F446759

General Info

Members Datasets Scaffolds Average Seq Length
451 242 902 159

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101014697|Ga0075428_1010146972
Length 187
Sequence MLDADALSRFVRDARAAGKRIVFTNGVFDILHPGHLRYLQAARRHGDLLIVGLNSDASVRRNKGPARPINPEQERAEVLAALECVDAVSIFDDETPADIIRRVQPDILVKGADWPADQIVGRDTVEALGGKVILEPVEPGYSTTAIIERIENSRRAADPTVAPRSFVPPTTFRGALPARLRVQLTDV

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
242 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 0
Rhizoplane 2.88
Rhizosphere 93.35
Stem 0
Stem Tuber 0
Unclassified 13.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_101014697 3300006844 Bacteria 878
2 JGI24751J29686_10036993 3300002459 Bacteria 1011
3 Ga0065714_10201823 3300005288 Bacteria 893
4 Ga0065712_10098726 3300005290 Unclassified 2093
5 Ga0065712_10181110 3300005290 Bacteria 1192
6 Ga0065712_10388775 3300005290 Unclassified 744
7 Ga0065715_10091480 3300005293 Bacteria 5763
8 Ga0070683_100016796 3300005329 Bacteria 6457
9 Ga0070690_100203872 3300005330 Bacteria 1378
10 Ga0070690_100288712 3300005330 Bacteria 1172
11 Ga0070670_100020982 3300005331 Bacteria 5618
12 Ga0070670_100051080 3300005331 Bacteria 3552
13 Ga0070670_100433485 3300005331 Bacteria 1163
14 Ga0070670_101425887 3300005331 Bacteria 635
15 Ga0070677_10023709 3300005333 Bacteria 2274
16 Ga0070677_10262542 3300005333 Bacteria 862
17 Ga0070677_10546487 3300005333 Bacteria 634
18 Ga0068869_100049062 3300005334 Bacteria 3055
19 Ga0070682_100760234 3300005337 Bacteria 783
20 Ga0068868_100284616 3300005338 Bacteria 1400
21 Ga0070660_100254282 3300005339 Bacteria 1433
22 Ga0070689_100005396 3300005340 Bacteria 8720
23 Ga0070689_100021433 3300005340 Bacteria 4811
24 Ga0070689_100065174 3300005340 Bacteria 2836
25 Ga0070687_100147284 3300005343 Unclassified 1378
26 Ga0070687_100726498 3300005343 Bacteria 696
27 Ga0070661_100348569 3300005344 Bacteria 1161
28 Ga0070661_100431221 3300005344 Bacteria 1046
29 Ga0070668_100204759 3300005347 Unclassified 1621
30 Ga0070669_100092205 3300005353 Archaea 2273
31 Ga0070669_100543631 3300005353 Bacteria 968
32 Ga0070675_100007486 3300005354 Bacteria 8435
33 Ga0070675_100043817 3300005354 Bacteria 3658
34 Ga0070675_100470757 3300005354 Bacteria 1129
35 Ga0070671_100322983 3300005355 Archaea 1315
36 Ga0070671_100560740 3300005355 Bacteria 985
37 Ga0070673_100017054 3300005364 Bacteria 5152
38 Ga0070673_100426541 3300005364 Bacteria 1190
39 Ga0070688_100016901 3300005365 Unclassified 4178
40 Ga0070688_100608971 3300005365 Bacteria 837
41 Ga0070659_100053781 3300005366 Bacteria 3170
42 Ga0070659_100131860 3300005366 Bacteria 2030
43 Ga0070659_100245359 3300005366 Bacteria 1483
44 Ga0070667_100237568 3300005367 Bacteria 1626
45 Ga0070667_100251835 3300005367 Bacteria 1579
46 Ga0070667_100425504 3300005367 Unclassified 1211
47 Ga0070709_10958219 3300005434 Bacteria 679
48 Ga0070713_100049727 3300005436 Bacteria 3460
49 Ga0070713_101408219 3300005436 Bacteria 676
50 Ga0070701_10104602 3300005438 Unclassified 1573
51 Ga0070701_10109771 3300005438 Bacteria 1539
52 Ga0070711_100096785 3300005439 Unclassified 2139
53 Ga0070711_100278163 3300005439 Bacteria 1323
54 Ga0070705_100012891 3300005440 Bacteria 4263
55 Ga0070705_100024100 3300005440 Bacteria 3280
56 Ga0070705_100040743 3300005440 Unclassified 2643
57 Ga0070700_100050764 3300005441 Bacteria 2579
58 Ga0070700_100197133 3300005441 Bacteria 1412
59 Ga0070700_100622129 3300005441 Bacteria 849
60 Ga0070700_100885227 3300005441 Bacteria 726
61 Ga0070694_100003095 3300005444 Bacteria 9905
62 Ga0070694_100009660 3300005444 Bacteria 5922
63 Ga0070694_100053893 3300005444 Bacteria 2723
64 Ga0070694_100458075 3300005444 Bacteria 1008
65 Ga0070678_100496832 3300005456 Bacteria 1076
66 Ga0070662_100026352 3300005457 Bacteria 4026
67 Ga0070662_101099462 3300005457 Unclassified 682
68 Ga0070681_10016477 3300005458 Bacteria 7379
69 Ga0070685_10045953 3300005466 Unclassified 2506
70 Ga0070706_100453551 3300005467 Unclassified 1193
71 Ga0070706_100742941 3300005467 Unclassified 909
72 Ga0070706_100795020 3300005467 Bacteria 876
73 Ga0070706_101376807 3300005467 Bacteria 646
74 Ga0070707_100062138 3300005468 Bacteria 3583
75 Ga0070707_100085679 3300005468 Bacteria 3046
76 Ga0070698_100006640 3300005471 Bacteria 12545
77 Ga0070698_100641438 3300005471 Bacteria 1003
78 Ga0070698_100903592 3300005471 Unclassified 829
79 Ga0070699_100008020 3300005518 Bacteria 9168
80 Ga0070699_100030464 3300005518 Bacteria 4657
81 Ga0070699_100619532 3300005518 Unclassified 987
82 Ga0070679_100922225 3300005530 Bacteria 817
83 Ga0070697_100008651 3300005536 Bacteria 7950
84 Ga0070697_100146632 3300005536 Bacteria 1987
85 Ga0070672_100017932 3300005543 Bacteria 5106
86 Ga0070672_100193928 3300005543 Bacteria 1697
87 Ga0070686_100025518 3300005544 Bacteria 3557
88 Ga0070686_100050062 3300005544 Bacteria 2653
89 Ga0070686_100191207 3300005544 Bacteria 1461
90 Ga0070695_100077297 3300005545 Bacteria 2193
91 Ga0070695_100123628 3300005545 Bacteria 1774
92 Ga0070696_100026633 3300005546 Bacteria 3933
93 Ga0070696_100061243 3300005546 Bacteria 2632
94 Ga0070693_100006290 3300005547 Bacteria 5754
95 Ga0070693_100190734 3300005547 Bacteria 1325
96 Ga0070693_100651686 3300005547 Bacteria 766
97 Ga0070704_100000089 3300005549 Bacteria 31704
98 Ga0070704_100296012 3300005549 Bacteria 1346
99 Ga0070704_100439682 3300005549 Bacteria 1121
100 Ga0068855_100221088 3300005563 Unclassified 2124
101 Ga0070664_100224495 3300005564 Bacteria 1681
102 Ga0070664_100414476 3300005564 Bacteria 1233
103 Ga0070664_100472745 3300005564 Bacteria 1153
104 Ga0068857_100058235 3300005577 Bacteria 3430
105 Ga0068857_101142208 3300005577 Bacteria 753
106 Ga0068854_100055804 3300005578 Bacteria 2845
107 Ga0068854_100103408 3300005578 Bacteria 2138
108 Ga0068854_100572289 3300005578 Bacteria 961
109 Ga0068856_100333113 3300005614 Bacteria 1535
110 Ga0070702_100028454 3300005615 Bacteria 3029
111 Ga0070702_100043883 3300005615 Bacteria 2521
112 Ga0068859_100003496 3300005617 Bacteria 15995
113 Ga0068859_100137975 3300005617 Bacteria 2512
114 Ga0068859_100869451 3300005617 Bacteria 987
115 Ga0068859_100912230 3300005617 Bacteria 963
116 Ga0068859_101099984 3300005617 Bacteria 874
117 Ga0068864_100024734 3300005618 Bacteria 5052
118 Ga0068864_100136312 3300005618 Unclassified 2210
119 Ga0068864_100224352 3300005618 Bacteria 1735
120 Ga0068864_100266026 3300005618 Unclassified 1596
121 Ga0068864_100269091 3300005618 Bacteria 1587
122 Ga0068861_100016764 3300005719 Bacteria 5190
123 Ga0068861_100133961 3300005719 Bacteria 2014
124 Ga0068870_10004468 3300005840 Bacteria 6022
125 Ga0068863_100299946 3300005841 Bacteria 1558
126 Ga0068863_100461326 3300005841 Bacteria 1248
127 Ga0068858_100162653 3300005842 Bacteria 2102
128 Ga0068860_100034523 3300005843 Unclassified 4852
129 Ga0068860_100099895 3300005843 Bacteria 2768
130 Ga0068860_100149979 3300005843 Bacteria 2245
131 Ga0068860_100404100 3300005843 Bacteria 1352
132 Ga0068862_100021428 3300005844 Bacteria 5399
133 Ga0068862_100315927 3300005844 Bacteria 1441
134 Ga0068862_100547343 3300005844 Bacteria 1105
135 Ga0068862_100710675 3300005844 Bacteria 974
136 Ga0081455_10067754 3300005937 Bacteria 2973
137 Ga0081539_10081476 3300005985 Bacteria 1700
138 Ga0075365_10003186 3300006038 Bacteria 8378
139 Ga0075368_10044166 3300006042 Bacteria 1757
140 Ga0075364_10015007 3300006051 Bacteria 4797
141 Ga0075364_10039634 3300006051 Bacteria 3055
142 Ga0070715_10247759 3300006163 Bacteria 930
143 Ga0070716_100373808 3300006173 Bacteria 1016
144 Ga0075367_10020998 3300006178 Bacteria 3644
145 Ga0075369_10082509 3300006186 Bacteria 1427
146 Ga0097621_100074334 3300006237 Bacteria 2815
147 Ga0097621_100291664 3300006237 Bacteria 1438
148 Ga0075370_10012462 3300006353 Bacteria 4494
149 Ga0068871_100160780 3300006358 Bacteria 1921
150 Ga0068871_100254152 3300006358 Bacteria 1531
151 Ga0075428_100009506 3300006844 Bacteria 10796
152 Ga0075428_100057506 3300006844 Bacteria 4257
153 Ga0075428_100585961 3300006844 Unclassified 1192
154 Ga0075430_100030740 3300006846 Bacteria 4561
155 Ga0075433_10001195 3300006852 Bacteria 18904
156 Ga0075433_10126457 3300006852 Bacteria 2270
157 Ga0075433_10208363 3300006852 Bacteria 1738
158 Ga0075433_10672045 3300006852 Bacteria 908
159 Ga0075434_100011105 3300006871 Bacteria 8476
160 Ga0075434_100017244 3300006871 Bacteria 6954
161 Ga0075434_100042722 3300006871 Bacteria 4494
162 Ga0075434_100120419 3300006871 Bacteria 2639
163 Ga0075434_100546158 3300006871 Bacteria 1178
164 Ga0075429_100268222 3300006880 Unclassified 1495
165 Ga0075436_100069690 3300006914 Bacteria 2430
166 Ga0075436_100215210 3300006914 Bacteria 1363
167 Ga0097620_100003496 3300006931 Bacteria 15995
168 Ga0097620_100137972 3300006931 Bacteria 2512
169 Ga0097620_100869314 3300006931 Bacteria 987
170 Ga0097620_100912401 3300006931 Bacteria 963
171 Ga0097620_101100207 3300006931 Bacteria 874
172 Ga0075435_100002425 3300007076 Bacteria 12369
173 Ga0075435_100053423 3300007076 Bacteria 3258
174 Ga0075435_100137085 3300007076 Bacteria 2051
175 Ga0075435_100152885 3300007076 Unclassified 1941
176 Ga0111539_10108155 3300009094 Bacteria 3263
177 Ga0111539_10156804 3300009094 Unclassified 2664
178 Ga0111539_10216666 3300009094 Bacteria 2230
179 Ga0111539_10219573 3300009094 Bacteria 2214
180 Ga0111539_10411305 3300009094 Bacteria 1575
181 Ga0111539_10597167 3300009094 Unclassified 1285
182 Ga0111539_11944643 3300009094 Unclassified 682
183 Ga0105245_10213211 3300009098 Bacteria 1860
184 Ga0114129_10057730 3300009147 Bacteria 5430
185 Ga0114129_11619747 3300009147 Bacteria 792
186 Ga0105243_10027210 3300009148 Bacteria 4380
187 Ga0105243_10094031 3300009148 Bacteria 2475
188 Ga0105243_10664703 3300009148 Bacteria 1011
189 Ga0105241_10090938 3300009174 Bacteria 2407
190 Ga0105242_10479390 3300009176 Bacteria 1179
191 Ga0105242_11685213 3300009176 Bacteria 670
192 Ga0105248_10048869 3300009177 Bacteria 4745
193 Ga0105248_10353072 3300009177 Bacteria 1655
194 Ga0105248_10452819 3300009177 Bacteria 1446
195 Ga0105248_11057147 3300009177 Unclassified 917
196 Ga0105238_10363317 3300009551 Bacteria 1437
197 Ga0105249_10001504 3300009553 Bacteria 20446
198 Ga0105249_10327636 3300009553 Bacteria 1544
199 Ga0105249_10758902 3300009553 Bacteria 1032
200 Ga0105249_11630016 3300009553 Bacteria 718
201 Ga0157371_10888393 3300013102 Unclassified 675
202 Ga0157378_10418175 3300013297 Bacteria 1324
203 Ga0163162_10372175 3300013306 Bacteria 1562
204 Ga0163162_10574196 3300013306 Unclassified 1255
205 Ga0157372_10244413 3300013307 Bacteria 2082
206 Ga0157372_11462549 3300013307 Bacteria 787
207 Ga0157375_10016653 3300013308 Bacteria 6611
208 Ga0163163_10000001 3300014325 Bacteria 622185
209 Ga0163163_10383384 3300014325 Bacteria 1463
210 Ga0157380_10981989 3300014326 Bacteria 877
211 Ga0157376_12799039 3300014969 Unclassified 528
212 Ga0207653_10026799 3300025885 Bacteria 1849
213 Ga0207653_10288609 3300025885 Unclassified 634
214 Ga0207680_10417253 3300025903 Bacteria 950
215 Ga0207685_10192693 3300025905 Bacteria 952
216 Ga0207699_10066807 3300025906 Bacteria 2184
217 Ga0207645_10016158 3300025907 Bacteria 4945
218 Ga0207643_10006990 3300025908 Bacteria 6049
219 Ga0207707_10022630 3300025912 Bacteria 5495
220 Ga0207707_10082554 3300025912 Bacteria 2806
221 Ga0207663_10446454 3300025916 Unclassified 997
222 Ga0207660_10232475 3300025917 Bacteria 1450
223 Ga0207662_10006288 3300025918 Bacteria 6397
224 Ga0207662_10038022 3300025918 Bacteria 2819
225 Ga0207649_10157426 3300025920 Bacteria 1571
226 Ga0207652_10597794 3300025921 Bacteria 989
227 Ga0207652_10759007 3300025921 Bacteria 863
228 Ga0207646_10032271 3300025922 Bacteria 4739
229 Ga0207646_10067009 3300025922 Bacteria 3205
230 Ga0207681_10003170 3300025923 Bacteria 10325
231 Ga0207681_10323709 3300025923 Bacteria 1227
232 Ga0207650_10028588 3300025925 Bacteria 4000
233 Ga0207650_10073266 3300025925 Bacteria 2579
234 Ga0207650_10342457 3300025925 Bacteria 1228
235 Ga0207650_11366517 3300025925 Bacteria 603
236 Ga0207659_10001272 3300025926 Bacteria 15110
237 Ga0207659_10011061 3300025926 Bacteria 5688
238 Ga0207659_10293691 3300025926 Unclassified 1332
239 Ga0207659_10445887 3300025926 Bacteria 1089
240 Ga0207687_10484826 3300025927 Bacteria 1030
241 Ga0207700_10027277 3300025928 Bacteria 3997
242 Ga0207700_11012501 3300025928 Bacteria 743
243 Ga0207644_10008620 3300025931 Bacteria 6669
244 Ga0207690_10049702 3300025932 Bacteria 2797
245 Ga0207690_10201701 3300025932 Bacteria 1511
246 Ga0207690_10273696 3300025932 Bacteria 1313
247 Ga0207706_10006050 3300025933 Bacteria 11253
248 Ga0207706_10380498 3300025933 Archaea 1225
249 Ga0207686_10135729 3300025934 Bacteria 1693
250 Ga0207709_10291278 3300025935 Bacteria 1210
251 Ga0207709_10527975 3300025935 Bacteria 925
252 Ga0207709_10855074 3300025935 Bacteria 737
253 Ga0207670_10002109 3300025936 Bacteria 10392
254 Ga0207670_10010102 3300025936 Bacteria 5419
255 Ga0207670_10019086 3300025936 Bacteria 4181
256 Ga0207669_10013371 3300025937 Bacteria 4073
257 Ga0207704_10022964 3300025938 Bacteria 3353
258 Ga0207691_10029747 3300025940 Bacteria 5108
259 Ga0207691_10081925 3300025940 Unclassified 2899
260 Ga0207711_10279061 3300025941 Bacteria 1538
261 Ga0207711_10727925 3300025941 Unclassified 925
262 Ga0207689_10046288 3300025942 Bacteria 3595
263 Ga0207679_10173399 3300025945 Bacteria 1778
264 Ga0207679_10349784 3300025945 Bacteria 1288
265 Ga0207679_11094152 3300025945 Bacteria 731
266 Ga0207651_10000712 3300025960 Bacteria 14261
267 Ga0207651_10491298 3300025960 Bacteria 1059
268 Ga0207712_10001523 3300025961 Bacteria 15691
269 Ga0207668_10313344 3300025972 Bacteria 1299
270 Ga0207640_10079136 3300025981 Bacteria 2240
271 Ga0207640_10899265 3300025981 Bacteria 773
272 Ga0207703_10139630 3300026035 Bacteria 2102
273 Ga0207708_10022974 3300026075 Bacteria 4710
274 Ga0207708_10202063 3300026075 Bacteria 1586
275 Ga0207708_10407595 3300026075 Bacteria 1125
276 Ga0207702_10244035 3300026078 Bacteria 1684
277 Ga0207641_10591816 3300026088 Bacteria 1085
278 Ga0207641_11563780 3300026088 Bacteria 661
279 Ga0207648_10013116 3300026089 Bacteria 7727
280 Ga0207676_10036931 3300026095 Bacteria 3719
281 Ga0207676_10058841 3300026095 Bacteria 3033
282 Ga0207676_11062866 3300026095 Bacteria 799
283 Ga0207674_10033101 3300026116 Bacteria 5413
284 Ga0207674_10503649 3300026116 Bacteria 1170
285 Ga0207675_100002376 3300026118 Bacteria 18642
286 Ga0207675_100221178 3300026118 Bacteria 1824
287 Ga0207683_10465873 3300026121 Bacteria 1166
288 Ga0207683_10820379 3300026121 Bacteria 863
289 Ga0209813_10079960 3300027866 Bacteria 1079
290 Ga0207428_10002283 3300027907 Bacteria 19243
291 Ga0207428_10162288 3300027907 Bacteria 1696
292 Ga0268265_10000135 3300028380 Bacteria 93986
293 Ga0268265_10521893 3300028380 Bacteria 1123
294 Ga0268265_10581675 3300028380 Bacteria 1067
295 Ga0268264_10023300 3300028381 Bacteria 5051
296 Ga0268264_10342776 3300028381 Unclassified 1420
297 Ga0268264_10379163 3300028381 Bacteria 1354
298 Ga0316576_10227021 3300031727 Bacteria 1404
299 Ga0307416_100097805 3300032002 Bacteria 2543
300 Ga0307416_101912368 3300032002 Unclassified 697
301 Ga0316583_10069130 3300032133 Bacteria 1236
302 Ga0373958_0109375 3300034819 Unclassified 657
303 Ga0373959_0078752 3300034820 Bacteria 756
304 Ga0373934_0003832 3300035086 Bacteria 5536
305 Ga0373944_0004796 3300035089 Bacteria 3541
306 Ga0373945_0044004 3300035116 Bacteria 1622
307 Ga0373953_0029622 3300035117 Bacteria 2118
308 Ga0373953_0040532 3300035117 Bacteria 1850
309 Ga0373954_0181952 3300035118 Bacteria 1031
310 Ga0373954_0215582 3300035118 Bacteria 944
311 Ga0373956_0090962 3300035119 Bacteria 1408
312 Ga0373956_0115342 3300035119 Bacteria 1252
313 Ga0373957_0003805 3300035120 Bacteria 4523
314 Ga0373946_0014128 3300035171 Unclassified 3008
315 Ga0373955_0004470 3300035172 Bacteria 6191
316 Ga0373955_0041886 3300035172 Unclassified 2457
317 Ga0373955_0055139 3300035172 Bacteria 2176
318 Ga0373955_0141274 3300035172 Bacteria 1412
319 Ga0373961_0035675 3300035241 Bacteria 1413
320 Ga0373924_0032443 3300035410 Bacteria 2104
321 Ga0373935_0080168 3300035692 Bacteria 2120
322 Ga0373935_0139125 3300035692 Bacteria 1638
323 Ga0373933_0002143 3300035724 Bacteria 11323
324 Ga0373947_0013719 3300035725 Bacteria 4643
325 Ga0373937_0000088 3300036401 Bacteria 84659
326 Ga0373937_0007516 3300036401 Bacteria 9433
327 Ga0373937_0163822 3300036401 Bacteria 2085
328 Ga0316582_0619045 3300036647 Bacteria 745
329 Ga0373925_0003153 3300037068 Bacteria 12918
330 Ga0373925_0290034 3300037068 Bacteria 1319
331 Ga0373925_0844640 3300037068 Bacteria 755
332 Ga0395905_0304745 3300037471 Bacteria 1481
333 Ga0436365_0580417 3300039437 Bacteria 1899
334 Ga0451853_1531392 3300041512 Bacteria 1199
335 Ga0439444_0014389 3300042437 Bacteria 1322
336 Ga0453683_0067310 3300044673 Bacteria 2239
337 Ga0453683_0095100 3300044673 Unclassified 1869
338 Ga0466957_0557876 3300044842 Bacteria 799
339 Ga0451576_0003703 3300045051 Bacteria 20672
340 Ga0451576_0013861 3300045051 Bacteria 9006
341 Ga0451576_0014174 3300045051 Bacteria 8884
342 Ga0451576_0347927 3300045051 Bacteria 1552
343 Ga0451576_2320771 3300045051 Bacteria 550
344 Ga0495603_0013780 3300046455 Bacteria 4892
345 Ga0495629_0525900 3300046459 Unclassified 796
346 Ga0495651_0134069 3300046462 Bacteria 1805
347 Ga0495580_0202634 3300046472 Bacteria 1367
348 Ga0495664_0348944 3300046477 Bacteria 891
349 Ga0495608_0023490 3300046511 Bacteria 4226
350 Ga0495608_0354563 3300046511 Bacteria 902
351 Ga0495618_0213182 3300046514 Bacteria 1220
352 Ga0495630_0009709 3300046517 Bacteria 6922
353 Ga0495644_0131983 3300046523 Bacteria 952
354 Ga0495663_0008327 3300046525 Bacteria 2872
355 Ga0495652_0131577 3300046529 Bacteria 1980
356 Ga0495665_0133607 3300046531 Bacteria 1299
357 Ga0495640_0413171 3300046533 Bacteria 827
358 Ga0495587_0327509 3300046536 Unclassified 855
359 Ga0495598_0032648 3300046537 Bacteria 1472
360 Ga0495598_0219254 3300046537 Unclassified 694
361 Ga0495609_0046792 3300046538 Bacteria 1937
362 Ga0495645_0041626 3300046543 Bacteria 3350
363 Ga0495645_0066483 3300046543 Bacteria 2605
364 Ga0495667_0109105 3300046559 Bacteria 1788
365 Ga0495667_0285112 3300046559 Bacteria 1048
366 Ga0495656_0054971 3300046615 Bacteria 1715
367 Ga0495656_0547057 3300046615 Bacteria 617
368 Ga0495659_0007092 3300046664 Bacteria 3546
369 Ga0495659_0024218 3300046664 Bacteria 2069
370 Ga0495659_0038588 3300046664 Unclassified 1696
371 Ga0495659_0042100 3300046664 Unclassified 1634
372 Ga0495659_0180412 3300046664 Bacteria 859
373 Ga0495661_0367022 3300046665 Bacteria 706
374 Ga0495588_0017272 3300046674 Bacteria 3500
375 Ga0495599_0082593 3300046678 Bacteria 2007
376 Ga0495658_0136777 3300046683 Bacteria 1495
377 Ga0495669_0162624 3300046684 Bacteria 1060
378 Ga0495613_0001676 3300046689 Bacteria 16870
379 Ga0495600_0015351 3300046809 Bacteria 4842
380 Ga0495600_0198427 3300046809 Bacteria 1289
381 Ga0495604_0095453 3300047317 Bacteria 2196
382 Ga0495636_0005448 3300047318 Bacteria 5001
383 Ga0495674_0750714 3300047319 Bacteria 762
384 Ga0495680_0300074 3300047322 Bacteria 1128
385 Ga0495680_0343761 3300047322 Bacteria 1040
386 Ga0495684_0004473 3300047471 Bacteria 10925
387 Ga0496103_0233730 3300048906 Bacteria 1183
388 Ga0496104_0474571 3300048907 Unclassified 1162
389 Ga0496104_0698889 3300048907 Bacteria 922
390 Ga0496105_0325659 3300048908 Unclassified 1231
391 Ga0496106_0226430 3300048909 Bacteria 1492
392 Ga0496108_0882858 3300048911 Bacteria 768
393 Ga0496109_0165339 3300048912 Unclassified 2074
394 Ga0496111_0492216 3300048914 Unclassified 903
395 Ga0496111_0946592 3300048914 Bacteria 619
396 Ga0496112_0041897 3300048915 Bacteria 4481
397 Ga0496112_0266526 3300048915 Unclassified 1662
398 Ga0496113_0045334 3300048916 Bacteria 3261
399 Ga0496114_0463471 3300048917 Bacteria 1122
400 Ga0501034_0061179 3300049571 Bacteria 3782
401 Ga0501067_0142233 3300049583 Bacteria 1336
402 Ga0501069_0285610 3300049585 Bacteria 966
403 Ga0501073_0324548 3300049589 Bacteria 1063
404 Ga0501074_0229406 3300049590 Bacteria 1322
405 Ga0501075_0120964 3300049591 Bacteria 1993
406 Ga0501076_0127957 3300049592 Bacteria 2059
407 Ga0501080_0103382 3300049742 Bacteria 2642
408 Ga0501081_0329239 3300049743 Bacteria 1124
409 Ga0501081_0754603 3300049743 Unclassified 731
410 nmdc:mga00v17_7255_c1 3300050491 Bacteria 5906
411 nmdc:mga0yw44_9572_c1 3300050492 Bacteria 4910
412 nmdc:mga0k408_128388_c1 3300050493 Unclassified 1504
413 nmdc:mga0k408_1695_c1 3300050493 Bacteria 11872
414 nmdc:mga04h51_94923_c1 3300050495 Bacteria 1079
415 nmdc:mga05p37_1985725_c1 3300050507 Unclassified 551
416 nmdc:mga05p37_26118_c2 3300050507 Bacteria 5344
417 nmdc:mga05p37_45007_c1 3300050507 Bacteria 5430
418 nmdc:mga05p37_57064_c1 3300050507 Bacteria 4809
419 nmdc:mga09592_168311_c1 3300050508 Bacteria 1894
420 nmdc:mga09592_258771_c1 3300050508 Unclassified 1509
421 nmdc:mga0qj67_97705_c1 3300050509 Bacteria 2365
422 nmdc:mga06r32_212702_c1 3300050510 Unclassified 1921
423 nmdc:mga08y16_152073_c1 3300050511 Bacteria 2405
424 nmdc:mga08y16_194262_c1 3300050511 Unclassified 2104
425 nmdc:mga08y16_311270_c1 3300050511 Bacteria 1622
426 nmdc:mga08y16_812_c1 3300050511 Bacteria 29900
427 nmdc:mga08y16_891429_c1 3300050511 Unclassified 876
428 nmdc:mga08y16_917611_c1 3300050511 Unclassified 861
429 nmdc:mga0n895_10701_c1 3300050512 Bacteria 8127
430 nmdc:mga0n895_275694_c1 3300050512 Bacteria 1706
431 nmdc:mga0n895_275721_c1 3300050512 Bacteria 1706
432 nmdc:mga0n895_35782_c1 3300050512 Bacteria 4790
433 nmdc:mga0n895_5870_c1 3300050512 Bacteria 10320
434 nmdc:mga0rr50_139803_c1 3300050513 Unclassified 1947
435 nmdc:mga0rr50_267473_c1 3300050513 Bacteria 1424
436 nmdc:mga0rr50_315045_c1 3300050513 Unclassified 1311
437 nmdc:mga0rr50_473387_c1 3300050513 Bacteria 1063
438 nmdc:mga0rr50_83924_c1 3300050513 Bacteria 2465
439 nmdc:mga08x19_143450_c1 3300050514 Bacteria 1614
440 nmdc:mga0a205_10970_c1 3300050515 Bacteria 8339
441 nmdc:mga0a205_276331_c1 3300050515 Bacteria 1556
442 nmdc:mga0a205_339073_c1 3300050515 Unclassified 1372
443 nmdc:mga0a205_4980_c1 3300050515 Bacteria 11949
444 nmdc:mga0a205_55615_c1 3300050515 Bacteria 3822
445 Ga0495601_0002903 3300053077 Bacteria 9751
446 Ga0495601_0483581 3300053077 Bacteria 800
447 Ga0495595_0042351 3300053084 Bacteria 2086
448 Ga0495619_0017607 3300053085 Bacteria 4526
449 Ga0495619_0311436 3300053085 Bacteria 1090
450 Ga0500592_002682 3300053116 Bacteria 2861
451 Ga0500628_050510 3300053129 Bacteria 985
452 Ga0075428_101014697
453 JGI24751J29686_10036993
454 Ga0065714_10201823
455 Ga0065712_10098726
456 Ga0065712_10181110
457 Ga0065712_10388775
458 Ga0065715_10091480
459 Ga0070683_100016796
460 Ga0070690_100203872
461 Ga0070690_100288712
462 Ga0070670_100020982
463 Ga0070670_100051080
464 Ga0070670_100433485
465 Ga0070670_101425887
466 Ga0070677_10023709
467 Ga0070677_10262542
468 Ga0070677_10546487
469 Ga0068869_100049062
470 Ga0070682_100760234
471 Ga0068868_100284616
472 Ga0070660_100254282
473 Ga0070689_100005396
474 Ga0070689_100021433
475 Ga0070689_100065174
476 Ga0070687_100147284
477 Ga0070687_100726498
478 Ga0070661_100348569
479 Ga0070661_100431221
480 Ga0070668_100204759
481 Ga0070669_100092205
482 Ga0070669_100543631
483 Ga0070675_100007486
484 Ga0070675_100043817
485 Ga0070675_100470757
486 Ga0070671_100322983
487 Ga0070671_100560740
488 Ga0070673_100017054
489 Ga0070673_100426541
490 Ga0070688_100016901
491 Ga0070688_100608971
492 Ga0070659_100053781
493 Ga0070659_100131860
494 Ga0070659_100245359
495 Ga0070667_100237568
496 Ga0070667_100251835
497 Ga0070667_100425504
498 Ga0070709_10958219
499 Ga0070713_100049727
500 Ga0070713_101408219
501 Ga0070701_10104602
502 Ga0070701_10109771
503 Ga0070711_100096785
504 Ga0070711_100278163
505 Ga0070705_100012891
506 Ga0070705_100024100
507 Ga0070705_100040743
508 Ga0070700_100050764
509 Ga0070700_100197133
510 Ga0070700_100622129
511 Ga0070700_100885227
512 Ga0070694_100003095
513 Ga0070694_100009660
514 Ga0070694_100053893
515 Ga0070694_100458075
516 Ga0070678_100496832
517 Ga0070662_100026352
518 Ga0070662_101099462
519 Ga0070681_10016477
520 Ga0070685_10045953
521 Ga0070706_100453551
522 Ga0070706_100742941
523 Ga0070706_100795020
524 Ga0070706_101376807
525 Ga0070707_100062138
526 Ga0070707_100085679
527 Ga0070698_100006640
528 Ga0070698_100641438
529 Ga0070698_100903592
530 Ga0070699_100008020
531 Ga0070699_100030464
532 Ga0070699_100619532
533 Ga0070679_100922225
534 Ga0070697_100008651
535 Ga0070697_100146632
536 Ga0070672_100017932
537 Ga0070672_100193928
538 Ga0070686_100025518
539 Ga0070686_100050062
540 Ga0070686_100191207
541 Ga0070695_100077297
542 Ga0070695_100123628
543 Ga0070696_100026633
544 Ga0070696_100061243
545 Ga0070693_100006290
546 Ga0070693_100190734
547 Ga0070693_100651686
548 Ga0070704_100000089
549 Ga0070704_100296012
550 Ga0070704_100439682
551 Ga0068855_100221088
552 Ga0070664_100224495
553 Ga0070664_100414476
554 Ga0070664_100472745
555 Ga0068857_100058235
556 Ga0068857_101142208
557 Ga0068854_100055804
558 Ga0068854_100103408
559 Ga0068854_100572289
560 Ga0068856_100333113
561 Ga0070702_100028454
562 Ga0070702_100043883
563 Ga0068859_100003496
564 Ga0068859_100137975
565 Ga0068859_100869451
566 Ga0068859_100912230
567 Ga0068859_101099984
568 Ga0068864_100024734
569 Ga0068864_100136312
570 Ga0068864_100224352
571 Ga0068864_100266026
572 Ga0068864_100269091
573 Ga0068861_100016764
574 Ga0068861_100133961
575 Ga0068870_10004468
576 Ga0068863_100299946
577 Ga0068863_100461326
578 Ga0068858_100162653
579 Ga0068860_100034523
580 Ga0068860_100099895
581 Ga0068860_100149979
582 Ga0068860_100404100
583 Ga0068862_100021428
584 Ga0068862_100315927
585 Ga0068862_100547343
586 Ga0068862_100710675
587 Ga0081455_10067754
588 Ga0081539_10081476
589 Ga0075365_10003186
590 Ga0075368_10044166
591 Ga0075364_10015007
592 Ga0075364_10039634
593 Ga0070715_10247759
594 Ga0070716_100373808
595 Ga0075367_10020998
596 Ga0075369_10082509
597 Ga0097621_100074334
598 Ga0097621_100291664
599 Ga0075370_10012462
600 Ga0068871_100160780
601 Ga0068871_100254152
602 Ga0075428_100009506
603 Ga0075428_100057506
604 Ga0075428_100585961
605 Ga0075430_100030740
606 Ga0075433_10001195
607 Ga0075433_10126457
608 Ga0075433_10208363
609 Ga0075433_10672045
610 Ga0075434_100011105
611 Ga0075434_100017244
612 Ga0075434_100042722
613 Ga0075434_100120419
614 Ga0075434_100546158
615 Ga0075429_100268222
616 Ga0075436_100069690
617 Ga0075436_100215210
618 Ga0097620_100003496
619 Ga0097620_100137972
620 Ga0097620_100869314
621 Ga0097620_100912401
622 Ga0097620_101100207
623 Ga0075435_100002425
624 Ga0075435_100053423
625 Ga0075435_100137085
626 Ga0075435_100152885
627 Ga0111539_10108155
628 Ga0111539_10156804
629 Ga0111539_10216666
630 Ga0111539_10219573
631 Ga0111539_10411305
632 Ga0111539_10597167
633 Ga0111539_11944643
634 Ga0105245_10213211
635 Ga0114129_10057730
636 Ga0114129_11619747
637 Ga0105243_10027210
638 Ga0105243_10094031
639 Ga0105243_10664703
640 Ga0105241_10090938
641 Ga0105242_10479390
642 Ga0105242_11685213
643 Ga0105248_10048869
644 Ga0105248_10353072
645 Ga0105248_10452819
646 Ga0105248_11057147
647 Ga0105238_10363317
648 Ga0105249_10001504
649 Ga0105249_10327636
650 Ga0105249_10758902
651 Ga0105249_11630016
652 Ga0157371_10888393
653 Ga0157378_10418175
654 Ga0163162_10372175
655 Ga0163162_10574196
656 Ga0157372_10244413
657 Ga0157372_11462549
658 Ga0157375_10016653
659 Ga0163163_10000001
660 Ga0163163_10383384
661 Ga0157380_10981989
662 Ga0157376_12799039
663 Ga0207653_10026799
664 Ga0207653_10288609
665 Ga0207680_10417253
666 Ga0207685_10192693
667 Ga0207699_10066807
668 Ga0207645_10016158
669 Ga0207643_10006990
670 Ga0207707_10022630
671 Ga0207707_10082554
672 Ga0207663_10446454
673 Ga0207660_10232475
674 Ga0207662_10006288
675 Ga0207662_10038022
676 Ga0207649_10157426
677 Ga0207652_10597794
678 Ga0207652_10759007
679 Ga0207646_10032271
680 Ga0207646_10067009
681 Ga0207681_10003170
682 Ga0207681_10323709
683 Ga0207650_10028588
684 Ga0207650_10073266
685 Ga0207650_10342457
686 Ga0207650_11366517
687 Ga0207659_10001272
688 Ga0207659_10011061
689 Ga0207659_10293691
690 Ga0207659_10445887
691 Ga0207687_10484826
692 Ga0207700_10027277
693 Ga0207700_11012501
694 Ga0207644_10008620
695 Ga0207690_10049702
696 Ga0207690_10201701
697 Ga0207690_10273696
698 Ga0207706_10006050
699 Ga0207706_10380498
700 Ga0207686_10135729
701 Ga0207709_10291278
702 Ga0207709_10527975
703 Ga0207709_10855074
704 Ga0207670_10002109
705 Ga0207670_10010102
706 Ga0207670_10019086
707 Ga0207669_10013371
708 Ga0207704_10022964
709 Ga0207691_10029747
710 Ga0207691_10081925
711 Ga0207711_10279061
712 Ga0207711_10727925
713 Ga0207689_10046288
714 Ga0207679_10173399
715 Ga0207679_10349784
716 Ga0207679_11094152
717 Ga0207651_10000712
718 Ga0207651_10491298
719 Ga0207712_10001523
720 Ga0207668_10313344
721 Ga0207640_10079136
722 Ga0207640_10899265
723 Ga0207703_10139630
724 Ga0207708_10022974
725 Ga0207708_10202063
726 Ga0207708_10407595
727 Ga0207702_10244035
728 Ga0207641_10591816
729 Ga0207641_11563780
730 Ga0207648_10013116
731 Ga0207676_10036931
732 Ga0207676_10058841
733 Ga0207676_11062866
734 Ga0207674_10033101
735 Ga0207674_10503649
736 Ga0207675_100002376
737 Ga0207675_100221178
738 Ga0207683_10465873
739 Ga0207683_10820379
740 Ga0209813_10079960
741 Ga0207428_10002283
742 Ga0207428_10162288
743 Ga0268265_10000135
744 Ga0268265_10521893
745 Ga0268265_10581675
746 Ga0268264_10023300
747 Ga0268264_10342776
748 Ga0268264_10379163
749 Ga0316576_10227021
750 Ga0307416_100097805
751 Ga0307416_101912368
752 Ga0316583_10069130
753 Ga0373958_0109375
754 Ga0373959_0078752
755 Ga0373934_0003832
756 Ga0373944_0004796
757 Ga0373945_0044004
758 Ga0373953_0029622
759 Ga0373953_0040532
760 Ga0373954_0181952
761 Ga0373954_0215582
762 Ga0373956_0090962
763 Ga0373956_0115342
764 Ga0373957_0003805
765 Ga0373946_0014128
766 Ga0373955_0004470
767 Ga0373955_0041886
768 Ga0373955_0055139
769 Ga0373955_0141274
770 Ga0373961_0035675
771 Ga0373924_0032443
772 Ga0373935_0080168
773 Ga0373935_0139125
774 Ga0373933_0002143
775 Ga0373947_0013719
776 Ga0373937_0000088
777 Ga0373937_0007516
778 Ga0373937_0163822
779 Ga0316582_0619045
780 Ga0373925_0003153
781 Ga0373925_0290034
782 Ga0373925_0844640
783 Ga0395905_0304745
784 Ga0436365_0580417
785 Ga0451853_1531392
786 Ga0439444_0014389
787 Ga0453683_0067310
788 Ga0453683_0095100
789 Ga0466957_0557876
790 Ga0451576_0003703
791 Ga0451576_0013861
792 Ga0451576_0014174
793 Ga0451576_0347927
794 Ga0451576_2320771
795 Ga0495603_0013780
796 Ga0495629_0525900
797 Ga0495651_0134069
798 Ga0495580_0202634
799 Ga0495664_0348944
800 Ga0495608_0023490
801 Ga0495608_0354563
802 Ga0495618_0213182
803 Ga0495630_0009709
804 Ga0495644_0131983
805 Ga0495663_0008327
806 Ga0495652_0131577
807 Ga0495665_0133607
808 Ga0495640_0413171
809 Ga0495587_0327509
810 Ga0495598_0032648
811 Ga0495598_0219254
812 Ga0495609_0046792
813 Ga0495645_0041626
814 Ga0495645_0066483
815 Ga0495667_0109105
816 Ga0495667_0285112
817 Ga0495656_0054971
818 Ga0495656_0547057
819 Ga0495659_0007092
820 Ga0495659_0024218
821 Ga0495659_0038588
822 Ga0495659_0042100
823 Ga0495659_0180412
824 Ga0495661_0367022
825 Ga0495588_0017272
826 Ga0495599_0082593
827 Ga0495658_0136777
828 Ga0495669_0162624
829 Ga0495613_0001676
830 Ga0495600_0015351
831 Ga0495600_0198427
832 Ga0495604_0095453
833 Ga0495636_0005448
834 Ga0495674_0750714
835 Ga0495680_0300074
836 Ga0495680_0343761
837 Ga0495684_0004473
838 Ga0496103_0233730
839 Ga0496104_0474571
840 Ga0496104_0698889
841 Ga0496105_0325659
842 Ga0496106_0226430
843 Ga0496108_0882858
844 Ga0496109_0165339
845 Ga0496111_0492216
846 Ga0496111_0946592
847 Ga0496112_0041897
848 Ga0496112_0266526
849 Ga0496113_0045334
850 Ga0496114_0463471
851 Ga0501034_0061179
852 Ga0501067_0142233
853 Ga0501069_0285610
854 Ga0501073_0324548
855 Ga0501074_0229406
856 Ga0501075_0120964
857 Ga0501076_0127957
858 Ga0501080_0103382
859 Ga0501081_0329239
860 Ga0501081_0754603
861 nmdc:mga00v17_7255_c1
862 nmdc:mga0yw44_9572_c1
863 nmdc:mga0k408_128388_c1
864 nmdc:mga0k408_1695_c1
865 nmdc:mga04h51_94923_c1
866 nmdc:mga05p37_1985725_c1
867 nmdc:mga05p37_26118_c2
868 nmdc:mga05p37_45007_c1
869 nmdc:mga05p37_57064_c1
870 nmdc:mga09592_168311_c1
871 nmdc:mga09592_258771_c1
872 nmdc:mga0qj67_97705_c1
873 nmdc:mga06r32_212702_c1
874 nmdc:mga08y16_152073_c1
875 nmdc:mga08y16_194262_c1
876 nmdc:mga08y16_311270_c1
877 nmdc:mga08y16_812_c1
878 nmdc:mga08y16_891429_c1
879 nmdc:mga08y16_917611_c1
880 nmdc:mga0n895_10701_c1
881 nmdc:mga0n895_275694_c1
882 nmdc:mga0n895_275721_c1
883 nmdc:mga0n895_35782_c1
884 nmdc:mga0n895_5870_c1
885 nmdc:mga0rr50_139803_c1
886 nmdc:mga0rr50_267473_c1
887 nmdc:mga0rr50_315045_c1
888 nmdc:mga0rr50_473387_c1
889 nmdc:mga0rr50_83924_c1
890 nmdc:mga08x19_143450_c1
891 nmdc:mga0a205_10970_c1
892 nmdc:mga0a205_276331_c1
893 nmdc:mga0a205_339073_c1
894 nmdc:mga0a205_4980_c1
895 nmdc:mga0a205_55615_c1
896 Ga0495601_0002903
897 Ga0495601_0483581
898 Ga0495595_0042351
899 Ga0495619_0017607
900 Ga0495619_0311436
901 Ga0500592_002682
902 Ga0500628_050510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

23

149

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.9139 4 141
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.8709 4 157
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.8709 4 141
2b7l-assembly2.cif.gz_D crystal structure of ctp:glycerol-3-phosphate cytidylyltransferase from staphylococcus aureus 0.8657 23 139
1n1d-assembly1.cif.gz_A glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol 0.8523 23 152
ID Description Score Start End Superfamily
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9483 4 155 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.874 23 152 3.40.50.620
2b7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8657 23 139 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.855 23 152 3.40.50.620
3glvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8482 22 142 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A537JR55-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase 0.9883 4 135 GO:0009058
GO:0016779
AF-A0A7C0ZCX4-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase 0.9865 4 136 GO:0009058
GO:0016779
AF-A0A529L1G2-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) 0.9846 3 138 GO:0005524
GO:0005975
GO:0009058
GO:0016773
GO:0016779
AF-A0A3D5R541-F1-model_v4 Cytidyltransferase-like domain-containing protein 0.9845 1 132 GO:0003824
GO:0009058
AF-A0A359DXJ0-F1-model_v4 deleted 0.9845 4 118

Map