F446988

General Info

Members Datasets Scaffolds Average Seq Length
452 251 432 146

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10000625|Ga0182008_100006255
Length 174
Sequence MRDKPLIWIKPGPPRGPSLQASFRRKSMFKRILIATDGSALSRKAVASGISLAATHGAELVALTVVPRYPMNYFEGAMVFTPEDIARIEKQWTDAAQEMLAAVDARAQRSGVKVKTVTVRSDRVAEAIIAAAQKQSCDLIVMASHGRKGVKRLLLGSETQHVLTHSSLPVLVLR

Samples

Sample ID Description Type Environment
1 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
2 2643221672 Variovorax sp. Root434 Isolate Unclassified
3 2738541297 Duganella sp. GV083 Isolate Unclassified
4 2738541307 Variovorax sp. GV008 Isolate Unclassified
5 2738541357 Duganella sp. GV053 Isolate Unclassified
6 2738543003 Duganella sp. GV066 Isolate Unclassified
7 2738543013 Variovorax sp. BT01 Isolate Unclassified
8 2738543026 Duganella sp. GV089 Isolate Unclassified
9 2738543029 Duganella sp. GV039 Isolate Unclassified
10 2821131069 Duganella sp. 1224 Isolate Unclassified
11 2842711865 Duganella sp. R-73148 Isolate Unclassified
12 2842733646 Variovorax sp. R-72446 Isolate Unclassified
13 2857558681 Duganella sp. R-74565 Isolate Unclassified
14 2857564685 Duganella sp. R-74599 Isolate Unclassified
15 2904424332 Duganella sp. 1411 Isolate Rhizosphere
16 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
17 2904456579 Variovorax sp. 2002 Isolate Unclassified
18 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
19 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
20 2929520902 Variovorax beijingensis 502 Isolate Unclassified
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
105 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
106 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
107 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
111 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
112 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
117 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
118 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
119 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
120 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
121 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
122 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
123 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
124 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
127 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
128 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
131 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
132 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
182 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
183 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
184 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
215 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
216 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
217 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
230 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
231 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
232 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
233 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
234 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
235 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
236 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
237 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
238 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
242 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
243 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
246 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
247 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
248 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
250 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
251 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.69
Metatranscriptomes 0.66
Isolates 4.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.14
Nodule 0.22
Rhizoplane 3.98
Rhizosphere 66.81
Stem 0
Stem Tuber 0
Unclassified 10.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1002930 3300002738 Bacteria 3947
2 JGI25150J39212_1011280 3300002774 Bacteria 1627
3 JGI25159J45721_1005684 3300002987 Bacteria 3868
4 JGI25153J46596_10023392 3300003215 Bacteria 2255
5 rootH1_10092922 3300003316 Bacteria 1493
6 rootH1_10092922 3300003323 Bacteria 4208
7 rootL2_10079890 3300003322 Bacteria 3421
8 rootL2_10079892 3300003322 Bacteria 2417
9 Ga0055529_1000152 3300003763 Bacteria 98133
10 Ga0055526_1001033 3300003771 Bacteria 20365
11 Ga0055526_1003235 3300003771 Bacteria 10491
12 Ga0055526_1004446 3300003771 Bacteria 8418
13 Ga0055537_1000580 3300003773 Bacteria 20336
14 Ga0055524_1002755 3300003775 Bacteria 8837
15 Ga0055534_1000283 3300003784 Bacteria 34520
16 Ga0055528_1000495 3300003790 Bacteria 31111
17 Ga0055543_1005248 3300004625 Bacteria 3341
18 Ga0065165_1002857 3300005262 Bacteria 13394
19 Ga0068868_100912573 3300005338 Bacteria 799
20 Ga0070673_100179014 3300005364 Bacteria 1814
21 Ga0070659_100514554 3300005366 Bacteria 1021
22 Ga0070667_100009849 3300005367 Bacteria 7923
23 Ga0070678_101055544 3300005456 Bacteria 749
24 Ga0070665_101182393 3300005548 Bacteria 776
25 Ga0068858_100178368 3300005842 Bacteria 2005
26 Ga0075432_10065532 3300006058 Bacteria 1299
27 Ga0075431_101712721 3300006847 Bacteria 585
28 Ga0068865_101731857 3300006881 Bacteria 564
29 Ga0079104_1021257 3300006946 Bacteria 1771
30 Ga0105244_10002041 3300009036 Bacteria 15556
31 Ga0105244_10006687 3300009036 Bacteria 7422
32 Ga0105243_11481680 3300009148 Bacteria 702
33 Ga0105248_11586139 3300009177 Bacteria 741
34 Ga0105238_10386614 3300009551 Bacteria 1391
35 Ga0182008_10000625 3300014497 Bacteria 25949
36 Ga0163161_10000441 3300017792 Bacteria 34632
37 Ga0163161_10005579 3300017792 Bacteria 8723
38 Ga0163161_10007311 3300017792 Bacteria 7620
39 Ga0163161_10082371 3300017792 Bacteria 2370
40 Ga0213872_10000430 3300021361 Bacteria 34377
41 Ga0213872_10009808 3300021361 Bacteria 4576
42 Ga0213872_10011815 3300021361 Bacteria 4126
43 Ga0213872_10015413 3300021361 Bacteria 3555
44 Ga0209437_105081 3300025233 Bacteria 2265
45 Ga0207425_1000829 3300025245 Bacteria 15420
46 Ga0209646_1000190 3300025246 Bacteria 75772
47 Ga0209129_1001419 3300025258 Bacteria 13384
48 Ga0209565_1000055 3300025263 Bacteria 201184
49 Ga0209455_1000070 3300025272 Bacteria 307867
50 Ga0209673_1000040 3300025273 Bacteria 312633
51 Ga0209673_1008518 3300025273 Bacteria 4556
52 Ga0209130_1000169 3300025284 Bacteria 95167
53 Ga0209675_1000052 3300025291 Bacteria 201332
54 Ga0209025_1000104 3300025294 Bacteria 226895
55 Ga0209025_1001876 3300025294 Bacteria 24626
56 Ga0209564_1000027 3300025295 Bacteria 518458
57 Ga0209564_1000047 3300025295 Bacteria 368031
58 Ga0209564_1000271 3300025295 Bacteria 108422
59 Ga0209758_1000436 3300025297 Bacteria 70342
60 Ga0209050_1003239 3300025298 Bacteria 12267
61 Ga0209256_1000100 3300025299 Bacteria 201246
62 Ga0207426_1030046 3300025302 Bacteria 1786
63 Ga0209051_1000144 3300025303 Bacteria 134811
64 Ga0209051_1000298 3300025303 Bacteria 78777
65 Ga0207655_1001651 3300025728 Bacteria 19767
66 Ga0207655_1020428 3300025728 Bacteria 3403
67 Ga0207680_10251461 3300025903 Bacteria 1221
68 Ga0207695_10094481 3300025913 Bacteria 2997
69 Ga0207671_10315394 3300025914 Bacteria 1237
70 Ga0207681_10054174 3300025923 Bacteria 2726
71 Ga0207706_10077280 3300025933 Bacteria 2928
72 Ga0207709_10013377 3300025935 Bacteria 4527
73 Ga0207709_10498967 3300025935 Bacteria 949
74 Ga0207709_10887584 3300025935 Bacteria 724
75 Ga0207709_11296552 3300025935 Bacteria 602
76 Ga0207691_10076785 3300025940 Bacteria 3010
77 Ga0207711_10605085 3300025941 Bacteria 1023
78 Ga0207667_10019879 3300025949 Bacteria 7482
79 Ga0207651_10170066 3300025960 Bacteria 1718
80 Ga0207640_10159564 3300025981 Bacteria 1667
81 Ga0207658_10120434 3300025986 Bacteria 2091
82 Ga0207677_10448326 3300026023 Bacteria 1105
83 Ga0207648_10135647 3300026089 Bacteria 2168
84 Ga0207674_10519189 3300026116 Bacteria 1150
85 Ga0207683_10038427 3300026121 Bacteria 4172
86 Ga0207683_10261988 3300026121 Bacteria 1578
87 Ga0207683_11014674 3300026121 Bacteria 770
88 Ga0207698_11947433 3300026142 Bacteria 602
89 Ga0207698_12210443 3300026142 Bacteria 563
90 Ga0207428_10281806 3300027907 Bacteria 1233
91 Ga0268266_11047311 3300028379 Bacteria 789
92 Ga0268265_10020909 3300028380 Bacteria 4574
93 Ga0307515_10078355 3300028794 Bacteria 4347
94 Ga0316181_1100671 3300030744 Bacteria 2555
95 Ga0307408_100002407 3300031548 Bacteria 13173
96 Ga0307408_100044086 3300031548 Bacteria 3177
97 Ga0307408_100070092 3300031548 Bacteria 2587
98 Ga0307408_100357760 3300031548 Bacteria 1241
99 Ga0307405_10141322 3300031731 Bacteria 1679
100 Ga0307413_10780875 3300031824 Bacteria 801
101 Ga0307410_10095665 3300031852 Bacteria 2118
102 Ga0307406_10015267 3300031901 Bacteria 4440
103 Ga0307412_10040445 3300031911 Bacteria 3016
104 Ga0307412_10345887 3300031911 Bacteria 1192
105 Ga0307412_10438906 3300031911 Bacteria 1072
106 Ga0307412_10641907 3300031911 Bacteria 904
107 Ga0307412_11854833 3300031911 Bacteria 555
108 Ga0307416_100024837 3300032002 Bacteria 4382
109 Ga0307416_100175815 3300032002 Bacteria 2000
110 Ga0307416_102445940 3300032002 Bacteria 621
111 Ga0307414_10121996 3300032004 Bacteria 2005
112 Ga0307414_10154893 3300032004 Bacteria 1812
113 Ga0307411_10367687 3300032005 Bacteria 1178
114 Ga0373939_0019784 3300035114 Bacteria 1820
115 Ga0436361_0009051 3300039447 Bacteria 7525
116 Ga0436361_0039131 3300039447 Bacteria 6153
117 Ga0436361_0359152 3300039447 Bacteria 5047
118 Ga0436361_0391361 3300039447 Bacteria 3192
119 Ga0439436_0000824 3300041404 Bacteria 8431
120 Ga0439436_0016070 3300041404 Bacteria 2248
121 Ga0439439_0009115 3300041406 Bacteria 2355
122 Ga0439447_010330 3300041407 Bacteria 2774
123 Ga0439461_0003635 3300041410 Bacteria 2544
124 Ga0439466_0001768 3300041411 Bacteria 8448
125 Ga0439466_0002194 3300041411 Bacteria 7643
126 Ga0439465_0001420 3300041413 Bacteria 7747
127 Ga0439431_0000834 3300041997 Bacteria 6657
128 Ga0439442_004204 3300042002 Bacteria 2853
129 Ga0439442_011415 3300042002 Bacteria 1809
130 Ga0439445_0000625 3300042004 Bacteria 7280
131 Ga0439445_0022851 3300042004 Bacteria 1580
132 Ga0439432_002313 3300042006 Bacteria 7182
133 Ga0439449_0002980 3300042007 Bacteria 6601
134 Ga0439449_0314955 3300042007 Bacteria 591
135 Ga0439452_002959 3300042010 Bacteria 6049
136 Ga0439462_0000866 3300042015 Bacteria 6353
137 Ga0450919_007642 3300042121 Bacteria 1261
138 Ga0450921_012000 3300042123 Bacteria 746
139 Ga0450923_010189 3300042125 Bacteria 1661
140 Ga0450898_007863 3300042134 Bacteria 1669
141 Ga0450906_017687 3300042145 Bacteria 1284
142 Ga0450910_002268 3300042147 Bacteria 2521
143 Ga0439446_0006641 3300042156 Bacteria 3024
144 Ga0439446_0135480 3300042156 Bacteria 801
145 Ga0450908_004609 3300042184 Bacteria 2654
146 Ga0450909_030798 3300042185 Bacteria 814
147 Ga0439434_0000355 3300042435 Bacteria 13126
148 Ga0439434_0004783 3300042435 Bacteria 3967
149 Ga0450918_004213 3300042531 Bacteria 2635
150 Ga0450893_0022631 3300042532 Bacteria 1090
151 Ga0466982_0049156 3300044672 Bacteria 2576
152 Ga0466965_0087444 3300044683 Bacteria 1582
153 Ga0495617_004450 3300046452 Bacteria 5098
154 Ga0495617_004713 3300046452 Bacteria 4932
155 Ga0495617_013481 3300046452 Bacteria 2782
156 Ga0495617_028401 3300046452 Bacteria 1880
157 Ga0495617_048840 3300046452 Bacteria 1408
158 Ga0495627_071131 3300046453 Bacteria 1016
159 Ga0495590_0000143 3300046457 Bacteria 43197
160 Ga0495590_0010791 3300046457 Bacteria 3424
161 Ga0495590_0284219 3300046457 Bacteria 620
162 Ga0495629_0272589 3300046459 Bacteria 1162
163 Ga0495638_0013978 3300046460 Bacteria 5442
164 Ga0495638_0023089 3300046460 Bacteria 4074
165 Ga0495638_0027806 3300046460 Bacteria 3658
166 Ga0495638_0064562 3300046460 Bacteria 2255
167 Ga0495638_0117108 3300046460 Bacteria 1577
168 Ga0495638_0163344 3300046460 Bacteria 1283
169 Ga0495653_0000044 3300046463 Bacteria 115591
170 Ga0495650_0001173 3300046471 Bacteria 27987
171 Ga0495650_0001749 3300046471 Bacteria 19780
172 Ga0495650_0005780 3300046471 Bacteria 7898
173 Ga0495650_0010450 3300046471 Bacteria 5178
174 Ga0495650_0013485 3300046471 Bacteria 4317
175 Ga0495605_0000098 3300046474 Bacteria 109816
176 Ga0495605_0025174 3300046474 Bacteria 3102
177 Ga0495639_0064818 3300046475 Bacteria 1680
178 Ga0495584_0023449 3300046491 Bacteria 3128
179 Ga0495584_0051844 3300046491 Bacteria 2065
180 Ga0495584_0062307 3300046491 Bacteria 1874
181 Ga0495585_0011603 3300046492 Bacteria 5210
182 Ga0495585_0039691 3300046492 Bacteria 2645
183 Ga0495585_0069225 3300046492 Bacteria 1926
184 Ga0495585_0091422 3300046492 Bacteria 1638
185 Ga0495585_0397787 3300046492 Bacteria 663
186 Ga0495607_0013577 3300046501 Bacteria 5332
187 Ga0495607_0024047 3300046501 Bacteria 3804
188 Ga0495607_0036319 3300046501 Bacteria 2969
189 Ga0495607_0037159 3300046501 Bacteria 2927
190 Ga0495607_0039827 3300046501 Bacteria 2803
191 Ga0495607_0041833 3300046501 Bacteria 2719
192 Ga0495607_0127944 3300046501 Bacteria 1325
193 Ga0495607_0256450 3300046501 Bacteria 839
194 Ga0495607_0290780 3300046501 Bacteria 772
195 Ga0495583_0000150 3300046506 Bacteria 117772
196 Ga0495583_0001383 3300046506 Bacteria 24824
197 Ga0495583_0037954 3300046506 Bacteria 2279
198 Ga0495606_0000099 3300046507 Bacteria 150950
199 Ga0495606_0000524 3300046507 Bacteria 62049
200 Ga0495606_0002603 3300046507 Bacteria 20634
201 Ga0495606_0009874 3300046507 Bacteria 8001
202 Ga0495606_0017983 3300046507 Bacteria 5318
203 Ga0495606_0052774 3300046507 Bacteria 2641
204 Ga0495606_0137262 3300046507 Bacteria 1447
205 Ga0495606_0179939 3300046507 Bacteria 1220
206 Ga0495610_0000017 3300046512 Bacteria 365675
207 Ga0495610_0000668 3300046512 Bacteria 33359
208 Ga0495610_0007137 3300046512 Bacteria 7529
209 Ga0495610_0013042 3300046512 Bacteria 4961
210 Ga0495610_0013989 3300046512 Bacteria 4742
211 Ga0495610_0017836 3300046512 Bacteria 4033
212 Ga0495610_0033341 3300046512 Bacteria 2664
213 Ga0495610_0069484 3300046512 Bacteria 1648
214 Ga0495610_0213087 3300046512 Bacteria 784
215 Ga0495616_0011015 3300046513 Bacteria 5200
216 Ga0495616_0018669 3300046513 Bacteria 3801
217 Ga0495616_0021339 3300046513 Bacteria 3507
218 Ga0495616_0033528 3300046513 Bacteria 2674
219 Ga0495620_0014255 3300046515 Bacteria 4045
220 Ga0495631_0006741 3300046518 Bacteria 5895
221 Ga0495637_0000195 3300046520 Bacteria 47191
222 Ga0495637_0008310 3300046520 Bacteria 5104
223 Ga0495643_0000250 3300046522 Bacteria 78905
224 Ga0495643_0001163 3300046522 Bacteria 25714
225 Ga0495644_0005133 3300046523 Bacteria 5126
226 Ga0495644_0034276 3300046523 Bacteria 1916
227 Ga0495648_0001296 3300046524 Bacteria 24870
228 Ga0495648_0001297 3300046524 Bacteria 24870
229 Ga0495648_0003753 3300046524 Bacteria 13223
230 Ga0495648_0020323 3300046524 Bacteria 4633
231 Ga0495648_0021171 3300046524 Bacteria 4511
232 Ga0495648_0021733 3300046524 Bacteria 4438
233 Ga0495642_0007076 3300046528 Bacteria 4304
234 Ga0495654_0000030 3300046530 Bacteria 216715
235 Ga0495609_0003952 3300046538 Bacteria 8301
236 Ga0495609_0004923 3300046538 Bacteria 7170
237 Ga0495609_0021993 3300046538 Bacteria 2940
238 Ga0495609_0059985 3300046538 Bacteria 1682
239 Ga0495621_0008493 3300046539 Bacteria 3084
240 Ga0495597_0001285 3300046542 Bacteria 18457
241 Ga0495597_0007688 3300046542 Bacteria 5452
242 Ga0495622_0002393 3300046557 Bacteria 9126
243 Ga0495622_0089640 3300046557 Bacteria 1413
244 Ga0495622_0171645 3300046557 Bacteria 975
245 Ga0495633_0000917 3300046558 Bacteria 24985
246 Ga0495633_0008985 3300046558 Bacteria 5563
247 Ga0495633_0010571 3300046558 Bacteria 5029
248 Ga0495633_0010820 3300046558 Bacteria 4962
249 Ga0495633_0015374 3300046558 Bacteria 3971
250 Ga0495633_0018017 3300046558 Bacteria 3593
251 Ga0495633_0021245 3300046558 Bacteria 3249
252 Ga0495656_0037064 3300046615 Bacteria 2011
253 Ga0495668_0000035 3300046616 Bacteria 240241
254 Ga0495668_0000286 3300046616 Bacteria 69771
255 Ga0495668_0000939 3300046616 Bacteria 32535
256 Ga0495668_0012053 3300046616 Bacteria 5145
257 Ga0495668_0018436 3300046616 Bacteria 4033
258 Ga0495668_0019844 3300046616 Bacteria 3868
259 Ga0495668_0030302 3300046616 Bacteria 3055
260 Ga0495668_0210712 3300046616 Bacteria 1064
261 Ga0495611_0012048 3300046648 Bacteria 3673
262 Ga0495611_0049646 3300046648 Bacteria 1888
263 Ga0495625_0000301 3300046660 Bacteria 76108
264 Ga0495625_0001765 3300046660 Bacteria 25007
265 Ga0495625_0011811 3300046660 Bacteria 7094
266 Ga0495625_0037049 3300046660 Bacteria 3581
267 Ga0495625_0090224 3300046660 Bacteria 2120
268 Ga0495625_0100382 3300046660 Bacteria 1989
269 Ga0495625_0291355 3300046660 Bacteria 1047
270 Ga0495635_0291840 3300046663 Bacteria 1094
271 Ga0495659_0006047 3300046664 Bacteria 3825
272 Ga0495659_0223240 3300046664 Bacteria 778
273 Ga0495661_0042903 3300046665 Bacteria 2785
274 Ga0495661_0055952 3300046665 Bacteria 2362
275 Ga0495661_0103364 3300046665 Bacteria 1599
276 Ga0495588_0011704 3300046674 Bacteria 4124
277 Ga0495588_0040500 3300046674 Bacteria 2376
278 Ga0495588_0056729 3300046674 Bacteria 2022
279 Ga0495588_0065222 3300046674 Bacteria 1889
280 Ga0495658_0002021 3300046683 Bacteria 10319
281 Ga0495669_0000495 3300046684 Bacteria 18130
282 Ga0495624_0110288 3300046690 Bacteria 1692
283 Ga0495670_0000859 3300046691 Bacteria 14714
284 Ga0495670_0053680 3300046691 Bacteria 2018
285 Ga0495670_0113488 3300046691 Bacteria 1404
286 Ga0495671_0000605 3300046692 Bacteria 26398
287 Ga0495671_0002197 3300046692 Bacteria 12422
288 Ga0495671_0014637 3300046692 Bacteria 4216
289 Ga0495671_0024897 3300046692 Bacteria 3114
290 Ga0495671_0037235 3300046692 Bacteria 2461
291 Ga0495649_0006762 3300046694 Bacteria 7105
292 Ga0495649_0162038 3300046694 Bacteria 1172
293 Ga0495589_0210356 3300046794 Bacteria 916
294 Ga0495660_0008498 3300046810 Bacteria 6012
295 Ga0495660_0046133 3300046810 Bacteria 2390
296 Ga0495660_0332272 3300046810 Bacteria 680
297 Ga0495636_0009358 3300047318 Bacteria 3858
298 Ga0495672_0007759 3300047320 Bacteria 8030
299 Ga0495672_0039616 3300047320 Bacteria 2864
300 Ga0495672_0055971 3300047320 Bacteria 2298
301 Ga0495676_0001586 3300047321 Bacteria 19725
302 Ga0495683_0020093 3300047323 Bacteria 3446
303 Ga0495683_0027488 3300047323 Bacteria 2909
304 Ga0495683_0309788 3300047323 Bacteria 676
305 Ga0495687_000057 3300047443 Bacteria 186224
306 Ga0495687_035072 3300047443 Bacteria 2259
307 Ga0495687_035073 3300047443 Bacteria 2259
308 Ga0495677_0005364 3300047445 Bacteria 4864
309 Ga0495677_0018199 3300047445 Bacteria 2546
310 Ga0495679_020420 3300047446 Bacteria 2306
311 Ga0495685_000299 3300047447 Bacteria 16305
312 Ga0495685_148638 3300047447 Bacteria 761
313 Ga0495673_0000069 3300047469 Bacteria 218170
314 Ga0495673_0000203 3300047469 Bacteria 89918
315 Ga0495673_0000236 3300047469 Bacteria 79618
316 Ga0495673_0024597 3300047469 Bacteria 2906
317 Ga0495673_0185146 3300047469 Bacteria 786
318 Ga0495681_0043110 3300047470 Bacteria 2178
319 Ga0495681_0177960 3300047470 Bacteria 876
320 Ga0495686_0008513 3300047472 Bacteria 7519
321 Ga0495686_0033844 3300047472 Bacteria 3296
322 Ga0495686_0034917 3300047472 Bacteria 3235
323 Ga0495686_0095368 3300047472 Bacteria 1802
324 Ga0495686_0428150 3300047472 Bacteria 706
325 Ga0495593_0009621 3300047673 Bacteria 5610
326 Ga0495602_0143484 3300048088 Bacteria 1887
327 Ga0495614_0000554 3300048089 Bacteria 15475
328 Ga0496100_0190265 3300048903 Bacteria 1489
329 Ga0496100_0241245 3300048903 Bacteria 1334
330 Ga0496100_1520670 3300048903 Bacteria 529
331 Ga0496101_0011298 3300048904 Bacteria 5920
332 Ga0496102_0003022 3300048905 Bacteria 14246
333 Ga0496103_0007072 3300048906 Bacteria 6699
334 Ga0496103_0007447 3300048906 Bacteria 6525
335 Ga0496104_0020803 3300048907 Bacteria 6017
336 Ga0496104_0143958 3300048907 Bacteria 2289
337 Ga0496105_0007130 3300048908 Bacteria 8621
338 Ga0496108_0243725 3300048911 Bacteria 1563
339 Ga0496109_0050814 3300048912 Bacteria 3775
340 Ga0496110_0011390 3300048913 Bacteria 7277
341 Ga0496110_0019551 3300048913 Bacteria 5702
342 Ga0496110_0393768 3300048913 Bacteria 1263
343 Ga0496111_0354836 3300048914 Bacteria 1085
344 Ga0496113_0151659 3300048916 Bacteria 1829
345 Ga0496114_0161281 3300048917 Bacteria 1950
346 Ga0496116_0007313 3300048919 Bacteria 9832
347 Ga0496116_0139271 3300048919 Bacteria 1368
348 Ga0496116_0254326 3300048919 Bacteria 872
349 Ga0496117_0074788 3300048920 Bacteria 2253
350 Ga0496117_0382595 3300048920 Bacteria 716
351 Ga0496121_0028960 3300048924 Bacteria 5140
352 Ga0496122_0005495 3300048925 Bacteria 15080
353 Ga0496122_0043677 3300048925 Bacteria 3508
354 Ga0496122_0069491 3300048925 Bacteria 2522
355 Ga0496122_0084957 3300048925 Bacteria 2186
356 Ga0496122_0127955 3300048925 Bacteria 1621
357 Ga0496122_0145050 3300048925 Bacteria 1477
358 Ga0496123_0001126 3300048926 Bacteria 39890
359 Ga0496123_0022384 3300048926 Bacteria 4871
360 Ga0496123_0117373 3300048926 Bacteria 1505
361 Ga0496123_0117565 3300048926 Bacteria 1503
362 Ga0496123_0127930 3300048926 Bacteria 1414
363 Ga0496124_0023504 3300048927 Bacteria 5625
364 Ga0496124_0032154 3300048927 Bacteria 4638
365 Ga0496124_0262818 3300048927 Bacteria 1269
366 Ga0496124_0277588 3300048927 Bacteria 1223
367 Ga0496124_0374453 3300048927 Bacteria 998
368 Ga0496124_0576392 3300048927 Bacteria 737
369 Ga0496125_0454374 3300048928 Bacteria 733
370 Ga0496126_0029894 3300048929 Bacteria 5171
371 Ga0496126_0476711 3300048929 Bacteria 1000
372 Ga0495678_004680 3300049459 Bacteria 7830
373 Ga0495678_012539 3300049459 Bacteria 4015
374 Ga0495678_016016 3300049459 Bacteria 3440
375 Ga0495682_0016086 3300049460 Bacteria 2829
376 Ga0501313_026834 3300049529 Bacteria 734
377 Ga0501315_070798 3300049531 Bacteria 578
378 Ga0501316_037815 3300049532 Bacteria 665
379 Ga0501249_006619 3300049679 Bacteria 2385
380 Ga0501262_001339 3300049759 Bacteria 2757
381 Ga0501279_016770 3300049775 Bacteria 1022
382 Ga0501220_01977 3300049852 Bacteria 816
383 nmdc:mga03683_1615_c1 3300050489 Bacteria 6754
384 nmdc:mga03683_2268_c1 3300050489 Bacteria 5934
385 nmdc:mga03683_60245_c1 3300050489 Bacteria 1603
386 nmdc:mga03n38_736374_c1 3300050490 Bacteria 570
387 nmdc:mga0yw44_14877_c1 3300050492 Bacteria 4148
388 nmdc:mga0k408_100614_c1 3300050493 Bacteria 1704
389 nmdc:mga0k408_79479_c1 3300050493 Bacteria 1919
390 nmdc:mga06z11_207842_c1 3300050494 Bacteria 1139
391 nmdc:mga06z11_20917_c1 3300050494 Bacteria 3031
392 nmdc:mga06z11_593188_c1 3300050494 Bacteria 674
393 nmdc:mga07m45_622743_c1 3300050496 Bacteria 623
394 nmdc:mga07m45_6289_c1 3300050496 Bacteria 5996
395 nmdc:mga06r32_1477044_c1 3300050510 Bacteria 620
396 nmdc:mga0sz30_196763_c1 3300050516 Bacteria 895
397 nmdc:mga0sz30_24123_c1 3300050516 Bacteria 2480
398 Ga0500610_0002029 3300053079 Bacteria 7257
399 Ga0500610_0358249 3300053079 Bacteria 613
400 Ga0500646_0102522 3300053090 Bacteria 900
401 Ga0500651_0079933 3300053093 Bacteria 2026
402 Ga0500566_0179038 3300053094 Bacteria 1089
403 Ga0500569_011681 3300053109 Bacteria 2106
404 Ga0500571_000523 3300053110 Bacteria 15774
405 Ga0500593_003919 3300053117 Bacteria 5704
406 Ga0500594_0001718 3300053118 Bacteria 4778
407 Ga0500594_0005635 3300053118 Bacteria 2780
408 Ga0500594_0047565 3300053118 Bacteria 1197
409 Ga0500607_002118 3300053121 Bacteria 16516
410 Ga0500608_001341 3300053122 Bacteria 8811
411 Ga0500618_000653 3300053125 Bacteria 20633
412 Ga0500618_029379 3300053125 Bacteria 1297
413 Ga0500618_052029 3300053125 Bacteria 927
414 Ga0500626_024225 3300053128 Bacteria 2722
415 Ga0500658_0000018 3300053134 Bacteria 141217
416 Ga0500559_0003026 3300053136 Bacteria 8409
417 Ga0500559_0004366 3300053136 Bacteria 6739
418 Ga0500559_0024170 3300053136 Bacteria 2583
419 Ga0500559_0162382 3300053136 Bacteria 1050
420 Ga0500568_0036245 3300053139 Bacteria 2008
421 Ga0500573_0064388 3300053140 Bacteria 2097
422 Ga0500574_000080 3300053141 Bacteria 10859
423 Ga0500586_001526 3300053145 Bacteria 4914
424 Ga0500586_001555 3300053145 Bacteria 4883
425 Ga0500616_0044324 3300053153 Bacteria 2373
426 Ga0500619_119882 3300053154 Bacteria 896
427 Ga0500627_0000384 3300053158 Bacteria 11946
428 Ga0500634_0045166 3300053161 Bacteria 2384
429 Ga0500636_0028727 3300053177 Bacteria 3284
430 Ga0500645_048206 3300053730 Bacteria 1248
431 Ga0500565_005790 3300053734 Bacteria 1108
432 Ga0500596_012183 3300053735 Bacteria 1307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046664 Ga0495659_0223240 Ga0495659_0223240_384_755 123
2 iso_pu_bacteria 2643221628 2644159702 140
3 iso_pu_bacteria 2643221672 2644401411 140
4 iso_pu_bacteria 2738541307 2738885770 140
5 iso_pu_bacteria 2738543013 2739250411 140
6 iso_pu_bacteria 2842733646 2842735528 140
7 iso_pu_bacteria 2904449895 2904453599 140
8 iso_pu_bacteria 2904449895 2904454288 140
9 iso_pu_bacteria 2904456579 2904462716 140
10 iso_pu_bacteria 2919462493 2919465032 140
11 iso_pu_bacteria 2928115317 2928116231 140
12 iso_pu_bacteria 2929520902 2929527164 140
13 iso_pu_bacteria 2738541297 2738827062 141
14 iso_pu_bacteria 2738541357 2739150859 141
15 iso_pu_bacteria 2738543003 2739192778 141
16 iso_pu_bacteria 2738543026 2739319255 141
17 iso_pu_bacteria 2738543029 2739337496 141
18 iso_pu_bacteria 2821131069 2821136482 141
19 iso_pu_bacteria 2842711865 2842713684 141
20 iso_pu_bacteria 2857558681 2857562347 141
21 iso_pu_bacteria 2857564685 2857568299 141
22 iso_pu_bacteria 2904424332 2904428557 141
23 3300005338 Ga0068868_100912573 Ga0068868_1009125732 144
24 3300005364 Ga0070673_100179014 Ga0070673_1001790142 144
25 3300005367 Ga0070667_100009849 Ga0070667_1000098495 144
26 3300005456 Ga0070678_101055544 Ga0070678_1010555441 144
27 3300005548 Ga0070665_101182393 Ga0070665_1011823931 144
28 3300005842 Ga0068858_100178368 Ga0068858_1001783682 144
29 3300006058 Ga0075432_10065532 Ga0075432_100655322 144
30 3300006946 Ga0079104_1021257 Ga0079104_10212572 144
31 3300009177 Ga0105248_11586139 Ga0105248_115861391 144
32 3300009551 Ga0105238_10386614 Ga0105238_103866142 144
33 3300014497 Ga0182008_10000625 Ga0182008_100006255 144
34 3300017792 Ga0163161_10000441 Ga0163161_100004416 144
35 3300017792 Ga0163161_10005579 Ga0163161_100055794 144
36 3300017792 Ga0163161_10007311 Ga0163161_100073112 144
37 3300017792 Ga0163161_10082371 Ga0163161_100823712 144
38 3300025258 Ga0209129_1001419 Ga0209129_10014196 144
39 3300025273 Ga0209673_1008518 Ga0209673_10085183 144
40 3300025294 Ga0209025_1000104 Ga0209025_100010468 144
41 3300025298 Ga0209050_1003239 Ga0209050_100323910 144
42 3300025303 Ga0209051_1000144 Ga0209051_100014465 144
43 3300025303 Ga0209051_1000298 Ga0209051_100029852 144
44 3300025903 Ga0207680_10251461 Ga0207680_102514612 144
45 3300025913 Ga0207695_10094481 Ga0207695_100944812 144
46 3300025914 Ga0207671_10315394 Ga0207671_103153941 144
47 3300025923 Ga0207681_10054174 Ga0207681_100541743 144
48 3300025933 Ga0207706_10077280 Ga0207706_100772803 144
49 3300025935 Ga0207709_10013377 Ga0207709_100133772 144
50 3300025935 Ga0207709_10498967 Ga0207709_104989672 144
51 3300025935 Ga0207709_11296552 Ga0207709_112965521 144
52 3300025940 Ga0207691_10076785 Ga0207691_100767852 144
53 3300025949 Ga0207667_10019879 Ga0207667_100198794 144
54 3300025960 Ga0207651_10170066 Ga0207651_101700662 144
55 3300025981 Ga0207640_10159564 Ga0207640_101595641 144
56 3300025986 Ga0207658_10120434 Ga0207658_101204342 144
57 3300026023 Ga0207677_10448326 Ga0207677_104483262 144
58 3300026089 Ga0207648_10135647 Ga0207648_101356472 144
59 3300026116 Ga0207674_10519189 Ga0207674_105191892 144
60 3300026121 Ga0207683_10038427 Ga0207683_100384274 144
61 3300026121 Ga0207683_10261988 Ga0207683_102619882 144
62 3300026121 Ga0207683_11014674 Ga0207683_110146742 144
63 3300026142 Ga0207698_11947433 Ga0207698_119474331 144
64 3300026142 Ga0207698_12210443 Ga0207698_122104432 144
65 3300027907 Ga0207428_10281806 Ga0207428_102818062 144
66 3300028379 Ga0268266_11047311 Ga0268266_110473112 144
67 3300028380 Ga0268265_10020909 Ga0268265_100209094 144
68 3300031548 Ga0307408_100044086 Ga0307408_1000440862 144
69 3300031548 Ga0307408_100070092 Ga0307408_1000700922 144
70 3300031548 Ga0307408_100357760 Ga0307408_1003577602 144
71 3300031731 Ga0307405_10141322 Ga0307405_101413222 144
72 3300031824 Ga0307413_10780875 Ga0307413_107808752 144
73 3300031852 Ga0307410_10095665 Ga0307410_100956652 144
74 3300031901 Ga0307406_10015267 Ga0307406_100152674 144
75 3300031911 Ga0307412_10040445 Ga0307412_100404452 144
76 3300031911 Ga0307412_10345887 Ga0307412_103458871 144
77 3300031911 Ga0307412_10438906 Ga0307412_104389062 144
78 3300031911 Ga0307412_10641907 Ga0307412_106419072 144
79 3300031911 Ga0307412_11854833 Ga0307412_118548331 144
80 3300032002 Ga0307416_100024837 Ga0307416_1000248374 144
81 3300032002 Ga0307416_100175815 Ga0307416_1001758152 144
82 3300032002 Ga0307416_102445940 Ga0307416_1024459402 144
83 3300032004 Ga0307414_10121996 Ga0307414_101219962 144
84 3300032004 Ga0307414_10154893 Ga0307414_101548932 144
85 3300032005 Ga0307411_10367687 Ga0307411_103676872 144
86 3300041404 Ga0439436_0000824 Ga0439436_0000824_5649_6092 144
87 3300041404 Ga0439436_0016070 Ga0439436_0016070_319_762 144
88 3300041406 Ga0439439_0009115 Ga0439439_0009115_1261_1704 144
89 3300041407 Ga0439447_010330 Ga0439447_010330_1629_2072 144
90 3300041410 Ga0439461_0003635 Ga0439461_0003635_1243_1686 144
91 3300041411 Ga0439466_0001768 Ga0439466_0001768_7221_7664 144
92 3300041411 Ga0439466_0002194 Ga0439466_0002194_5736_6179 144
93 3300041413 Ga0439465_0001420 Ga0439465_0001420_1669_2112 144
94 3300041997 Ga0439431_0000834 Ga0439431_0000834_1999_2442 144
95 3300042002 Ga0439442_004204 Ga0439442_004204_645_1088 144
96 3300042002 Ga0439442_011415 Ga0439442_011415_144_587 144
97 3300042004 Ga0439445_0000625 Ga0439445_0000625_3301_3744 144
98 3300042004 Ga0439445_0022851 Ga0439445_0022851_268_711 144
99 3300042006 Ga0439432_002313 Ga0439432_002313_5623_6066 144
100 3300042007 Ga0439449_0002980 Ga0439449_0002980_750_1193 144
101 3300042007 Ga0439449_0314955 Ga0439449_0314955_111_554 144
102 3300042010 Ga0439452_002959 Ga0439452_002959_2469_2912 144
103 3300042015 Ga0439462_0000866 Ga0439462_0000866_2282_2725 144
104 3300042121 Ga0450919_007642 Ga0450919_007642_683_1126 144
105 3300042123 Ga0450921_012000 Ga0450921_012000_52_495 144
106 3300042125 Ga0450923_010189 Ga0450923_010189_402_845 144
107 3300042134 Ga0450898_007863 Ga0450898_007863_525_968 144
108 3300042145 Ga0450906_017687 Ga0450906_017687_183_626 144
109 3300042147 Ga0450910_002268 Ga0450910_002268_22_465 144
110 3300042156 Ga0439446_0006641 Ga0439446_0006641_2114_2557 144
111 3300042156 Ga0439446_0135480 Ga0439446_0135480_74_517 144
112 3300042184 Ga0450908_004609 Ga0450908_004609_1388_1831 144
113 3300042185 Ga0450909_030798 Ga0450909_030798_97_540 144
114 3300042435 Ga0439434_0000355 Ga0439434_0000355_12493_12936 144
115 3300042435 Ga0439434_0004783 Ga0439434_0004783_640_1083 144
116 3300042531 Ga0450918_004213 Ga0450918_004213_1556_1999 144
117 3300042532 Ga0450893_0022631 Ga0450893_0022631_477_920 144
118 3300046453 Ga0495627_071131 Ga0495627_071131_67_579 144
119 3300046459 Ga0495629_0272589 Ga0495629_0272589_554_997 144
120 3300046460 Ga0495638_0117108 Ga0495638_0117108_126_569 144
121 3300046507 Ga0495606_0179939 Ga0495606_0179939_27_470 144
122 3300046512 Ga0495610_0033341 Ga0495610_0033341_1820_2263 144
123 3300046513 Ga0495616_0011015 Ga0495616_0011015_4404_4847 144
124 3300046515 Ga0495620_0014255 Ga0495620_0014255_1923_2366 144
125 3300046518 Ga0495631_0006741 Ga0495631_0006741_4117_4560 144
126 3300046539 Ga0495621_0008493 Ga0495621_0008493_2272_2715 144
127 3300046557 Ga0495622_0089640 Ga0495622_0089640_463_906 144
128 3300046616 Ga0495668_0018436 Ga0495668_0018436_3041_3484 144
129 3300046616 Ga0495668_0210712 Ga0495668_0210712_43_486 144
130 3300046660 Ga0495625_0000301 Ga0495625_0000301_41695_42138 144
131 3300046663 Ga0495635_0291840 Ga0495635_0291840_516_959 144
132 3300046674 Ga0495588_0011704 Ga0495588_0011704_1609_2052 144
133 3300046674 Ga0495588_0040500 Ga0495588_0040500_232_684 144
134 3300046674 Ga0495588_0056729 Ga0495588_0056729_674_1117 144
135 3300046674 Ga0495588_0065222 Ga0495588_0065222_821_1264 144
136 3300046683 Ga0495658_0002021 Ga0495658_0002021_2957_3400 144
137 3300046690 Ga0495624_0110288 Ga0495624_0110288_484_927 144
138 3300046691 Ga0495670_0113488 Ga0495670_0113488_712_1224 144
139 3300046692 Ga0495671_0002197 Ga0495671_0002197_9190_9633 144
140 3300046810 Ga0495660_0046133 Ga0495660_0046133_1765_2208 144
141 3300047321 Ga0495676_0001586 Ga0495676_0001586_7791_8234 144
142 3300047673 Ga0495593_0009621 Ga0495593_0009621_1992_2435 144
143 3300048088 Ga0495602_0143484 Ga0495602_0143484_1357_1800 144
144 3300048089 Ga0495614_0000554 Ga0495614_0000554_12279_12722 144
145 3300048903 Ga0496100_0190265 Ga0496100_0190265_23_466 144
146 3300048903 Ga0496100_1520670 Ga0496100_1520670_26_469 144
147 3300048904 Ga0496101_0011298 Ga0496101_0011298_1405_1848 144
148 3300048905 Ga0496102_0003022 Ga0496102_0003022_11579_12022 144
149 3300048906 Ga0496103_0007447 Ga0496103_0007447_1616_2059 144
150 3300048907 Ga0496104_0020803 Ga0496104_0020803_4586_5029 144
151 3300048908 Ga0496105_0007130 Ga0496105_0007130_1643_2086 144
152 3300048911 Ga0496108_0243725 Ga0496108_0243725_120_632 144
153 3300048912 Ga0496109_0050814 Ga0496109_0050814_1383_1826 144
154 3300048913 Ga0496110_0011390 Ga0496110_0011390_1833_2276 144
155 3300048913 Ga0496110_0019551 Ga0496110_0019551_2747_3259 144
156 3300048913 Ga0496110_0393768 Ga0496110_0393768_161_604 144
157 3300048914 Ga0496111_0354836 Ga0496111_0354836_481_924 144
158 3300048916 Ga0496113_0151659 Ga0496113_0151659_925_1368 144
159 3300048919 Ga0496116_0007313 Ga0496116_0007313_1512_1955 144
160 3300048919 Ga0496116_0139271 Ga0496116_0139271_874_1317 144
161 3300048920 Ga0496117_0074788 Ga0496117_0074788_799_1242 144
162 3300048920 Ga0496117_0382595 Ga0496117_0382595_22_465 144
163 3300048924 Ga0496121_0028960 Ga0496121_0028960_1517_1960 144
164 3300048925 Ga0496122_0005495 Ga0496122_0005495_11297_11740 144
165 3300048925 Ga0496122_0069491 Ga0496122_0069491_190_633 144
166 3300048925 Ga0496122_0127955 Ga0496122_0127955_177_620 144
167 3300048925 Ga0496122_0145050 Ga0496122_0145050_929_1372 144
168 3300048926 Ga0496123_0001126 Ga0496123_0001126_35640_36083 144
169 3300048926 Ga0496123_0117373 Ga0496123_0117373_206_649 144
170 3300048926 Ga0496123_0117565 Ga0496123_0117565_80_523 144
171 3300048926 Ga0496123_0127930 Ga0496123_0127930_793_1236 144
172 3300048927 Ga0496124_0032154 Ga0496124_0032154_3445_3888 144
173 3300048927 Ga0496124_0277588 Ga0496124_0277588_12_455 144
174 3300048927 Ga0496124_0576392 Ga0496124_0576392_50_562 144
175 3300048928 Ga0496125_0454374 Ga0496125_0454374_67_579 144
176 3300048929 Ga0496126_0476711 Ga0496126_0476711_179_622 144
177 3300049759 Ga0501262_001339 Ga0501262_001339_2208_2651 144
178 3300050489 nmdc:mga03683_1615_c1 nmdc:mga03683_1615_c1_3775_4218 144
179 3300050489 nmdc:mga03683_2268_c1 nmdc:mga03683_2268_c1_3520_3963 144
180 3300050489 nmdc:mga03683_60245_c1 nmdc:mga03683_60245_c1_1109_1552 144
181 3300050490 nmdc:mga03n38_736374_c1 nmdc:mga03n38_736374_c1_74_517 144
182 3300050492 nmdc:mga0yw44_14877_c1 nmdc:mga0yw44_14877_c1_771_1214 144
183 3300050493 nmdc:mga0k408_100614_c1 nmdc:mga0k408_100614_c1_458_901 144
184 3300050493 nmdc:mga0k408_79479_c1 nmdc:mga0k408_79479_c1_544_987 144
185 3300050494 nmdc:mga06z11_207842_c1 nmdc:mga06z11_207842_c1_584_1027 144
186 3300050494 nmdc:mga06z11_20917_c1 nmdc:mga06z11_20917_c1_1972_2415 144
187 3300050494 nmdc:mga06z11_593188_c1 nmdc:mga06z11_593188_c1_219_662 144
188 3300050496 nmdc:mga07m45_622743_c1 nmdc:mga07m45_622743_c1_142_585 144
189 3300050496 nmdc:mga07m45_6289_c1 nmdc:mga07m45_6289_c1_17_460 144
190 3300050516 nmdc:mga0sz30_196763_c1 nmdc:mga0sz30_196763_c1_434_877 144
191 3300050516 nmdc:mga0sz30_24123_c1 nmdc:mga0sz30_24123_c1_1612_2055 144
192 3300053079 Ga0500610_0002029 Ga0500610_0002029_2711_3154 144
193 3300053079 Ga0500610_0358249 Ga0500610_0358249_64_507 144
194 3300053090 Ga0500646_0102522 Ga0500646_0102522_92_535 144
195 3300053093 Ga0500651_0079933 Ga0500651_0079933_26_469 144
196 3300053094 Ga0500566_0179038 Ga0500566_0179038_552_995 144
197 3300053109 Ga0500569_011681 Ga0500569_011681_1455_1898 144
198 3300053110 Ga0500571_000523 Ga0500571_000523_3418_3861 144
199 3300053117 Ga0500593_003919 Ga0500593_003919_1806_2249 144
200 3300053118 Ga0500594_0001718 Ga0500594_0001718_3170_3613 144
201 3300053121 Ga0500607_002118 Ga0500607_002118_3553_3996 144
202 3300053122 Ga0500608_001341 Ga0500608_001341_4125_4568 144
203 3300053125 Ga0500618_052029 Ga0500618_052029_228_671 144
204 3300053128 Ga0500626_024225 Ga0500626_024225_1401_1844 144
205 3300053134 Ga0500658_0000018 Ga0500658_0000018_136288_136731 144
206 3300053136 Ga0500559_0003026 Ga0500559_0003026_6207_6650 144
207 3300053136 Ga0500559_0004366 Ga0500559_0004366_3760_4203 144
208 3300053136 Ga0500559_0024170 Ga0500559_0024170_934_1377 144
209 3300053139 Ga0500568_0036245 Ga0500568_0036245_959_1402 144
210 3300053140 Ga0500573_0064388 Ga0500573_0064388_1473_1916 144
211 3300053141 Ga0500574_000080 Ga0500574_000080_9081_9524 144
212 3300053153 Ga0500616_0044324 Ga0500616_0044324_1540_1983 144
213 3300053154 Ga0500619_119882 Ga0500619_119882_148_591 144
214 3300053158 Ga0500627_0000384 Ga0500627_0000384_3238_3681 144
215 3300053161 Ga0500634_0045166 Ga0500634_0045166_739_1182 144
216 3300053177 Ga0500636_0028727 Ga0500636_0028727_2522_2965 144
217 3300053730 Ga0500645_048206 Ga0500645_048206_527_979 144
218 3300053734 Ga0500565_005790 Ga0500565_005790_341_784 144
219 3300053735 Ga0500596_012183 Ga0500596_012183_213_656 144
220 3300002738 JGI25154J39366_1002930 JGI25154J39366_10029303 145
221 3300002774 JGI25150J39212_1011280 JGI25150J39212_10112801 145
222 3300002987 JGI25159J45721_1005684 JGI25159J45721_10056843 145
223 3300003215 JGI25153J46596_10023392 JGI25153J46596_100233922 145
224 3300003316 rootH1_10092922 rootH1_100929222 145
225 3300003322 rootL2_10079890 rootL2_100798903 145
226 3300003322 rootL2_10079892 rootL2_100798922 145
227 3300003763 Ga0055529_1000152 Ga0055529_10001523 145
228 3300003771 Ga0055526_1001033 Ga0055526_10010333 145
229 3300003771 Ga0055526_1003235 Ga0055526_10032353 145
230 3300003771 Ga0055526_1004446 Ga0055526_10044467 145
231 3300003773 Ga0055537_1000580 Ga0055537_10005803 145
232 3300003775 Ga0055524_1002755 Ga0055524_10027558 145
233 3300003784 Ga0055534_1000283 Ga0055534_10002833 145
234 3300003790 Ga0055528_1000495 Ga0055528_100049530 145
235 3300004625 Ga0055543_1005248 Ga0055543_10052482 145
236 3300005262 Ga0065165_1002857 Ga0065165_100285712 145
237 3300005366 Ga0070659_100514554 Ga0070659_1005145542 145
238 3300006847 Ga0075431_101712721 Ga0075431_1017127212 145
239 3300006881 Ga0068865_101731857 Ga0068865_1017318572 145
240 3300009036 Ga0105244_10002041 Ga0105244_100020419 145
241 3300009036 Ga0105244_10006687 Ga0105244_100066873 145
242 3300009148 Ga0105243_11481680 Ga0105243_114816802 145
243 3300021361 Ga0213872_10000430 Ga0213872_1000043037 145
244 3300021361 Ga0213872_10009808 Ga0213872_100098083 145
245 3300021361 Ga0213872_10011815 Ga0213872_100118152 145
246 3300021361 Ga0213872_10015413 Ga0213872_100154135 145
247 3300025233 Ga0209437_105081 Ga0209437_1050813 145
248 3300025245 Ga0207425_1000829 Ga0207425_100082914 145
249 3300025246 Ga0209646_1000190 Ga0209646_100019059 145
250 3300025263 Ga0209565_1000055 Ga0209565_10000553 145
251 3300025272 Ga0209455_1000070 Ga0209455_10000704 145
252 3300025273 Ga0209673_1000040 Ga0209673_10000403 145
253 3300025284 Ga0209130_1000169 Ga0209130_100016990 145
254 3300025291 Ga0209675_1000052 Ga0209675_1000052186 145
255 3300025294 Ga0209025_1001876 Ga0209025_100187624 145
256 3300025295 Ga0209564_1000027 Ga0209564_10000274 145
257 3300025295 Ga0209564_1000047 Ga0209564_1000047324 145
258 3300025295 Ga0209564_1000271 Ga0209564_10002714 145
259 3300025297 Ga0209758_1000436 Ga0209758_10004363 145
260 3300025299 Ga0209256_1000100 Ga0209256_1000100186 145
261 3300025302 Ga0207426_1030046 Ga0207426_10300462 145
262 3300025728 Ga0207655_1001651 Ga0207655_100165119 145
263 3300025728 Ga0207655_1020428 Ga0207655_10204285 145
264 3300025935 Ga0207709_10887584 Ga0207709_108875842 145
265 3300025941 Ga0207711_10605085 Ga0207711_106050851 145
266 3300028794 Ga0307515_10078355 Ga0307515_100783553 145
267 3300030744 Ga0316181_1100671 Ga0316181_11006712 145
268 3300031548 Ga0307408_100002407 Ga0307408_10000240712 145
269 3300035114 Ga0373939_0019784 Ga0373939_0019784_222_659 145
270 3300039447 Ga0436361_0009051 Ga0436361_0009051_3544_3981 145
271 3300039447 Ga0436361_0039131 Ga0436361_0039131_3363_3800 145
272 3300039447 Ga0436361_0359152 Ga0436361_0359152_1966_2403 145
273 3300039447 Ga0436361_0391361 Ga0436361_0391361_1777_2229 145
274 3300044672 Ga0466982_0049156 Ga0466982_0049156_1596_2036 145
275 3300044683 Ga0466965_0087444 Ga0466965_0087444_56_496 145
276 3300046452 Ga0495617_004450 Ga0495617_004450_2453_2890 145
277 3300046452 Ga0495617_004713 Ga0495617_004713_2093_2530 145
278 3300046452 Ga0495617_013481 Ga0495617_013481_1113_1553 145
279 3300046452 Ga0495617_028401 Ga0495617_028401_1287_1727 145
280 3300046452 Ga0495617_048840 Ga0495617_048840_300_740 145
281 3300046457 Ga0495590_0000143 Ga0495590_0000143_22349_22786 145
282 3300046457 Ga0495590_0010791 Ga0495590_0010791_1701_2141 145
283 3300046457 Ga0495590_0284219 Ga0495590_0284219_97_534 145
284 3300046460 Ga0495638_0013978 Ga0495638_0013978_2520_2957 145
285 3300046460 Ga0495638_0023089 Ga0495638_0023089_1137_1577 145
286 3300046460 Ga0495638_0027806 Ga0495638_0027806_2258_2695 145
287 3300046460 Ga0495638_0064562 Ga0495638_0064562_181_618 145
288 3300046460 Ga0495638_0163344 Ga0495638_0163344_435_872 145
289 3300046463 Ga0495653_0000044 Ga0495653_0000044_2368_2805 145
290 3300046471 Ga0495650_0001173 Ga0495650_0001173_25163_25600 145
291 3300046471 Ga0495650_0001749 Ga0495650_0001749_16885_17322 145
292 3300046471 Ga0495650_0005780 Ga0495650_0005780_2429_2866 145
293 3300046471 Ga0495650_0010450 Ga0495650_0010450_2048_2485 145
294 3300046471 Ga0495650_0013485 Ga0495650_0013485_1808_2245 145
295 3300046474 Ga0495605_0000098 Ga0495605_0000098_2437_2874 145
296 3300046474 Ga0495605_0025174 Ga0495605_0025174_1288_1728 145
297 3300046475 Ga0495639_0064818 Ga0495639_0064818_468_905 145
298 3300046491 Ga0495584_0023449 Ga0495584_0023449_1129_1569 145
299 3300046491 Ga0495584_0051844 Ga0495584_0051844_106_546 145
300 3300046491 Ga0495584_0062307 Ga0495584_0062307_1178_1615 145
301 3300046492 Ga0495585_0011603 Ga0495585_0011603_2473_2910 145
302 3300046492 Ga0495585_0039691 Ga0495585_0039691_1130_1570 145
303 3300046492 Ga0495585_0069225 Ga0495585_0069225_1111_1551 145
304 3300046492 Ga0495585_0091422 Ga0495585_0091422_1015_1455 145
305 3300046492 Ga0495585_0397787 Ga0495585_0397787_69_509 145
306 3300046501 Ga0495607_0013577 Ga0495607_0013577_2206_2643 145
307 3300046501 Ga0495607_0024047 Ga0495607_0024047_1254_1694 145
308 3300046501 Ga0495607_0036319 Ga0495607_0036319_983_1423 145
309 3300046501 Ga0495607_0037159 Ga0495607_0037159_2159_2596 145
310 3300046501 Ga0495607_0039827 Ga0495607_0039827_1334_1774 145
311 3300046501 Ga0495607_0041833 Ga0495607_0041833_1618_2055 145
312 3300046501 Ga0495607_0127944 Ga0495607_0127944_12_452 145
313 3300046501 Ga0495607_0256450 Ga0495607_0256450_264_704 145
314 3300046501 Ga0495607_0290780 Ga0495607_0290780_239_676 145
315 3300046506 Ga0495583_0000150 Ga0495583_0000150_116193_116633 145
316 3300046506 Ga0495583_0001383 Ga0495583_0001383_21910_22347 145
317 3300046506 Ga0495583_0037954 Ga0495583_0037954_1024_1461 145
318 3300046507 Ga0495606_0000099 Ga0495606_0000099_2426_2863 145
319 3300046507 Ga0495606_0000524 Ga0495606_0000524_58923_59360 145
320 3300046507 Ga0495606_0002603 Ga0495606_0002603_17779_18216 145
321 3300046507 Ga0495606_0009874 Ga0495606_0009874_2504_2941 145
322 3300046507 Ga0495606_0017983 Ga0495606_0017983_2255_2692 145
323 3300046507 Ga0495606_0052774 Ga0495606_0052774_69_506 145
324 3300046507 Ga0495606_0137262 Ga0495606_0137262_717_1154 145
325 3300046512 Ga0495610_0000017 Ga0495610_0000017_2427_2864 145
326 3300046512 Ga0495610_0000668 Ga0495610_0000668_30495_30932 145
327 3300046512 Ga0495610_0007137 Ga0495610_0007137_2619_3056 145
328 3300046512 Ga0495610_0013042 Ga0495610_0013042_2344_2781 145
329 3300046512 Ga0495610_0013989 Ga0495610_0013989_1683_2120 145
330 3300046512 Ga0495610_0017836 Ga0495610_0017836_601_1038 145
331 3300046512 Ga0495610_0069484 Ga0495610_0069484_246_686 145
332 3300046512 Ga0495610_0213087 Ga0495610_0213087_106_543 145
333 3300046513 Ga0495616_0018669 Ga0495616_0018669_2259_2696 145
334 3300046513 Ga0495616_0021339 Ga0495616_0021339_1288_1728 145
335 3300046513 Ga0495616_0033528 Ga0495616_0033528_1147_1587 145
336 3300046520 Ga0495637_0000195 Ga0495637_0000195_44340_44777 145
337 3300046520 Ga0495637_0008310 Ga0495637_0008310_2518_2955 145
338 3300046522 Ga0495643_0000250 Ga0495643_0000250_2507_2944 145
339 3300046522 Ga0495643_0001163 Ga0495643_0001163_22599_23036 145
340 3300046523 Ga0495644_0005133 Ga0495644_0005133_3422_3862 145
341 3300046523 Ga0495644_0034276 Ga0495644_0034276_155_595 145
342 3300046524 Ga0495648_0001296 Ga0495648_0001296_21942_22379 145
343 3300046524 Ga0495648_0001297 Ga0495648_0001297_2492_2929 145
344 3300046524 Ga0495648_0003753 Ga0495648_0003753_2587_3024 145
345 3300046524 Ga0495648_0020323 Ga0495648_0020323_2417_2854 145
346 3300046524 Ga0495648_0021171 Ga0495648_0021171_2656_3096 145
347 3300046524 Ga0495648_0021733 Ga0495648_0021733_1602_2039 145
348 3300046528 Ga0495642_0007076 Ga0495642_0007076_2631_3068 145
349 3300046530 Ga0495654_0000030 Ga0495654_0000030_2415_2852 145
350 3300046538 Ga0495609_0003952 Ga0495609_0003952_5380_5817 145
351 3300046538 Ga0495609_0004923 Ga0495609_0004923_1506_1946 145
352 3300046538 Ga0495609_0021993 Ga0495609_0021993_1490_1927 145
353 3300046538 Ga0495609_0059985 Ga0495609_0059985_450_887 145
354 3300046542 Ga0495597_0001285 Ga0495597_0001285_2912_3349 145
355 3300046542 Ga0495597_0007688 Ga0495597_0007688_2337_2774 145
356 3300046557 Ga0495622_0002393 Ga0495622_0002393_2547_2984 145
357 3300046557 Ga0495622_0171645 Ga0495622_0171645_81_521 145
358 3300046558 Ga0495633_0000917 Ga0495633_0000917_2575_3012 145
359 3300046558 Ga0495633_0008985 Ga0495633_0008985_2497_2934 145
360 3300046558 Ga0495633_0010571 Ga0495633_0010571_2024_2461 145
361 3300046558 Ga0495633_0010820 Ga0495633_0010820_1413_1850 145
362 3300046558 Ga0495633_0015374 Ga0495633_0015374_1293_1733 145
363 3300046558 Ga0495633_0018017 Ga0495633_0018017_2002_2439 145
364 3300046558 Ga0495633_0021245 Ga0495633_0021245_1125_1565 145
365 3300046615 Ga0495656_0037064 Ga0495656_0037064_596_1036 145
366 3300046616 Ga0495668_0000035 Ga0495668_0000035_237262_237699 145
367 3300046616 Ga0495668_0000286 Ga0495668_0000286_66968_67405 145
368 3300046616 Ga0495668_0000939 Ga0495668_0000939_11290_11727 145
369 3300046616 Ga0495668_0012053 Ga0495668_0012053_2566_3003 145
370 3300046616 Ga0495668_0019844 Ga0495668_0019844_1260_1697 145
371 3300046616 Ga0495668_0030302 Ga0495668_0030302_1081_1518 145
372 3300046648 Ga0495611_0012048 Ga0495611_0012048_1965_2405 145
373 3300046648 Ga0495611_0049646 Ga0495611_0049646_127_567 145
374 3300046660 Ga0495625_0001765 Ga0495625_0001765_2633_3070 145
375 3300046660 Ga0495625_0011811 Ga0495625_0011811_2451_2888 145
376 3300046660 Ga0495625_0037049 Ga0495625_0037049_984_1421 145
377 3300046660 Ga0495625_0090224 Ga0495625_0090224_1424_1861 145
378 3300046660 Ga0495625_0100382 Ga0495625_0100382_1508_1948 145
379 3300046660 Ga0495625_0291355 Ga0495625_0291355_199_636 145
380 3300046664 Ga0495659_0006047 Ga0495659_0006047_1288_1728 145
381 3300046665 Ga0495661_0042903 Ga0495661_0042903_1076_1513 145
382 3300046665 Ga0495661_0055952 Ga0495661_0055952_823_1263 145
383 3300046665 Ga0495661_0103364 Ga0495661_0103364_1010_1450 145
384 3300046684 Ga0495669_0000495 Ga0495669_0000495_16351_16788 145
385 3300046691 Ga0495670_0000859 Ga0495670_0000859_13128_13568 145
386 3300046691 Ga0495670_0053680 Ga0495670_0053680_1303_1743 145
387 3300046692 Ga0495671_0000605 Ga0495671_0000605_23393_23830 145
388 3300046692 Ga0495671_0014637 Ga0495671_0014637_1591_2028 145
389 3300046692 Ga0495671_0024897 Ga0495671_0024897_211_648 145
390 3300046692 Ga0495671_0037235 Ga0495671_0037235_155_595 145
391 3300046694 Ga0495649_0006762 Ga0495649_0006762_1878_2315 145
392 3300046694 Ga0495649_0162038 Ga0495649_0162038_88_525 145
393 3300046794 Ga0495589_0210356 Ga0495589_0210356_235_675 145
394 3300046810 Ga0495660_0008498 Ga0495660_0008498_3131_3568 145
395 3300046810 Ga0495660_0332272 Ga0495660_0332272_97_534 145
396 3300047318 Ga0495636_0009358 Ga0495636_0009358_1261_1701 145
397 3300047320 Ga0495672_0007759 Ga0495672_0007759_2507_2944 145
398 3300047320 Ga0495672_0039616 Ga0495672_0039616_1311_1751 145
399 3300047320 Ga0495672_0055971 Ga0495672_0055971_714_1154 145
400 3300047323 Ga0495683_0020093 Ga0495683_0020093_1140_1580 145
401 3300047323 Ga0495683_0027488 Ga0495683_0027488_1447_1884 145
402 3300047323 Ga0495683_0309788 Ga0495683_0309788_150_590 145
403 3300047443 Ga0495687_000057 Ga0495687_000057_184645_185085 145
404 3300047443 Ga0495687_035072 Ga0495687_035072_1203_1640 145
405 3300047443 Ga0495687_035073 Ga0495687_035073_1203_1640 145
406 3300047445 Ga0495677_0005364 Ga0495677_0005364_3280_3720 145
407 3300047445 Ga0495677_0018199 Ga0495677_0018199_1064_1501 145
408 3300047446 Ga0495679_020420 Ga0495679_020420_438_875 145
409 3300047447 Ga0495685_000299 Ga0495685_000299_14764_15204 145
410 3300047447 Ga0495685_148638 Ga0495685_148638_65_502 145
411 3300047469 Ga0495673_0000069 Ga0495673_0000069_215313_215750 145
412 3300047469 Ga0495673_0000203 Ga0495673_0000203_2568_3005 145
413 3300047469 Ga0495673_0000236 Ga0495673_0000236_76529_76966 145
414 3300047469 Ga0495673_0024597 Ga0495673_0024597_1043_1483 145
415 3300047469 Ga0495673_0185146 Ga0495673_0185146_325_765 145
416 3300047470 Ga0495681_0043110 Ga0495681_0043110_1267_1704 145
417 3300047470 Ga0495681_0177960 Ga0495681_0177960_395_832 145
418 3300047472 Ga0495686_0008513 Ga0495686_0008513_2716_3168 145
419 3300047472 Ga0495686_0033844 Ga0495686_0033844_2325_2762 145
420 3300047472 Ga0495686_0034917 Ga0495686_0034917_832_1269 145
421 3300047472 Ga0495686_0095368 Ga0495686_0095368_667_1104 145
422 3300047472 Ga0495686_0428150 Ga0495686_0428150_29_469 145
423 3300048903 Ga0496100_0241245 Ga0496100_0241245_811_1248 145
424 3300048906 Ga0496103_0007072 Ga0496103_0007072_2244_2681 145
425 3300048907 Ga0496104_0143958 Ga0496104_0143958_1793_2230 145
426 3300048917 Ga0496114_0161281 Ga0496114_0161281_651_1088 145
427 3300048919 Ga0496116_0254326 Ga0496116_0254326_353_790 145
428 3300048925 Ga0496122_0043677 Ga0496122_0043677_2089_2526 145
429 3300048925 Ga0496122_0084957 Ga0496122_0084957_1707_2144 145
430 3300048926 Ga0496123_0022384 Ga0496123_0022384_2424_2861 145
431 3300048927 Ga0496124_0023504 Ga0496124_0023504_1435_1872 145
432 3300048927 Ga0496124_0262818 Ga0496124_0262818_378_815 145
433 3300048927 Ga0496124_0374453 Ga0496124_0374453_239_676 145
434 3300048929 Ga0496126_0029894 Ga0496126_0029894_2170_2607 145
435 3300049459 Ga0495678_004680 Ga0495678_004680_4716_5153 145
436 3300049459 Ga0495678_012539 Ga0495678_012539_1288_1728 145
437 3300049459 Ga0495678_016016 Ga0495678_016016_969_1406 145
438 3300049460 Ga0495682_0016086 Ga0495682_0016086_1103_1543 145
439 3300049529 Ga0501313_026834 Ga0501313_026834_282_722 145
440 3300049531 Ga0501315_070798 Ga0501315_070798_15_455 145
441 3300049532 Ga0501316_037815 Ga0501316_037815_10_450 145
442 3300049679 Ga0501249_006619 Ga0501249_006619_1660_2097 145
443 3300049775 Ga0501279_016770 Ga0501279_016770_371_811 145
444 3300049852 Ga0501220_01977 Ga0501220_01977_230_670 145
445 3300050510 nmdc:mga06r32_1477044_c1 nmdc:mga06r32_1477044_c1_48_518 145
446 3300053118 Ga0500594_0005635 Ga0500594_0005635_139_576 145
447 3300053118 Ga0500594_0047565 Ga0500594_0047565_408_857 145
448 3300053125 Ga0500618_000653 Ga0500618_000653_2398_2835 145
449 3300053125 Ga0500618_029379 Ga0500618_029379_532_969 145
450 3300053136 Ga0500559_0162382 Ga0500559_0162382_336_773 145
451 3300053145 Ga0500586_001526 Ga0500586_001526_2158_2595 145
452 3300053145 Ga0500586_001555 Ga0500586_001555_2058_2495 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

28

174

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.9101 3 144
5ahw-assembly1.cif.gz_B crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8702 2 145
5ahw-assembly2.cif.gz_D crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8702 2 145
3ab7-assembly3.cif.gz_B crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8689 4 143
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.8581 3 144
ID Description Score Start End Superfamily
4wnyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9101 3 144 3.40.50.620
5ahwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8702 2 145 3.40.50.620
af_Q57951_25_170_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8659 1 144 3.40.50.620
4wnyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8581 3 144 3.40.50.620
5ahwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8385 2 145 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A4Q3BVY6-F1-model_v4 Universal stress protein 0.9383 1 111
AF-A0A4Q3BVY6-F1-model_v4 Universal stress protein 0.9064 1 111
AF-A0A117N3L7-F1-model_v4 UspA domain-containing protein 0.9034 1 144
AF-A0A3N5V236-F1-model_v4 Universal stress protein 0.9019 1 92
AF-A0A1V2VC17-F1-model_v4 deleted 0.9006 1 145

Feature Viewer

pLDDT pTM Quality
88.46 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map