_2388 221
133 3300050509 nmdc:mga0qj67_18407_c1 nmdc:mga0qj67_18407_c1_3213_3878 221
134 3300050509 nmdc:mga0qj67_55587_c1 nmdc:mga0qj67_55587_c1_1762_2436 221
135 3300050513 nmdc:mga0rr50_85974_c1 nmdc:mga0rr50_85974_c1_298_963 221
136 3300050515 nmdc:mga0a205_171471_c1 nmdc:mga0a205_171471_c1_1244_1918 221
137 3300050515 nmdc:mga0a205_88552_c1 nmdc:mga0a205_88552_c1_856_1521 221
138 2162886011 MRS1b_contig_4961617 MRS1b_0825.00001340 222
139 3300005289 Ga0065704_10094601 Ga0065704_100946013 222
140 3300005295 Ga0065707_10084224 Ga0065707_100842241 222
141 3300005328 Ga0070676_10027049 Ga0070676_100270492 222
142 3300005328 Ga0070676_10111549 Ga0070676_101115491 222
143 3300005328 Ga0070676_10164806 Ga0070676_101648062 222
144 3300005330 Ga0070690_100010592 Ga0070690_1000105923 222
145 3300005330 Ga0070690_100040783 Ga0070690_1000407832 222
146 3300005334 Ga0068869_100077351 Ga0068869_1000773512 222
147 3300005334 Ga0068869_100574043 Ga0068869_1005740431 222
148 3300005335 Ga0070666_10005588 Ga0070666_100055883 222
149 3300005335 Ga0070666_10058706 Ga0070666_100587061 222
150 3300005335 Ga0070666_10204197 Ga0070666_102041972 222
151 3300005335 Ga0070666_10480003 Ga0070666_104800031 222
152 3300005336 Ga0070680_100430259 Ga0070680_1004302592 222
153 3300005338 Ga0068868_100081198 Ga0068868_1000811982 222
154 3300005338 Ga0068868_100081588 Ga0068868_1000815882 222
155 3300005338 Ga0068868_100127912 Ga0068868_1001279122 222
156 3300005338 Ga0068868_100337531 Ga0068868_1003375312 222
157 3300005339 Ga0070660_100235235 Ga0070660_1002352352 222
158 3300005340 Ga0070689_100059410 Ga0070689_1000594102 222
159 3300005341 Ga0070691_10023709 Ga0070691_100237091 222
160 3300005343 Ga0070687_100069908 Ga0070687_1000699081 222
161 3300005343 Ga0070687_100105959 Ga0070687_1001059591 222
162 3300005344 Ga0070661_100286953 Ga0070661_1002869531 222
163 3300005345 Ga0070692_10312765 Ga0070692_103127651 222
164 3300005347 Ga0070668_100184467 Ga0070668_1001844672 222
165 3300005353 Ga0070669_100007313 Ga0070669_1000073137 222
166 3300005353 Ga0070669_100009452 Ga0070669_1000094524 222
167 3300005353 Ga0070669_100121483 Ga0070669_1001214832 222
168 3300005354 Ga0070675_100151780 Ga0070675_1001517802 222
169 3300005355 Ga0070671_100004720 Ga0070671_1000047205 222
170 3300005355 Ga0070671_100017234 Ga0070671_1000172345 222
171 3300005356 Ga0070674_100002430 Ga0070674_1000024301 222
172 3300005356 Ga0070674_100087458 Ga0070674_1000874583 222
173 3300005356 Ga0070674_100567968 Ga0070674_1005679681 222
174 3300005364 Ga0070673_100000903 Ga0070673_1000009035 222
175 3300005364 Ga0070673_100093716 Ga0070673_1000937162 222
176 3300005365 Ga0070688_100035212 Ga0070688_1000352122 222
177 3300005365 Ga0070688_100236427 Ga0070688_1002364272 222
178 3300005367 Ga0070667_100287022 Ga0070667_1002870221 222
179 3300005367 Ga0070667_100724743 Ga0070667_1007247431 222
180 3300005436 Ga0070713_100037425 Ga0070713_1000374254 222
181 3300005438 Ga0070701_10033057 Ga0070701_100330573 222
182 3300005441 Ga0070700_100437950 Ga0070700_1004379501 222
183 3300005444 Ga0070694_100046958 Ga0070694_1000469583 222
184 3300005445 Ga0070708_100097025 Ga0070708_1000970253 222
185 3300005445 Ga0070708_100119684 Ga0070708_1001196843 222
186 3300005456 Ga0070678_100115941 Ga0070678_1001159412 222
187 3300005456 Ga0070678_100116147 Ga0070678_1001161472 222
188 3300005457 Ga0070662_100064992 Ga0070662_1000649922 222
189 3300005457 Ga0070662_100137130 Ga0070662_1001371302 222
190 3300005457 Ga0070662_100757656 Ga0070662_1007576561 222
191 3300005459 Ga0068867_100004488 Ga0068867_1000044887 222
192 3300005459 Ga0068867_100055579 Ga0068867_1000555792 222
193 3300005459 Ga0068867_100075723 Ga0068867_1000757232 222
194 3300005459 Ga0068867_100199339 Ga0068867_1001993392 222
195 3300005459 Ga0068867_100477985 Ga0068867_1004779852 222
196 3300005471 Ga0070698_100464586 Ga0070698_1004645862 222
197 3300005518 Ga0070699_100058715 Ga0070699_1000587155 222
198 3300005536 Ga0070697_100024862 Ga0070697_1000248622 222
199 3300005539 Ga0068853_100131414 Ga0068853_1001314142 222
200 3300005539 Ga0068853_100140982 Ga0068853_1001409823 222
201 3300005543 Ga0070672_100086957 Ga0070672_1000869572 222
202 3300005544 Ga0070686_100000820 Ga0070686_1000008201 222
203 3300005546 Ga0070696_100114976 Ga0070696_1001149763 222
204 3300005547 Ga0070693_100027150 Ga0070693_1000271503 222
205 3300005548 Ga0070665_100004460 Ga0070665_1000044606 222
206 3300005548 Ga0070665_100010872 Ga0070665_1000108725 222
207 3300005549 Ga0070704_100021997 Ga0070704_1000219973 222
208 3300005549 Ga0070704_100082546 Ga0070704_1000825463 222
209 3300005563 Ga0068855_100254467 Ga0068855_1002544671 222
210 3300005563 Ga0068855_101000024 Ga0068855_1010000241 222
211 3300005564 Ga0070664_100683186 Ga0070664_1006831862 222
212 3300005564 Ga0070664_100705300 Ga0070664_1007053001 222
213 3300005578 Ga0068854_100018811 Ga0068854_1000188114 222
214 3300005578 Ga0068854_100136328 Ga0068854_1001363282 222
215 3300005578 Ga0068854_100340614 Ga0068854_1003406141 222
216 3300005615 Ga0070702_100052914 Ga0070702_1000529143 222
217 3300005616 Ga0068852_100187638 Ga0068852_1001876382 222
218 3300005617 Ga0068859_100397734 Ga0068859_1003977342 222
219 3300005618 Ga0068864_100220387 Ga0068864_1002203872 222
220 3300005718 Ga0068866_10092905 Ga0068866_100929052 222
221 3300005718 Ga0068866_10100973 Ga0068866_101009732 222
222 3300005718 Ga0068866_10117599 Ga0068866_101175992 222
223 3300005719 Ga0068861_100019324 Ga0068861_1000193244 222
224 3300005719 Ga0068861_100055374 Ga0068861_1000553743 222
225 3300005841 Ga0068863_100008892 Ga0068863_1000088922 222
226 3300005841 Ga0068863_100087181 Ga0068863_1000871812 222
227 3300005842 Ga0068858_100094860 Ga0068858_1000948602 222
228 3300005843 Ga0068860_100048459 Ga0068860_1000484592 222
229 3300005843 Ga0068860_100055479 Ga0068860_1000554792 222
230 3300005843 Ga0068860_100239244 Ga0068860_1002392442 222
231 3300005844 Ga0068862_100018117 Ga0068862_1000181173 222
232 3300005844 Ga0068862_100028538 Ga0068862_1000285384 222
233 3300005844 Ga0068862_100182479 Ga0068862_1001824792 222
234 3300005937 Ga0081455_10036567 Ga0081455_100365672 222
235 3300006028 Ga0070717_10773966 Ga0070717_107739662 222
236 3300006038 Ga0075365_10405247 Ga0075365_104052472 222
237 3300006177 Ga0075362_10022530 Ga0075362_100225303 222
238 3300006195 Ga0075366_10087444 Ga0075366_100874442 222
239 3300006237 Ga0097621_100092654 Ga0097621_1000926542 222
240 3300006358 Ga0068871_100002008 Ga0068871_1000020089 222
241 3300006358 Ga0068871_100117775 Ga0068871_1001177752 222
242 3300006358 Ga0068871_100278120 Ga0068871_1002781202 222
243 3300006358 Ga0068871_100673834 Ga0068871_1006738342 222
244 3300006844 Ga0075428_100047286 Ga0075428_1000472864 222
245 3300006846 Ga0075430_100001311 Ga0075430_1000013117 222
246 3300006846 Ga0075430_100072889 Ga0075430_1000728894 222
247 3300006847 Ga0075431_100159230 Ga0075431_1001592302 222
248 3300006852 Ga0075433_10022772 Ga0075433_100227725 222
249 3300006852 Ga0075433_10137046 Ga0075433_101370461 222
250 3300006871 Ga0075434_100061458 Ga0075434_1000614582 222
251 3300006880 Ga0075429_100021822 Ga0075429_1000218224 222
252 3300006880 Ga0075429_100158321 Ga0075429_1001583213 222
253 3300006881 Ga0068865_100011919 Ga0068865_1000119195 222
254 3300006881 Ga0068865_100127890 Ga0068865_1001278902 222
255 3300006914 Ga0075436_100028741 Ga0075436_1000287412 222
256 3300006931 Ga0097620_100397747 Ga0097620_1003977472 222
257 3300007076 Ga0075435_100002724 Ga0075435_1000027249 222
258 3300009098 Ga0105245_10008195 Ga0105245_100081952 222
259 3300009098 Ga0105245_10017557 Ga0105245_100175574 222
260 3300009098 Ga0105245_10031604 Ga0105245_100316045 222
261 3300009098 Ga0105245_10108775 Ga0105245_101087752 222
262 3300009098 Ga0105245_10534561 Ga0105245_105345611 222
263 3300009147 Ga0114129_10004972 Ga0114129_100049728 222
264 3300009147 Ga0114129_10061439 Ga0114129_100614392 222
265 3300009147 Ga0114129_10084671 Ga0114129_100846714 222
266 3300009147 Ga0114129_10319312 Ga0114129_103193122 222
267 3300009148 Ga0105243_10048117 Ga0105243_100481173 222
268 3300009148 Ga0105243_10124843 Ga0105243_101248432 222
269 3300009148 Ga0105243_10814402 Ga0105243_108144022 222
270 3300009174 Ga0105241_10030908 Ga0105241_100309085 222
271 3300009174 Ga0105241_10043826 Ga0105241_100438262 222
272 3300009176 Ga0105242_10006216 Ga0105242_100062166 222
273 3300009176 Ga0105242_10008976 Ga0105242_100089763 222
274 3300009176 Ga0105242_10017192 Ga0105242_100171925 222
275 3300009176 Ga0105242_10061616 Ga0105242_100616163 222
276 3300009176 Ga0105242_10083213 Ga0105242_100832131 222
277 3300009176 Ga0105242_10832518 Ga0105242_108325181 222
278 3300009177 Ga0105248_10004221 Ga0105248_100042219 222
279 3300009177 Ga0105248_10027939 Ga0105248_100279394 222
280 3300009177 Ga0105248_10039102 Ga0105248_100391023 222
281 3300009177 Ga0105248_10047650 Ga0105248_100476502 222
282 3300009177 Ga0105248_10094366 Ga0105248_100943662 222
283 3300009177 Ga0105248_10253353 Ga0105248_102533532 222
284 3300009177 Ga0105248_11012806 Ga0105248_110128061 222
285 3300009551 Ga0105238_10099504 Ga0105238_100995043 222
286 3300009553 Ga0105249_10051744 Ga0105249_100517442 222
287 3300009553 Ga0105249_10195418 Ga0105249_101954182 222
288 3300009553 Ga0105249_10456031 Ga0105249_104560313 222
289 3300009553 Ga0105249_11069757 Ga0105249_110697571 222
290 3300010375 Ga0105239_11049046 Ga0105239_110490461 222
291 3300013296 Ga0157374_10021748 Ga0157374_100217484 222
292 3300013296 Ga0157374_10549265 Ga0157374_105492652 222
293 3300013297 Ga0157378_10025364 Ga0157378_100253642 222
294 3300013297 Ga0157378_10315828 Ga0157378_103158281 222
295 3300013306 Ga0163162_10073035 Ga0163162_100730354 222
296 3300013306 Ga0163162_10133964 Ga0163162_101339642 222
297 3300013306 Ga0163162_11090909 Ga0163162_110909091 222
298 3300014325 Ga0163163_10165262 Ga0163163_101652622 222
299 3300014326 Ga0157380_10331356 Ga0157380_103313561 222
300 3300014968 Ga0157379_10022039 Ga0157379_100220393 222
301 3300014968 Ga0157379_10032598 Ga0157379_100325982 222
302 3300014968 Ga0157379_10180478 Ga0157379_101804782 222
303 3300014969 Ga0157376_10006901 Ga0157376_100069016 222
304 3300014969 Ga0157376_10111426 Ga0157376_101114262 222
305 3300017792 Ga0163161_10208735 Ga0163161_102087352 222
306 3300025315 Ga0207697_10042165 Ga0207697_100421651 222
307 3300025321 Ga0207656_10097559 Ga0207656_100975592 222
308 3300025885 Ga0207653_10031998 Ga0207653_100319982 222
309 3300025899 Ga0207642_10060680 Ga0207642_100606803 222
310 3300025899 Ga0207642_10186929 Ga0207642_101869292 222
311 3300025903 Ga0207680_10024239 Ga0207680_100242391 222
312 3300025903 Ga0207680_10041556 Ga0207680_100415562 222
313 3300025903 Ga0207680_10285955 Ga0207680_102859552 222
314 3300025907 Ga0207645_10043855 Ga0207645_100438553 222
315 3300025913 Ga0207695_10617555 Ga0207695_106175551 222
316 3300025918 Ga0207662_10012816 Ga0207662_100128164 222
317 3300025918 Ga0207662_10083452 Ga0207662_100834522 222
318 3300025919 Ga0207657_10687680 Ga0207657_106876801 222
319 3300025923 Ga0207681_10076662 Ga0207681_100766622 222
320 3300025923 Ga0207681_10173209 Ga0207681_101732092 222
321 3300025927 Ga0207687_10007613 Ga0207687_100076132 222
322 3300025927 Ga0207687_10018202 Ga0207687_100182023 222
323 3300025927 Ga0207687_10059189 Ga0207687_100591892 222
324 3300025928 Ga0207700_10148444 Ga0207700_101484442 222
325 3300025931 Ga0207644_10024956 Ga0207644_100249562 222
326 3300025931 Ga0207644_10039918 Ga0207644_100399183 222
327 3300025932 Ga0207690_10042736 Ga0207690_100427362 222
328 3300025932 Ga0207690_10082417 Ga0207690_100824172 222
329 3300025933 Ga0207706_10003106 Ga0207706_1000310612 222
330 3300025934 Ga0207686_10001069 Ga0207686_1000106910 222
331 3300025934 Ga0207686_10034567 Ga0207686_100345673 222
332 3300025934 Ga0207686_10050599 Ga0207686_100505992 222
333 3300025934 Ga0207686_10112978 Ga0207686_101129782 222
334 3300025935 Ga0207709_10135778 Ga0207709_101357782 222
335 3300025936 Ga0207670_10677332 Ga0207670_106773322 222
336 3300025937 Ga0207669_10033816 Ga0207669_100338166 222
337 3300025937 Ga0207669_10411769 Ga0207669_104117691 222
338 3300025937 Ga0207669_10428986 Ga0207669_104289861 222
339 3300025937 Ga0207669_10698049 Ga0207669_106980492 222
340 3300025938 Ga0207704_10002402 Ga0207704_100024025 222
341 3300025938 Ga0207704_10376580 Ga0207704_103765801 222
342 3300025940 Ga0207691_10076326 Ga0207691_100763262 222
343 3300025941 Ga0207711_10125288 Ga0207711_101252882 222
344 3300025941 Ga0207711_10168473 Ga0207711_101684732 222
345 3300025941 Ga0207711_10406305 Ga0207711_104063051 222
346 3300025942 Ga0207689_10079849 Ga0207689_100798493 222
347 3300025945 Ga0207679_10652393 Ga0207679_106523932 222
348 3300025945 Ga0207679_11065911 Ga0207679_110659111 222
349 3300025949 Ga0207667_10482026 Ga0207667_104820262 222
350 3300025960 Ga0207651_10124216 Ga0207651_101242162 222
351 3300025960 Ga0207651_10204405 Ga0207651_102044052 222
352 3300025961 Ga0207712_10066640 Ga0207712_100666401 222
353 3300025972 Ga0207668_10165982 Ga0207668_101659822 222
354 3300025981 Ga0207640_10008787 Ga0207640_100087871 222
355 3300025981 Ga0207640_10080778 Ga0207640_100807783 222
356 3300025986 Ga0207658_10187700 Ga0207658_101877002 222
357 3300026023 Ga0207677_10006290 Ga0207677_100062905 222
358 3300026023 Ga0207677_10081455 Ga0207677_100814552 222
359 3300026023 Ga0207677_10098382 Ga0207677_100983822 222
360 3300026023 Ga0207677_10875719 Ga0207677_108757191 222
361 3300026035 Ga0207703_10167803 Ga0207703_101678032 222
362 3300026075 Ga0207708_10076647 Ga0207708_100766473 222
363 3300026088 Ga0207641_10004310 Ga0207641_100043104 222
364 3300026088 Ga0207641_10034434 Ga0207641_100344342 222
365 3300026089 Ga0207648_10027939 Ga0207648_100279395 222
366 3300026089 Ga0207648_10084956 Ga0207648_100849562 222
367 3300026089 Ga0207648_10147485 Ga0207648_101474852 222
368 3300026118 Ga0207675_100009910 Ga0207675_1000099108 222
369 3300026118 Ga0207675_100068800 Ga0207675_1000688002 222
370 3300026121 Ga0207683_10079918 Ga0207683_100799183 222
371 3300026121 Ga0207683_10216540 Ga0207683_102165402 222
372 3300026121 Ga0207683_10272651 Ga0207683_102726513 222
373 3300028379 Ga0268266_10015346 Ga0268266_100153464 222
374 3300028379 Ga0268266_10070643 Ga0268266_100706433 222
375 3300028380 Ga0268265_10018485 Ga0268265_100184854 222
376 3300028381 Ga0268264_10048850 Ga0268264_100488502 222
377 3300028381 Ga0268264_10747064 Ga0268264_107470642 222
378 3300034816 Ga0373930_0074685 Ga0373930_0074685_83_763 222
379 3300034817 Ga0373948_0010100 Ga0373948_0010100_334_1002 222
380 3300034819 Ga0373958_0002844 Ga0373958_0002844_323_991 222
381 3300034957 Ga0373938_0016108 Ga0373938_0016108_415_1083 222
382 3300035085 Ga0373929_0000507 Ga0373929_0000507_6633_7301 222
383 3300035086 Ga0373934_0081533 Ga0373934_0081533_71_739 222
384 3300035088 Ga0373940_0053528 Ga0373940_0053528_359_1027 222
385 3300035089 Ga0373944_0146791 Ga0373944_0146791_140_808 222
386 3300035091 Ga0373951_0003439 Ga0373951_0003439_2774_3442 222
387 3300035092 Ga0373952_0002405 Ga0373952_0002405_2670_3338 222
388 3300035111 Ga0373923_0032541 Ga0373923_0032541_1135_1803 222
389 3300035112 Ga0373932_0001066 Ga0373932_0001066_1155_1823 222
390 3300035112 Ga0373932_0042682 Ga0373932_0042682_72_740 222
391 3300035114 Ga0373939_0005527 Ga0373939_0005527_468_1136 222
392 3300035114 Ga0373939_0006260 Ga0373939_0006260_101_769 222
393 3300035114 Ga0373939_0052254 Ga0373939_0052254_585_1253 222
394 3300035115 Ga0373941_0001546 Ga0373941_0001546_3841_4509 222
395 3300035115 Ga0373941_0019722 Ga0373941_0019722_154_822 222
396 3300035121 Ga0373960_0001422 Ga0373960_0001422_4577_5245 222
397 3300035170 Ga0373943_0237669 Ga0373943_0237669_23_724 222
398 3300035170 Ga0373943_0307989 Ga0373943_0307989_157_825 222
399 3300035241 Ga0373961_0014619 Ga0373961_0014619_274_942 222
400 3300035241 Ga0373961_0014864 Ga0373961_0014864_1106_1786 222
401 3300035242 Ga0373962_0009910 Ga0373962_0009910_1471_2139 222
402 3300035691 Ga0373931_0053963 Ga0373931_0053963_930_1598 222
403 3300035692 Ga0373935_0212530 Ga0373935_0212530_366_1034 222
404 3300035724 Ga0373933_0145384 Ga0373933_0145384_691_1359 222
405 3300035724 Ga0373933_0211779 Ga0373933_0211779_500_1168 222
406 3300035725 Ga0373947_0052362 Ga0373947_0052362_1446_2147 222
407 3300036401 Ga0373937_0103575 Ga0373937_0103575_1161_1829 222
408 3300037068 Ga0373925_0005714 Ga0373925_0005714_6828_7496 222
409 3300045051 Ga0451576_0020375 Ga0451576_0020375_4689_5357 222
410 3300046463 Ga0495653_0182626 Ga0495653_0182626_305_973 222
411 3300046559 Ga0495667_0058131 Ga0495667_0058131_897_1565 222
412 3300046663 Ga0495635_0034631 Ga0495635_0034631_1706_2374 222
413 3300046681 Ga0495647_0035964 Ga0495647_0035964_322_1023 222
414 3300046683 Ga0495658_0025671 Ga0495658_0025671_91_792 222
415 3300046689 Ga0495613_0193460 Ga0495613_0193460_442_1110 222
416 3300047319 Ga0495674_0082466 Ga0495674_0082466_124_792 222
417 3300048904 Ga0496101_0474309 Ga0496101_0474309_296_964 222
418 3300048905 Ga0496102_0125523 Ga0496102_0125523_1408_2076 222
419 3300048907 Ga0496104_0232364 Ga0496104_0232364_749_1417 222
420 3300048909 Ga0496106_0236268 Ga0496106_0236268_544_1212 222
421 3300048909 Ga0496106_0511641 Ga0496106_0511641_140_808 222
422 3300048910 Ga0496107_0076724 Ga0496107_0076724_1275_1943 222
423 3300048912 Ga0496109_0443181 Ga0496109_0443181_516_1199 222
424 3300048917 Ga0496114_0265549 Ga0496114_0265549_21_704 222
425 3300049568 Ga0501031_0504175 Ga0501031_0504175_38_712 222
426 3300049587 Ga0501071_0648204 Ga0501071_0648204_122_796 222
427 3300050489 nmdc:mga03683_80124_c1 nmdc:mga03683_80124_c1_514_1182 222
428 3300050491 nmdc:mga00v17_20858_c1 nmdc:mga00v17_20858_c1_293_961 222
429 3300050491 nmdc:mga00v17_93212_c1 nmdc:mga00v17_93212_c1_710_1378 222
430 3300050491 nmdc:mga00v17_9892_c1 nmdc:mga00v17_9892_c1_3331_3999 222
431 3300050492 nmdc:mga0yw44_25812_c1 nmdc:mga0yw44_25812_c1_2093_2761 222
432 3300050493 nmdc:mga0k408_14233_c1 nmdc:mga0k408_14233_c1_856_1524 222
433 3300050496 nmdc:mga07m45_13165_c1 nmdc:mga07m45_13165_c1_2850_3518 222
434 3300050507 nmdc:mga05p37_10423_c1 nmdc:mga05p37_10423_c1_1351_2025 222
435 3300050507 nmdc:mga05p37_155805_c1 nmdc:mga05p37_155805_c1_1807_2481 222
436 3300050507 nmdc:mga05p37_99480_c1 nmdc:mga05p37_99480_c1_2756_3436 222
437 3300050507 nmdc:mga05p37_99665_c1 nmdc:mga05p37_99665_c1_2225_2893 222
438 3300050508 nmdc:mga09592_198078_c1 nmdc:mga09592_198078_c1_887_1555 222
439 3300050509 nmdc:mga0qj67_85558_c1 nmdc:mga0qj67_85558_c1_1156_1824 222
440 3300050510 nmdc:mga06r32_18864_c1 nmdc:mga06r32_18864_c1_3281_3949 222
441 3300050511 nmdc:mga08y16_217610_c1 nmdc:mga08y16_217610_c1_1170_1850 222
442 3300050512 nmdc:mga0n895_21289_c1 nmdc:mga0n895_21289_c1_3744_4412 222
443 3300050512 nmdc:mga0n895_231920_c1 nmdc:mga0n895_231920_c1_531_1199 222
444 3300050512 nmdc:mga0n895_815369_c1 nmdc:mga0n895_815369_c1_89_757 222
445 3300050513 nmdc:mga0rr50_300241_c1 nmdc:mga0rr50_300241_c1_257_925 222
446 3300050513 nmdc:mga0rr50_473203_c1 nmdc:mga0rr50_473203_c1_270_938 222
447 3300050513 nmdc:mga0rr50_63078_c1 nmdc:mga0rr50_63078_c1_1200_1868 222
448 3300050514 nmdc:mga08x19_22154_c1 nmdc:mga08x19_22154_c1_2321_2989 222
449 3300050514 nmdc:mga08x19_72690_c1 nmdc:mga08x19_72690_c1_538_1206 222
450 3300050515 nmdc:mga0a205_50530_c1 nmdc:mga0a205_50530_c1_2820_3488 222
451 3300053077 Ga0495601_0059943 Ga0495601_0059943_1613_2281 222
452 3300053134 Ga0500658_0038389 Ga0500658_0038389_293_1039 222
453 3300060353 Ga0501082_0683533 Ga0501082_0683533_78_752 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00498

FHA

FHA domain

169

235

0.97

PF16697

Yop-YscD_cpl

Inner membrane component of T3SS, cytoplasmic domain

157

243

0.93

Feature Viewer

pLDDT pTM Quality
84.09 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map