F446742
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 451 | 210 | 451 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10380064|Ga0070681_103800642 |
| Length | 162 |
| Sequence | MPTTSAPPLAPRLRFAVTRTARRLRQEAGGGLSPTLNAALATVAGHGPLTPSELAARERIQRPTATRLIAKLEADGLVARTADPADGRSFLIAATADGAALIQELRTRKDAFLAARLRRLPSEDRAVLARAAELLEDLLEGDQEGPEAQRRDRGAGPDASRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 127 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 128 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 132 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 133 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 134 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 135 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 137 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 140 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 141 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 142 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 143 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 144 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 145 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 146 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 147 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 167 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 173 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 179 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 210 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 11.09 |
| Rhizosphere | 88.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10101872 | 3300003203 | Bacteria | 856 |
| 2 | Ga0070683_100106867 | 3300005329 | Bacteria | 2639 |
| 3 | Ga0070683_100110024 | 3300005329 | Bacteria | 2599 |
| 4 | Ga0070683_100361980 | 3300005329 | Bacteria | 1381 |
| 5 | Ga0070683_100653440 | 3300005329 | Bacteria | 1007 |
| 6 | Ga0070683_101059449 | 3300005329 | Unclassified | 779 |
| 7 | Ga0070683_101934758 | 3300005329 | Bacteria | 567 |
| 8 | Ga0070690_100738624 | 3300005330 | Bacteria | 759 |
| 9 | Ga0070690_100783733 | 3300005330 | Unclassified | 738 |
| 10 | Ga0070670_101148865 | 3300005331 | Bacteria | 709 |
| 11 | Ga0068869_100774947 | 3300005334 | Unclassified | 823 |
| 12 | Ga0070682_100788644 | 3300005337 | Bacteria | 771 |
| 13 | Ga0070682_100990374 | 3300005337 | Unclassified | 697 |
| 14 | Ga0070682_102035170 | 3300005337 | Unclassified | 506 |
| 15 | Ga0068868_100094092 | 3300005338 | Bacteria | 2417 |
| 16 | Ga0068868_100096874 | 3300005338 | Bacteria | 2383 |
| 17 | Ga0068868_100332177 | 3300005338 | Bacteria | 1298 |
| 18 | Ga0068868_100410242 | 3300005338 | Bacteria | 1171 |
| 19 | Ga0068868_101052727 | 3300005338 | Bacteria | 747 |
| 20 | Ga0070660_100080791 | 3300005339 | Bacteria | 2552 |
| 21 | Ga0070691_10589603 | 3300005341 | Unclassified | 655 |
| 22 | Ga0070687_100070541 | 3300005343 | Bacteria | 1875 |
| 23 | Ga0070687_100116308 | 3300005343 | Unclassified | 1522 |
| 24 | Ga0070661_100443551 | 3300005344 | Bacteria | 1032 |
| 25 | Ga0070661_100503410 | 3300005344 | Bacteria | 970 |
| 26 | Ga0070692_10028758 | 3300005345 | Unclassified | 2765 |
| 27 | Ga0070692_11031675 | 3300005345 | Unclassified | 577 |
| 28 | Ga0070675_100484490 | 3300005354 | Unclassified | 1113 |
| 29 | Ga0070675_102169449 | 3300005354 | Unclassified | 512 |
| 30 | Ga0070674_101246057 | 3300005356 | Bacteria | 662 |
| 31 | Ga0070673_101622855 | 3300005364 | Bacteria | 611 |
| 32 | Ga0070673_102059069 | 3300005364 | Bacteria | 542 |
| 33 | Ga0070659_100479572 | 3300005366 | Bacteria | 1058 |
| 34 | Ga0070667_100428579 | 3300005367 | Bacteria | 1206 |
| 35 | Ga0070667_100467606 | 3300005367 | Bacteria | 1153 |
| 36 | Ga0070667_101779089 | 3300005367 | Bacteria | 580 |
| 37 | Ga0070701_10041840 | 3300005438 | Bacteria | 2336 |
| 38 | Ga0070701_10850908 | 3300005438 | Bacteria | 626 |
| 39 | Ga0070705_100300943 | 3300005440 | Unclassified | 1149 |
| 40 | Ga0070700_100077271 | 3300005441 | Bacteria | 2140 |
| 41 | Ga0070700_101297645 | 3300005441 | Bacteria | 612 |
| 42 | Ga0070694_100018268 | 3300005444 | Bacteria | 4449 |
| 43 | Ga0070694_100179976 | 3300005444 | Bacteria | 1563 |
| 44 | Ga0070708_100979409 | 3300005445 | Bacteria | 793 |
| 45 | Ga0070663_100121582 | 3300005455 | Bacteria | 1973 |
| 46 | Ga0070663_100573403 | 3300005455 | Bacteria | 946 |
| 47 | Ga0070663_100629611 | 3300005455 | Bacteria | 905 |
| 48 | Ga0070678_100327437 | 3300005456 | Bacteria | 1310 |
| 49 | Ga0070678_100469907 | 3300005456 | Bacteria | 1105 |
| 50 | Ga0070662_100874358 | 3300005457 | Unclassified | 766 |
| 51 | Ga0070681_10380064 | 3300005458 | Bacteria | 1323 |
| 52 | Ga0068867_100143935 | 3300005459 | Bacteria | 1866 |
| 53 | Ga0068867_100565513 | 3300005459 | Bacteria | 987 |
| 54 | Ga0070685_10081978 | 3300005466 | Bacteria | 1935 |
| 55 | Ga0070679_101266977 | 3300005530 | Bacteria | 683 |
| 56 | Ga0070684_100151401 | 3300005535 | Bacteria | 2102 |
| 57 | Ga0070684_100161488 | 3300005535 | Archaea | 2033 |
| 58 | Ga0070684_100262933 | 3300005535 | Bacteria | 1578 |
| 59 | Ga0070684_100401289 | 3300005535 | Unclassified | 1264 |
| 60 | Ga0070684_100802457 | 3300005535 | Unclassified | 880 |
| 61 | Ga0070684_100818948 | 3300005535 | Bacteria | 871 |
| 62 | Ga0070684_100920004 | 3300005535 | Bacteria | 820 |
| 63 | Ga0070684_101441661 | 3300005535 | Unclassified | 649 |
| 64 | Ga0068853_100174425 | 3300005539 | Unclassified | 1947 |
| 65 | Ga0068853_101940462 | 3300005539 | Unclassified | 571 |
| 66 | Ga0070672_100157140 | 3300005543 | Bacteria | 1884 |
| 67 | Ga0070686_100593692 | 3300005544 | Bacteria | 872 |
| 68 | Ga0070686_100757415 | 3300005544 | Bacteria | 779 |
| 69 | Ga0070686_100874943 | 3300005544 | Bacteria | 729 |
| 70 | Ga0070686_101184314 | 3300005544 | Bacteria | 634 |
| 71 | Ga0070686_101349224 | 3300005544 | Bacteria | 597 |
| 72 | Ga0070696_100763304 | 3300005546 | Bacteria | 793 |
| 73 | Ga0070696_101300182 | 3300005546 | Bacteria | 617 |
| 74 | Ga0070693_100546744 | 3300005547 | Bacteria | 828 |
| 75 | Ga0070665_100193554 | 3300005548 | Bacteria | 2034 |
| 76 | Ga0070665_100445902 | 3300005548 | Bacteria | 1304 |
| 77 | Ga0070665_101038099 | 3300005548 | Bacteria | 832 |
| 78 | Ga0070704_100022917 | 3300005549 | Bacteria | 4069 |
| 79 | Ga0070704_101171106 | 3300005549 | Bacteria | 700 |
| 80 | Ga0068855_100362868 | 3300005563 | Bacteria | 1594 |
| 81 | Ga0070664_100758021 | 3300005564 | Bacteria | 906 |
| 82 | Ga0070664_101528933 | 3300005564 | Bacteria | 632 |
| 83 | Ga0070664_101905170 | 3300005564 | Bacteria | 564 |
| 84 | Ga0068857_100119224 | 3300005577 | Bacteria | 2375 |
| 85 | Ga0068857_100219273 | 3300005577 | Bacteria | 1737 |
| 86 | Ga0068857_101392164 | 3300005577 | Bacteria | 682 |
| 87 | Ga0068856_100260586 | 3300005614 | Bacteria | 1749 |
| 88 | Ga0068856_100277488 | 3300005614 | Bacteria | 1692 |
| 89 | Ga0068856_100512733 | 3300005614 | Bacteria | 1220 |
| 90 | Ga0070702_100014950 | 3300005615 | Bacteria | 3950 |
| 91 | Ga0070702_100404069 | 3300005615 | Bacteria | 978 |
| 92 | Ga0068852_100128722 | 3300005616 | Bacteria | 2329 |
| 93 | Ga0068852_101374807 | 3300005616 | Bacteria | 728 |
| 94 | Ga0068859_100239550 | 3300005617 | Bacteria | 1903 |
| 95 | Ga0068859_101220706 | 3300005617 | Bacteria | 828 |
| 96 | Ga0068859_101739011 | 3300005617 | Bacteria | 689 |
| 97 | Ga0068864_100189013 | 3300005618 | Bacteria | 1887 |
| 98 | Ga0068864_100327500 | 3300005618 | Bacteria | 1440 |
| 99 | Ga0068864_100385016 | 3300005618 | Bacteria | 1330 |
| 100 | Ga0068864_100448824 | 3300005618 | Bacteria | 1233 |
| 101 | Ga0068866_11064974 | 3300005718 | Bacteria | 578 |
| 102 | Ga0068861_102539909 | 3300005719 | Unclassified | 516 |
| 103 | Ga0068851_10884872 | 3300005834 | Bacteria | 559 |
| 104 | Ga0068863_100570794 | 3300005841 | Bacteria | 1118 |
| 105 | Ga0068863_100630084 | 3300005841 | Bacteria | 1063 |
| 106 | Ga0068858_100359236 | 3300005842 | Bacteria | 1396 |
| 107 | Ga0068858_100458532 | 3300005842 | Bacteria | 1229 |
| 108 | Ga0068860_100052827 | 3300005843 | Bacteria | 3864 |
| 109 | Ga0068862_100204669 | 3300005844 | Bacteria | 1781 |
| 110 | Ga0068862_100357853 | 3300005844 | Bacteria | 1356 |
| 111 | Ga0081455_10038969 | 3300005937 | Bacteria | 4204 |
| 112 | Ga0081455_10112345 | 3300005937 | Bacteria | 2162 |
| 113 | Ga0081455_10211304 | 3300005937 | Bacteria | 1445 |
| 114 | Ga0081538_10010378 | 3300005981 | Bacteria | 7637 |
| 115 | Ga0081538_10042074 | 3300005981 | Bacteria | 2889 |
| 116 | Ga0081538_10128134 | 3300005981 | Bacteria | 1200 |
| 117 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 118 | Ga0081539_10030265 | 3300005985 | Bacteria | 3365 |
| 119 | Ga0075365_10724305 | 3300006038 | Bacteria | 702 |
| 120 | Ga0097621_102244562 | 3300006237 | Bacteria | 522 |
| 121 | Ga0068871_101036507 | 3300006358 | Bacteria | 765 |
| 122 | Ga0075434_101501561 | 3300006871 | Unclassified | 683 |
| 123 | Ga0075429_101241438 | 3300006880 | Bacteria | 650 |
| 124 | Ga0068865_100347783 | 3300006881 | Unclassified | 1200 |
| 125 | Ga0068865_100544614 | 3300006881 | Unclassified | 974 |
| 126 | Ga0068865_100934468 | 3300006881 | Bacteria | 756 |
| 127 | Ga0068865_100977575 | 3300006881 | Bacteria | 740 |
| 128 | Ga0097620_100239532 | 3300006931 | Bacteria | 1903 |
| 129 | Ga0097620_101220763 | 3300006931 | Bacteria | 828 |
| 130 | Ga0097620_101739083 | 3300006931 | Bacteria | 689 |
| 131 | Ga0111539_10272865 | 3300009094 | Bacteria | 1968 |
| 132 | Ga0111539_10431620 | 3300009094 | Bacteria | 1534 |
| 133 | Ga0105245_10142928 | 3300009098 | Bacteria | 2255 |
| 134 | Ga0105245_10272739 | 3300009098 | Bacteria | 1650 |
| 135 | Ga0105245_10540138 | 3300009098 | Bacteria | 1187 |
| 136 | Ga0105245_10743675 | 3300009098 | Bacteria | 1016 |
| 137 | Ga0105245_10821878 | 3300009098 | Bacteria | 968 |
| 138 | Ga0105245_11879451 | 3300009098 | Unclassified | 652 |
| 139 | Ga0105245_12361527 | 3300009098 | Unclassified | 585 |
| 140 | Ga0114129_10731041 | 3300009147 | Unclassified | 1269 |
| 141 | Ga0105243_10057894 | 3300009148 | Bacteria | 3087 |
| 142 | Ga0105243_10190339 | 3300009148 | Bacteria | 1792 |
| 143 | Ga0105243_10212892 | 3300009148 | Unclassified | 1703 |
| 144 | Ga0105243_10364474 | 3300009148 | Bacteria | 1331 |
| 145 | Ga0105243_12393126 | 3300009148 | Bacteria | 566 |
| 146 | Ga0105242_10868899 | 3300009176 | Bacteria | 899 |
| 147 | Ga0105242_13235296 | 3300009176 | Bacteria | 506 |
| 148 | Ga0105248_10596890 | 3300009177 | Unclassified | 1246 |
| 149 | Ga0105249_10021190 | 3300009553 | Bacteria | 5819 |
| 150 | Ga0105249_10508550 | 3300009553 | Bacteria | 1251 |
| 151 | Ga0105249_10912239 | 3300009553 | Bacteria | 946 |
| 152 | Ga0105249_11709649 | 3300009553 | Bacteria | 702 |
| 153 | Ga0105239_10436047 | 3300010375 | Bacteria | 1485 |
| 154 | Ga0105239_11096772 | 3300010375 | Unclassified | 916 |
| 155 | Ga0105246_10214180 | 3300011119 | Bacteria | 1505 |
| 156 | Ga0105246_10409376 | 3300011119 | Bacteria | 1128 |
| 157 | Ga0105246_11237194 | 3300011119 | Bacteria | 689 |
| 158 | Ga0105246_11673274 | 3300011119 | Bacteria | 604 |
| 159 | Ga0157369_10395982 | 3300013105 | Bacteria | 1433 |
| 160 | Ga0157369_10820974 | 3300013105 | Bacteria | 955 |
| 161 | Ga0157369_12497275 | 3300013105 | Bacteria | 523 |
| 162 | Ga0157374_10279147 | 3300013296 | Bacteria | 1649 |
| 163 | Ga0163162_10283293 | 3300013306 | Bacteria | 1789 |
| 164 | Ga0163162_10374360 | 3300013306 | Bacteria | 1557 |
| 165 | Ga0157375_10012714 | 3300013308 | Bacteria | 7470 |
| 166 | Ga0157375_11667960 | 3300013308 | Unclassified | 754 |
| 167 | Ga0157380_11188470 | 3300014326 | Bacteria | 806 |
| 168 | Ga0182008_10219942 | 3300014497 | Unclassified | 971 |
| 169 | Ga0157377_10071222 | 3300014745 | Bacteria | 2010 |
| 170 | Ga0157377_10105779 | 3300014745 | Bacteria | 1684 |
| 171 | Ga0157377_10131947 | 3300014745 | Bacteria | 1527 |
| 172 | Ga0157377_10176431 | 3300014745 | Bacteria | 1340 |
| 173 | Ga0157377_10183759 | 3300014745 | Bacteria | 1317 |
| 174 | Ga0157377_10562862 | 3300014745 | Bacteria | 807 |
| 175 | Ga0157379_10672635 | 3300014968 | Bacteria | 970 |
| 176 | Ga0157376_10094985 | 3300014969 | Bacteria | 2592 |
| 177 | Ga0206353_10709368 | 3300020082 | Bacteria | 1385 |
| 178 | Ga0207642_10512148 | 3300025899 | Bacteria | 736 |
| 179 | Ga0207688_10285213 | 3300025901 | Bacteria | 1007 |
| 180 | Ga0207688_10335933 | 3300025901 | Bacteria | 929 |
| 181 | Ga0207647_10178069 | 3300025904 | Bacteria | 1236 |
| 182 | Ga0207705_10796867 | 3300025909 | Unclassified | 733 |
| 183 | Ga0207707_10306328 | 3300025912 | Bacteria | 1373 |
| 184 | Ga0207662_10136766 | 3300025918 | Unclassified | 1549 |
| 185 | Ga0207662_10142067 | 3300025918 | Bacteria | 1521 |
| 186 | Ga0207662_10361868 | 3300025918 | Bacteria | 976 |
| 187 | Ga0207652_10094906 | 3300025921 | Bacteria | 2627 |
| 188 | Ga0207652_10767594 | 3300025921 | Bacteria | 857 |
| 189 | Ga0207659_10476576 | 3300025926 | Unclassified | 1054 |
| 190 | Ga0207659_11675838 | 3300025926 | Unclassified | 542 |
| 191 | Ga0207687_11455129 | 3300025927 | Bacteria | 589 |
| 192 | Ga0207690_10192990 | 3300025932 | Bacteria | 1541 |
| 193 | Ga0207690_11072754 | 3300025932 | Bacteria | 671 |
| 194 | Ga0207690_11182603 | 3300025932 | Unclassified | 638 |
| 195 | Ga0207706_10030475 | 3300025933 | Bacteria | 4811 |
| 196 | Ga0207706_10248668 | 3300025933 | Bacteria | 1554 |
| 197 | Ga0207706_10406503 | 3300025933 | Bacteria | 1180 |
| 198 | Ga0207686_11039344 | 3300025934 | Unclassified | 666 |
| 199 | Ga0207709_10081822 | 3300025935 | Bacteria | 2083 |
| 200 | Ga0207709_10094195 | 3300025935 | Bacteria | 1965 |
| 201 | Ga0207709_10214647 | 3300025935 | Bacteria | 1383 |
| 202 | Ga0207709_10273776 | 3300025935 | Bacteria | 1244 |
| 203 | Ga0207709_10305093 | 3300025935 | Bacteria | 1185 |
| 204 | Ga0207669_10895315 | 3300025937 | Bacteria | 741 |
| 205 | Ga0207669_11618762 | 3300025937 | Bacteria | 553 |
| 206 | Ga0207704_10339116 | 3300025938 | Unclassified | 1166 |
| 207 | Ga0207665_10802963 | 3300025939 | Bacteria | 744 |
| 208 | Ga0207691_10259478 | 3300025940 | Bacteria | 1498 |
| 209 | Ga0207661_10042152 | 3300025944 | Bacteria | 3598 |
| 210 | Ga0207661_10149318 | 3300025944 | Bacteria | 2019 |
| 211 | Ga0207661_10207608 | 3300025944 | Bacteria | 1725 |
| 212 | Ga0207661_11410186 | 3300025944 | Unclassified | 639 |
| 213 | Ga0207679_10172974 | 3300025945 | Bacteria | 1780 |
| 214 | Ga0207679_10359717 | 3300025945 | Bacteria | 1271 |
| 215 | Ga0207679_10581835 | 3300025945 | Unclassified | 1007 |
| 216 | Ga0207651_10239140 | 3300025960 | Bacteria | 1479 |
| 217 | Ga0207651_10652633 | 3300025960 | Bacteria | 924 |
| 218 | Ga0207651_10876359 | 3300025960 | Bacteria | 799 |
| 219 | Ga0207712_10336708 | 3300025961 | Bacteria | 1250 |
| 220 | Ga0207712_10542976 | 3300025961 | Bacteria | 999 |
| 221 | Ga0207712_11580865 | 3300025961 | Bacteria | 588 |
| 222 | Ga0207640_10436941 | 3300025981 | Bacteria | 1075 |
| 223 | Ga0207658_10257015 | 3300025986 | Bacteria | 1487 |
| 224 | Ga0207658_10914353 | 3300025986 | Bacteria | 799 |
| 225 | Ga0207677_10072272 | 3300026023 | Bacteria | 2438 |
| 226 | Ga0207677_10730221 | 3300026023 | Bacteria | 881 |
| 227 | Ga0207677_11368661 | 3300026023 | Bacteria | 651 |
| 228 | Ga0207703_10263013 | 3300026035 | Bacteria | 1560 |
| 229 | Ga0207703_11616416 | 3300026035 | Unclassified | 623 |
| 230 | Ga0207703_11703626 | 3300026035 | Unclassified | 606 |
| 231 | Ga0207703_11975853 | 3300026035 | Unclassified | 559 |
| 232 | Ga0207678_10461549 | 3300026067 | Unclassified | 1105 |
| 233 | Ga0207678_10582900 | 3300026067 | Bacteria | 980 |
| 234 | Ga0207678_11357019 | 3300026067 | Bacteria | 629 |
| 235 | Ga0207708_10226863 | 3300026075 | Bacteria | 1498 |
| 236 | Ga0207708_10702192 | 3300026075 | Bacteria | 865 |
| 237 | Ga0207702_10172480 | 3300026078 | Bacteria | 1985 |
| 238 | Ga0207702_10446161 | 3300026078 | Bacteria | 1255 |
| 239 | Ga0207702_10551470 | 3300026078 | Bacteria | 1127 |
| 240 | Ga0207641_10328123 | 3300026088 | Bacteria | 1453 |
| 241 | Ga0207641_10640256 | 3300026088 | Bacteria | 1044 |
| 242 | Ga0207648_10345146 | 3300026089 | Bacteria | 1341 |
| 243 | Ga0207676_10060920 | 3300026095 | Bacteria | 2987 |
| 244 | Ga0207676_10128359 | 3300026095 | Bacteria | 2152 |
| 245 | Ga0207676_10262578 | 3300026095 | Bacteria | 1560 |
| 246 | Ga0207676_10914816 | 3300026095 | Bacteria | 861 |
| 247 | Ga0207676_12218689 | 3300026095 | Bacteria | 547 |
| 248 | Ga0207674_10312258 | 3300026116 | Bacteria | 1521 |
| 249 | Ga0207674_10751461 | 3300026116 | Bacteria | 941 |
| 250 | Ga0207675_100096903 | 3300026118 | Bacteria | 2777 |
| 251 | Ga0207675_100414125 | 3300026118 | Bacteria | 1330 |
| 252 | Ga0207675_100770609 | 3300026118 | Bacteria | 974 |
| 253 | Ga0207675_101592500 | 3300026118 | Bacteria | 674 |
| 254 | Ga0207683_10012992 | 3300026121 | Bacteria | 7108 |
| 255 | Ga0207683_10368952 | 3300026121 | Bacteria | 1319 |
| 256 | Ga0207683_10393444 | 3300026121 | Bacteria | 1274 |
| 257 | Ga0207698_10290471 | 3300026142 | Bacteria | 1517 |
| 258 | Ga0207698_10779290 | 3300026142 | Bacteria | 957 |
| 259 | Ga0207698_10990098 | 3300026142 | Unclassified | 851 |
| 260 | Ga0207698_11641544 | 3300026142 | Bacteria | 658 |
| 261 | Ga0207698_12034588 | 3300026142 | Bacteria | 588 |
| 262 | Ga0207428_10124064 | 3300027907 | Bacteria | 1978 |
| 263 | Ga0268266_10226284 | 3300028379 | Bacteria | 1721 |
| 264 | Ga0268266_10394743 | 3300028379 | Bacteria | 1307 |
| 265 | Ga0268265_10351098 | 3300028380 | Bacteria | 1347 |
| 266 | Ga0268265_11358841 | 3300028380 | Bacteria | 712 |
| 267 | Ga0268264_10120710 | 3300028381 | Bacteria | 2309 |
| 268 | Ga0307408_101022563 | 3300031548 | Bacteria | 763 |
| 269 | Ga0307405_10128068 | 3300031731 | Bacteria | 1749 |
| 270 | Ga0307405_11875699 | 3300031731 | Bacteria | 534 |
| 271 | Ga0307413_10149416 | 3300031824 | Bacteria | 1626 |
| 272 | Ga0307410_10036790 | 3300031852 | Bacteria | 3191 |
| 273 | Ga0307410_10316886 | 3300031852 | Bacteria | 1236 |
| 274 | Ga0307406_10029453 | 3300031901 | Bacteria | 3325 |
| 275 | Ga0307406_10411712 | 3300031901 | Bacteria | 1075 |
| 276 | Ga0307406_10427822 | 3300031901 | Bacteria | 1056 |
| 277 | Ga0307406_10461235 | 3300031901 | Unclassified | 1022 |
| 278 | Ga0307406_11462457 | 3300031901 | Bacteria | 600 |
| 279 | Ga0307407_10043949 | 3300031903 | Bacteria | 2515 |
| 280 | Ga0307407_10069290 | 3300031903 | Bacteria | 2093 |
| 281 | Ga0307407_10384351 | 3300031903 | Bacteria | 1003 |
| 282 | Ga0307412_10121551 | 3300031911 | Bacteria | 1881 |
| 283 | Ga0307412_10678734 | 3300031911 | Bacteria | 882 |
| 284 | Ga0307409_100020771 | 3300031995 | Bacteria | 4484 |
| 285 | Ga0307409_100053464 | 3300031995 | Bacteria | 3103 |
| 286 | Ga0307409_100465476 | 3300031995 | Bacteria | 1223 |
| 287 | Ga0307409_100596051 | 3300031995 | Bacteria | 1091 |
| 288 | Ga0307409_100916605 | 3300031995 | Bacteria | 891 |
| 289 | Ga0307416_100076056 | 3300032002 | Bacteria | 2812 |
| 290 | Ga0307416_103545784 | 3300032002 | Bacteria | 522 |
| 291 | Ga0307414_10093484 | 3300032004 | Bacteria | 2242 |
| 292 | Ga0307411_10137461 | 3300032005 | Bacteria | 1797 |
| 293 | Ga0307411_10208029 | 3300032005 | Bacteria | 1508 |
| 294 | Ga0307411_10511917 | 3300032005 | Bacteria | 1017 |
| 295 | Ga0307411_11471289 | 3300032005 | Bacteria | 625 |
| 296 | Ga0307415_100004172 | 3300032126 | Bacteria | 7458 |
| 297 | Ga0307415_100025264 | 3300032126 | Bacteria | 3724 |
| 298 | Ga0307415_100110453 | 3300032126 | Bacteria | 2039 |
| 299 | Ga0307415_100220051 | 3300032126 | Bacteria | 1521 |
| 300 | Ga0307415_100285887 | 3300032126 | Bacteria | 1359 |
| 301 | Ga0307415_101110287 | 3300032126 | Bacteria | 741 |
| 302 | Ga0373944_0210051 | 3300035089 | Bacteria | 707 |
| 303 | Ga0373945_0124707 | 3300035116 | Bacteria | 1027 |
| 304 | Ga0373946_0311956 | 3300035171 | Bacteria | 780 |
| 305 | Ga0373947_0130354 | 3300035725 | Bacteria | 1605 |
| 306 | Ga0373947_0187436 | 3300035725 | Bacteria | 1349 |
| 307 | Ga0373925_0082477 | 3300037068 | Bacteria | 2447 |
| 308 | Ga0439448_0146369 | 3300042005 | Bacteria | 819 |
| 309 | Ga0466966_0195557 | 3300044684 | Bacteria | 1224 |
| 310 | Ga0466966_0289227 | 3300044684 | Bacteria | 985 |
| 311 | Ga0466961_0809079 | 3300044693 | Unclassified | 559 |
| 312 | Ga0466964_0081614 | 3300044706 | Bacteria | 1389 |
| 313 | Ga0466964_0383600 | 3300044706 | Bacteria | 730 |
| 314 | Ga0466970_0915480 | 3300044765 | Bacteria | 516 |
| 315 | Ga0466957_0024325 | 3300044842 | Bacteria | 3583 |
| 316 | Ga0466960_0308830 | 3300044901 | Bacteria | 893 |
| 317 | Ga0466960_0491501 | 3300044901 | Unclassified | 718 |
| 318 | Ga0466967_0004123 | 3300045976 | Bacteria | 9710 |
| 319 | Ga0466967_0004558 | 3300045976 | Bacteria | 9382 |
| 320 | Ga0466967_0253973 | 3300045976 | Bacteria | 1680 |
| 321 | Ga0466967_0287187 | 3300045976 | Bacteria | 1579 |
| 322 | Ga0466967_0654749 | 3300045976 | Bacteria | 1039 |
| 323 | Ga0466967_0896065 | 3300045976 | Bacteria | 882 |
| 324 | Ga0466967_1708066 | 3300045976 | Bacteria | 627 |
| 325 | Ga0466967_2160359 | 3300045976 | Bacteria | 553 |
| 326 | Ga0495603_0266962 | 3300046455 | Bacteria | 985 |
| 327 | Ga0495590_0326072 | 3300046457 | Bacteria | 581 |
| 328 | Ga0495629_0237333 | 3300046459 | Bacteria | 1256 |
| 329 | Ga0495582_0145619 | 3300046473 | Bacteria | 1344 |
| 330 | Ga0495606_0351789 | 3300046507 | Bacteria | 782 |
| 331 | Ga0495618_0252180 | 3300046514 | Bacteria | 1107 |
| 332 | Ga0495620_0161640 | 3300046515 | Bacteria | 870 |
| 333 | Ga0495631_0046374 | 3300046518 | Bacteria | 1911 |
| 334 | Ga0495631_0309704 | 3300046518 | Bacteria | 672 |
| 335 | Ga0495631_0520187 | 3300046518 | Bacteria | 507 |
| 336 | Ga0495644_0293371 | 3300046523 | Bacteria | 636 |
| 337 | Ga0495640_0133783 | 3300046533 | Bacteria | 1603 |
| 338 | Ga0495597_0365612 | 3300046542 | Bacteria | 552 |
| 339 | Ga0495633_0350242 | 3300046558 | Bacteria | 669 |
| 340 | Ga0495668_0178981 | 3300046616 | Bacteria | 1162 |
| 341 | Ga0495661_0379985 | 3300046665 | Bacteria | 690 |
| 342 | Ga0495674_0818306 | 3300047319 | Bacteria | 723 |
| 343 | Ga0495683_0218882 | 3300047323 | Bacteria | 850 |
| 344 | Ga0496100_0196691 | 3300048903 | Bacteria | 1467 |
| 345 | Ga0496100_0299483 | 3300048903 | Bacteria | 1203 |
| 346 | Ga0496100_0462285 | 3300048903 | Bacteria | 974 |
| 347 | Ga0496100_0689682 | 3300048903 | Bacteria | 797 |
| 348 | Ga0496101_0003399 | 3300048904 | Bacteria | 9929 |
| 349 | Ga0496102_0048761 | 3300048905 | Bacteria | 3851 |
| 350 | Ga0496102_0366172 | 3300048905 | Bacteria | 1357 |
| 351 | Ga0496104_0862775 | 3300048907 | Bacteria | 810 |
| 352 | Ga0496104_1264076 | 3300048907 | Unclassified | 641 |
| 353 | Ga0496105_0045379 | 3300048908 | Bacteria | 3626 |
| 354 | Ga0496105_0069852 | 3300048908 | Bacteria | 2903 |
| 355 | Ga0496105_0103470 | 3300048908 | Bacteria | 2351 |
| 356 | Ga0496105_1250364 | 3300048908 | Bacteria | 544 |
| 357 | Ga0496106_0034631 | 3300048909 | Bacteria | 3772 |
| 358 | Ga0496106_0056624 | 3300048909 | Bacteria | 2964 |
| 359 | Ga0496106_0172868 | 3300048909 | Bacteria | 1713 |
| 360 | Ga0496106_0273060 | 3300048909 | Bacteria | 1354 |
| 361 | Ga0496106_0482087 | 3300048909 | Bacteria | 996 |
| 362 | Ga0496107_0001173 | 3300048910 | Bacteria | 15902 |
| 363 | Ga0496108_0007985 | 3300048911 | Bacteria | 8584 |
| 364 | Ga0496108_0029165 | 3300048911 | Bacteria | 4568 |
| 365 | Ga0496108_0056422 | 3300048911 | Bacteria | 3300 |
| 366 | Ga0496108_0278337 | 3300048911 | Bacteria | 1457 |
| 367 | Ga0496108_0846677 | 3300048911 | Bacteria | 787 |
| 368 | Ga0496109_0009001 | 3300048912 | Bacteria | 8502 |
| 369 | Ga0496109_0050912 | 3300048912 | Bacteria | 3771 |
| 370 | Ga0496109_0540673 | 3300048912 | Bacteria | 1099 |
| 371 | Ga0496110_0004818 | 3300048913 | Bacteria | 10511 |
| 372 | Ga0496110_0048229 | 3300048913 | Bacteria | 3733 |
| 373 | Ga0496110_0076930 | 3300048913 | Bacteria | 2968 |
| 374 | Ga0496110_0816049 | 3300048913 | Bacteria | 837 |
| 375 | Ga0496111_0017188 | 3300048914 | Bacteria | 4997 |
| 376 | Ga0496111_0062443 | 3300048914 | Bacteria | 2701 |
| 377 | Ga0496111_0223822 | 3300048914 | Bacteria | 1398 |
| 378 | Ga0496111_0263196 | 3300048914 | Bacteria | 1280 |
| 379 | Ga0496112_0015182 | 3300048915 | Bacteria | 7178 |
| 380 | Ga0496112_0052792 | 3300048915 | Bacteria | 3990 |
| 381 | Ga0496112_0071749 | 3300048915 | Bacteria | 3423 |
| 382 | Ga0496112_0095569 | 3300048915 | Bacteria | 2942 |
| 383 | Ga0496112_0441158 | 3300048915 | Bacteria | 1240 |
| 384 | Ga0496113_0023382 | 3300048916 | Bacteria | 4382 |
| 385 | Ga0496113_0224944 | 3300048916 | Bacteria | 1496 |
| 386 | Ga0496113_0310077 | 3300048916 | Bacteria | 1264 |
| 387 | Ga0496113_0933046 | 3300048916 | Bacteria | 686 |
| 388 | Ga0496113_1444560 | 3300048916 | Unclassified | 532 |
| 389 | Ga0496114_0339256 | 3300048917 | Bacteria | 1329 |
| 390 | Ga0496114_1282599 | 3300048917 | Bacteria | 619 |
| 391 | Ga0496114_1610977 | 3300048917 | Unclassified | 537 |
| 392 | Ga0496115_0369204 | 3300048918 | Bacteria | 1168 |
| 393 | Ga0496115_0648940 | 3300048918 | Bacteria | 834 |
| 394 | Ga0496121_0014845 | 3300048924 | Bacteria | 8219 |
| 395 | Ga0496121_0333225 | 3300048924 | Unclassified | 1017 |
| 396 | Ga0501031_0087384 | 3300049568 | Bacteria | 2033 |
| 397 | Ga0501036_0169403 | 3300049572 | Bacteria | 1840 |
| 398 | Ga0501036_0189679 | 3300049572 | Bacteria | 1730 |
| 399 | Ga0501036_0464455 | 3300049572 | Bacteria | 1054 |
| 400 | Ga0501036_1182844 | 3300049572 | Unclassified | 623 |
| 401 | Ga0501037_0231023 | 3300049573 | Bacteria | 1299 |
| 402 | Ga0501037_0810425 | 3300049573 | Bacteria | 618 |
| 403 | Ga0501038_0211535 | 3300049574 | Bacteria | 1551 |
| 404 | Ga0501039_0114186 | 3300049575 | Bacteria | 2113 |
| 405 | Ga0501039_0120813 | 3300049575 | Bacteria | 2053 |
| 406 | Ga0501040_0050344 | 3300049576 | Bacteria | 2849 |
| 407 | Ga0501040_0079345 | 3300049576 | Bacteria | 2272 |
| 408 | Ga0501040_0522020 | 3300049576 | Unclassified | 856 |
| 409 | Ga0501041_0037128 | 3300049577 | Bacteria | 2951 |
| 410 | Ga0501041_0042516 | 3300049577 | Bacteria | 2762 |
| 411 | Ga0501041_0201956 | 3300049577 | Bacteria | 1246 |
| 412 | Ga0501042_0140512 | 3300049578 | Bacteria | 1741 |
| 413 | Ga0501042_0140529 | 3300049578 | Bacteria | 1741 |
| 414 | Ga0501046_0123792 | 3300049580 | Bacteria | 1966 |
| 415 | Ga0501048_0088375 | 3300049582 | Bacteria | 2186 |
| 416 | Ga0501048_0104274 | 3300049582 | Bacteria | 2001 |
| 417 | Ga0501048_0114348 | 3300049582 | Bacteria | 1906 |
| 418 | Ga0501048_0393615 | 3300049582 | Bacteria | 990 |
| 419 | Ga0501067_0564362 | 3300049583 | Bacteria | 638 |
| 420 | Ga0501071_0239023 | 3300049587 | Bacteria | 1369 |
| 421 | Ga0501071_0286740 | 3300049587 | Bacteria | 1246 |
| 422 | Ga0501072_0062636 | 3300049588 | Bacteria | 2934 |
| 423 | Ga0501072_0095937 | 3300049588 | Bacteria | 2357 |
| 424 | Ga0501072_0723828 | 3300049588 | Bacteria | 781 |
| 425 | Ga0501074_0368532 | 3300049590 | Bacteria | 1019 |
| 426 | Ga0501075_0236140 | 3300049591 | Bacteria | 1394 |
| 427 | Ga0501076_0120216 | 3300049592 | Bacteria | 2127 |
| 428 | Ga0501076_0355346 | 3300049592 | Bacteria | 1203 |
| 429 | Ga0501079_0049942 | 3300049741 | Bacteria | 3229 |
| 430 | Ga0501080_0139971 | 3300049742 | Bacteria | 2237 |
| 431 | Ga0501081_0072929 | 3300049743 | Bacteria | 2394 |
| 432 | Ga0501083_0253383 | 3300049744 | Bacteria | 1146 |
| 433 | Ga0501035_0549290 | 3300049822 | Bacteria | 946 |
| 434 | Ga0501044_0543280 | 3300049823 | Bacteria | 1060 |
| 435 | Ga0501045_0031340 | 3300049824 | Bacteria | 3851 |
| 436 | Ga0501045_0051448 | 3300049824 | Bacteria | 3006 |
| 437 | nmdc:mga05p37_489007_c1 | 3300050507 | Bacteria | 1415 |
| 438 | nmdc:mga08y16_465168_c1 | 3300050511 | Bacteria | 1288 |
| 439 | nmdc:mga08y16_652570_c1 | 3300050511 | Bacteria | 1056 |
| 440 | nmdc:mga08y16_853779_c1 | 3300050511 | Bacteria | 899 |
| 441 | nmdc:mga0n895_812931_c1 | 3300050512 | Bacteria | 924 |
| 442 | Ga0495601_0120201 | 3300053077 | Bacteria | 1706 |
| 443 | Ga0495619_0181811 | 3300053085 | Bacteria | 1455 |
| 444 | Ga0501084_0137302 | 3300054114 | Bacteria | 2058 |
| 445 | Ga0501084_0236211 | 3300054114 | Bacteria | 1543 |
| 446 | Ga0501084_1786349 | 3300054114 | Unclassified | 513 |
| 447 | Ga0501082_0024168 | 3300060353 | Bacteria | 5241 |
| 448 | Ga0501082_0254756 | 3300060353 | Bacteria | 1527 |
| 449 | Ga0466962_0117270 | 3300061719 | Bacteria | 1283 |
| 450 | Ga0530510_0236821 | 3300061734 | Bacteria | 1358 |
| 451 | Ga0530510_0246095 | 3300061734 | Bacteria | 1332 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005330 | Ga0070690_100783733 | Ga0070690_1007837332 | 121 |
| 2 | 3300005440 | Ga0070705_100300943 | Ga0070705_1003009432 | 121 |
| 3 | 3300014969 | Ga0157376_10094985 | Ga0157376_100949854 | 121 |
| 4 | 3300026121 | Ga0207683_10012992 | Ga0207683_100129923 | 121 |
| 5 | 3300005329 | Ga0070683_100106867 | Ga0070683_1001068672 | 124 |
| 6 | 3300005367 | Ga0070667_100467606 | Ga0070667_1004676062 | 124 |
| 7 | 3300005577 | Ga0068857_100119224 | Ga0068857_1001192243 | 124 |
| 8 | 3300009148 | Ga0105243_10190339 | Ga0105243_101903393 | 124 |
| 9 | 3300025935 | Ga0207709_10214647 | Ga0207709_102146472 | 124 |
| 10 | 3300025986 | Ga0207658_10914353 | Ga0207658_109143532 | 124 |
| 11 | 3300048916 | Ga0496113_0933046 | Ga0496113_0933046_163_597 | 124 |
| 12 | 3300013296 | Ga0157374_10279147 | Ga0157374_102791472 | 130 |
| 13 | 3300005544 | Ga0070686_101184314 | Ga0070686_1011843141 | 131 |
| 14 | 3300025945 | Ga0207679_10581835 | Ga0207679_105818352 | 131 |
| 15 | 3300020082 | Ga0206353_10709368 | Ga0206353_107093682 | 132 |
| 16 | 3300044706 | Ga0466964_0081614 | Ga0466964_0081614_785_1219 | 133 |
| 17 | 3300045976 | Ga0466967_0004123 | Ga0466967_0004123_3583_4017 | 133 |
| 18 | 3300046518 | Ga0495631_0520187 | Ga0495631_0520187_61_471 | 133 |
| 19 | 3300044901 | Ga0466960_0491501 | Ga0466960_0491501_234_659 | 136 |
| 20 | 3300005343 | Ga0070687_100116308 | Ga0070687_1001163082 | 138 |
| 21 | 3300005345 | Ga0070692_10028758 | Ga0070692_100287582 | 138 |
| 22 | 3300005367 | Ga0070667_100428579 | Ga0070667_1004285792 | 138 |
| 23 | 3300005444 | Ga0070694_100018268 | Ga0070694_1000182683 | 138 |
| 24 | 3300005444 | Ga0070694_100179976 | Ga0070694_1001799762 | 138 |
| 25 | 3300005445 | Ga0070708_100979409 | Ga0070708_1009794092 | 138 |
| 26 | 3300005539 | Ga0068853_100174425 | Ga0068853_1001744253 | 138 |
| 27 | 3300005544 | Ga0070686_100593692 | Ga0070686_1005936922 | 138 |
| 28 | 3300005544 | Ga0070686_100874943 | Ga0070686_1008749432 | 138 |
| 29 | 3300005544 | Ga0070686_101349224 | Ga0070686_1013492241 | 138 |
| 30 | 3300005549 | Ga0070704_100022917 | Ga0070704_1000229172 | 138 |
| 31 | 3300005563 | Ga0068855_100362868 | Ga0068855_1003628683 | 138 |
| 32 | 3300005564 | Ga0070664_100758021 | Ga0070664_1007580211 | 138 |
| 33 | 3300005614 | Ga0068856_100260586 | Ga0068856_1002605862 | 138 |
| 34 | 3300005614 | Ga0068856_100512733 | Ga0068856_1005127332 | 138 |
| 35 | 3300005618 | Ga0068864_100189013 | Ga0068864_1001890132 | 138 |
| 36 | 3300005843 | Ga0068860_100052827 | Ga0068860_1000528273 | 138 |
| 37 | 3300005844 | Ga0068862_100357853 | Ga0068862_1003578532 | 138 |
| 38 | 3300005981 | Ga0081538_10042074 | Ga0081538_100420744 | 138 |
| 39 | 3300006881 | Ga0068865_100977575 | Ga0068865_1009775751 | 138 |
| 40 | 3300009098 | Ga0105245_10743675 | Ga0105245_107436752 | 138 |
| 41 | 3300009553 | Ga0105249_10021190 | Ga0105249_100211904 | 138 |
| 42 | 3300010375 | Ga0105239_10436047 | Ga0105239_104360472 | 138 |
| 43 | 3300011119 | Ga0105246_11673274 | Ga0105246_116732742 | 138 |
| 44 | 3300013306 | Ga0163162_10374360 | Ga0163162_103743602 | 138 |
| 45 | 3300013308 | Ga0157375_10012714 | Ga0157375_100127145 | 138 |
| 46 | 3300014745 | Ga0157377_10071222 | Ga0157377_100712221 | 138 |
| 47 | 3300014745 | Ga0157377_10183759 | Ga0157377_101837592 | 138 |
| 48 | 3300014968 | Ga0157379_10672635 | Ga0157379_106726352 | 138 |
| 49 | 3300025904 | Ga0207647_10178069 | Ga0207647_101780692 | 138 |
| 50 | 3300025918 | Ga0207662_10136766 | Ga0207662_101367662 | 138 |
| 51 | 3300025918 | Ga0207662_10361868 | Ga0207662_103618682 | 138 |
| 52 | 3300025937 | Ga0207669_11618762 | Ga0207669_116187621 | 138 |
| 53 | 3300025960 | Ga0207651_10239140 | Ga0207651_102391402 | 138 |
| 54 | 3300025986 | Ga0207658_10257015 | Ga0207658_102570153 | 138 |
| 55 | 3300026078 | Ga0207702_10446161 | Ga0207702_104461612 | 138 |
| 56 | 3300026078 | Ga0207702_10551470 | Ga0207702_105514702 | 138 |
| 57 | 3300026095 | Ga0207676_10060920 | Ga0207676_100609203 | 138 |
| 58 | 3300026118 | Ga0207675_101592500 | Ga0207675_1015925002 | 138 |
| 59 | 3300028380 | Ga0268265_11358841 | Ga0268265_113588411 | 138 |
| 60 | 3300028381 | Ga0268264_10120710 | Ga0268264_101207102 | 138 |
| 61 | 3300031731 | Ga0307405_11875699 | Ga0307405_118756991 | 138 |
| 62 | 3300031852 | Ga0307410_10036790 | Ga0307410_100367902 | 138 |
| 63 | 3300031901 | Ga0307406_10427822 | Ga0307406_104278222 | 138 |
| 64 | 3300031903 | Ga0307407_10043949 | Ga0307407_100439492 | 138 |
| 65 | 3300031911 | Ga0307412_10121551 | Ga0307412_101215512 | 138 |
| 66 | 3300031995 | Ga0307409_100020771 | Ga0307409_1000207713 | 138 |
| 67 | 3300032004 | Ga0307414_10093484 | Ga0307414_100934842 | 138 |
| 68 | 3300032005 | Ga0307411_10208029 | Ga0307411_102080292 | 138 |
| 69 | 3300032126 | Ga0307415_100220051 | Ga0307415_1002200511 | 138 |
| 70 | 3300035116 | Ga0373945_0124707 | Ga0373945_0124707_171_605 | 138 |
| 71 | 3300035171 | Ga0373946_0311956 | Ga0373946_0311956_230_664 | 138 |
| 72 | 3300035725 | Ga0373947_0187436 | Ga0373947_0187436_206_640 | 138 |
| 73 | 3300037068 | Ga0373925_0082477 | Ga0373925_0082477_375_809 | 138 |
| 74 | 3300046459 | Ga0495629_0237333 | Ga0495629_0237333_678_1112 | 138 |
| 75 | 3300046473 | Ga0495582_0145619 | Ga0495582_0145619_687_1121 | 138 |
| 76 | 3300046514 | Ga0495618_0252180 | Ga0495618_0252180_40_474 | 138 |
| 77 | 3300046533 | Ga0495640_0133783 | Ga0495640_0133783_134_568 | 138 |
| 78 | 3300047319 | Ga0495674_0818306 | Ga0495674_0818306_57_491 | 138 |
| 79 | 3300048903 | Ga0496100_0689682 | Ga0496100_0689682_84_518 | 138 |
| 80 | 3300048907 | Ga0496104_0862775 | Ga0496104_0862775_228_662 | 138 |
| 81 | 3300048908 | Ga0496105_0103470 | Ga0496105_0103470_1571_2005 | 138 |
| 82 | 3300048908 | Ga0496105_1250364 | Ga0496105_1250364_40_474 | 138 |
| 83 | 3300048909 | Ga0496106_0172868 | Ga0496106_0172868_327_761 | 138 |
| 84 | 3300048909 | Ga0496106_0482087 | Ga0496106_0482087_326_769 | 138 |
| 85 | 3300048911 | Ga0496108_0029165 | Ga0496108_0029165_1643_2077 | 138 |
| 86 | 3300048911 | Ga0496108_0278337 | Ga0496108_0278337_642_1076 | 138 |
| 87 | 3300048912 | Ga0496109_0050912 | Ga0496109_0050912_1644_2078 | 138 |
| 88 | 3300048912 | Ga0496109_0540673 | Ga0496109_0540673_459_890 | 138 |
| 89 | 3300048914 | Ga0496111_0017188 | Ga0496111_0017188_4215_4649 | 138 |
| 90 | 3300048914 | Ga0496111_0263196 | Ga0496111_0263196_787_1221 | 138 |
| 91 | 3300048915 | Ga0496112_0052792 | Ga0496112_0052792_2256_2690 | 138 |
| 92 | 3300048915 | Ga0496112_0441158 | Ga0496112_0441158_457_888 | 138 |
| 93 | 3300048916 | Ga0496113_0023382 | Ga0496113_0023382_2572_3006 | 138 |
| 94 | 3300053077 | Ga0495601_0120201 | Ga0495601_0120201_1001_1435 | 138 |
| 95 | 3300053085 | Ga0495619_0181811 | Ga0495619_0181811_79_513 | 138 |
| 96 | 3300005548 | Ga0070665_100445902 | Ga0070665_1004459022 | 139 |
| 97 | 3300028379 | Ga0268266_10226284 | Ga0268266_102262842 | 139 |
| 98 | 3300005329 | Ga0070683_100110024 | Ga0070683_1001100242 | 140 |
| 99 | 3300005330 | Ga0070690_100738624 | Ga0070690_1007386242 | 140 |
| 100 | 3300005337 | Ga0070682_102035170 | Ga0070682_1020351701 | 140 |
| 101 | 3300005338 | Ga0068868_100096874 | Ga0068868_1000968744 | 140 |
| 102 | 3300005339 | Ga0070660_100080791 | Ga0070660_1000807912 | 140 |
| 103 | 3300005341 | Ga0070691_10589603 | Ga0070691_105896031 | 140 |
| 104 | 3300005343 | Ga0070687_100070541 | Ga0070687_1000705411 | 140 |
| 105 | 3300005344 | Ga0070661_100503410 | Ga0070661_1005034101 | 140 |
| 106 | 3300005345 | Ga0070692_11031675 | Ga0070692_110316752 | 140 |
| 107 | 3300005354 | Ga0070675_102169449 | Ga0070675_1021694491 | 140 |
| 108 | 3300005364 | Ga0070673_101622855 | Ga0070673_1016228551 | 140 |
| 109 | 3300005366 | Ga0070659_100479572 | Ga0070659_1004795722 | 140 |
| 110 | 3300005367 | Ga0070667_101779089 | Ga0070667_1017790892 | 140 |
| 111 | 3300005438 | Ga0070701_10041840 | Ga0070701_100418402 | 140 |
| 112 | 3300005441 | Ga0070700_100077271 | Ga0070700_1000772712 | 140 |
| 113 | 3300005441 | Ga0070700_101297645 | Ga0070700_1012976451 | 140 |
| 114 | 3300005455 | Ga0070663_100629611 | Ga0070663_1006296112 | 140 |
| 115 | 3300005456 | Ga0070678_100327437 | Ga0070678_1003274371 | 140 |
| 116 | 3300005459 | Ga0068867_100143935 | Ga0068867_1001439352 | 140 |
| 117 | 3300005459 | Ga0068867_100565513 | Ga0068867_1005655132 | 140 |
| 118 | 3300005466 | Ga0070685_10081978 | Ga0070685_100819782 | 140 |
| 119 | 3300005535 | Ga0070684_100818948 | Ga0070684_1008189481 | 140 |
| 120 | 3300005535 | Ga0070684_100920004 | Ga0070684_1009200042 | 140 |
| 121 | 3300005539 | Ga0068853_101940462 | Ga0068853_1019404621 | 140 |
| 122 | 3300005544 | Ga0070686_100757415 | Ga0070686_1007574152 | 140 |
| 123 | 3300005615 | Ga0070702_100014950 | Ga0070702_1000149505 | 140 |
| 124 | 3300005615 | Ga0070702_100404069 | Ga0070702_1004040692 | 140 |
| 125 | 3300005616 | Ga0068852_100128722 | Ga0068852_1001287222 | 140 |
| 126 | 3300005617 | Ga0068859_100239550 | Ga0068859_1002395502 | 140 |
| 127 | 3300005618 | Ga0068864_100327500 | Ga0068864_1003275002 | 140 |
| 128 | 3300005618 | Ga0068864_100448824 | Ga0068864_1004488242 | 140 |
| 129 | 3300005842 | Ga0068858_100458532 | Ga0068858_1004585322 | 140 |
| 130 | 3300005981 | Ga0081538_10010378 | Ga0081538_100103788 | 140 |
| 131 | 3300006038 | Ga0075365_10724305 | Ga0075365_107243052 | 140 |
| 132 | 3300006358 | Ga0068871_101036507 | Ga0068871_1010365071 | 140 |
| 133 | 3300006881 | Ga0068865_100544614 | Ga0068865_1005446142 | 140 |
| 134 | 3300006931 | Ga0097620_100239532 | Ga0097620_1002395322 | 140 |
| 135 | 3300009094 | Ga0111539_10272865 | Ga0111539_102728652 | 140 |
| 136 | 3300009094 | Ga0111539_10431620 | Ga0111539_104316202 | 140 |
| 137 | 3300009098 | Ga0105245_10540138 | Ga0105245_105401382 | 140 |
| 138 | 3300009098 | Ga0105245_10821878 | Ga0105245_108218781 | 140 |
| 139 | 3300009098 | Ga0105245_11879451 | Ga0105245_118794511 | 140 |
| 140 | 3300009148 | Ga0105243_10057894 | Ga0105243_100578944 | 140 |
| 141 | 3300009148 | Ga0105243_12393126 | Ga0105243_123931261 | 140 |
| 142 | 3300009176 | Ga0105242_10868899 | Ga0105242_108688992 | 140 |
| 143 | 3300009177 | Ga0105248_10596890 | Ga0105248_105968902 | 140 |
| 144 | 3300009553 | Ga0105249_10508550 | Ga0105249_105085502 | 140 |
| 145 | 3300011119 | Ga0105246_10409376 | Ga0105246_104093762 | 140 |
| 146 | 3300011119 | Ga0105246_11237194 | Ga0105246_112371941 | 140 |
| 147 | 3300013306 | Ga0163162_10283293 | Ga0163162_102832932 | 140 |
| 148 | 3300014745 | Ga0157377_10105779 | Ga0157377_101057793 | 140 |
| 149 | 3300014745 | Ga0157377_10131947 | Ga0157377_101319472 | 140 |
| 150 | 3300025901 | Ga0207688_10335933 | Ga0207688_103359332 | 140 |
| 151 | 3300025909 | Ga0207705_10796867 | Ga0207705_107968672 | 140 |
| 152 | 3300025918 | Ga0207662_10142067 | Ga0207662_101420671 | 140 |
| 153 | 3300025926 | Ga0207659_11675838 | Ga0207659_116758381 | 140 |
| 154 | 3300025927 | Ga0207687_11455129 | Ga0207687_114551291 | 140 |
| 155 | 3300025932 | Ga0207690_11182603 | Ga0207690_111826032 | 140 |
| 156 | 3300025933 | Ga0207706_10030475 | Ga0207706_100304752 | 140 |
| 157 | 3300025934 | Ga0207686_11039344 | Ga0207686_110393441 | 140 |
| 158 | 3300025935 | Ga0207709_10094195 | Ga0207709_100941952 | 140 |
| 159 | 3300025944 | Ga0207661_10149318 | Ga0207661_101493182 | 140 |
| 160 | 3300025960 | Ga0207651_10652633 | Ga0207651_106526332 | 140 |
| 161 | 3300025961 | Ga0207712_10542976 | Ga0207712_105429761 | 140 |
| 162 | 3300026023 | Ga0207677_11368661 | Ga0207677_113686612 | 140 |
| 163 | 3300026035 | Ga0207703_10263013 | Ga0207703_102630132 | 140 |
| 164 | 3300026035 | Ga0207703_11616416 | Ga0207703_116164162 | 140 |
| 165 | 3300026067 | Ga0207678_11357019 | Ga0207678_113570191 | 140 |
| 166 | 3300026075 | Ga0207708_10226863 | Ga0207708_102268632 | 140 |
| 167 | 3300026088 | Ga0207641_10640256 | Ga0207641_106402562 | 140 |
| 168 | 3300026089 | Ga0207648_10345146 | Ga0207648_103451462 | 140 |
| 169 | 3300026095 | Ga0207676_10128359 | Ga0207676_101283592 | 140 |
| 170 | 3300026095 | Ga0207676_12218689 | Ga0207676_122186891 | 140 |
| 171 | 3300026118 | Ga0207675_100096903 | Ga0207675_1000969033 | 140 |
| 172 | 3300026121 | Ga0207683_10368952 | Ga0207683_103689522 | 140 |
| 173 | 3300026142 | Ga0207698_10290471 | Ga0207698_102904712 | 140 |
| 174 | 3300026142 | Ga0207698_11641544 | Ga0207698_116415442 | 140 |
| 175 | 3300031731 | Ga0307405_10128068 | Ga0307405_101280681 | 140 |
| 176 | 3300031824 | Ga0307413_10149416 | Ga0307413_101494162 | 140 |
| 177 | 3300031852 | Ga0307410_10316886 | Ga0307410_103168862 | 140 |
| 178 | 3300031901 | Ga0307406_11462457 | Ga0307406_114624571 | 140 |
| 179 | 3300031911 | Ga0307412_10678734 | Ga0307412_106787341 | 140 |
| 180 | 3300031995 | Ga0307409_100465476 | Ga0307409_1004654762 | 140 |
| 181 | 3300031995 | Ga0307409_100596051 | Ga0307409_1005960512 | 140 |
| 182 | 3300032002 | Ga0307416_100076056 | Ga0307416_1000760563 | 140 |
| 183 | 3300032005 | Ga0307411_11471289 | Ga0307411_114712892 | 140 |
| 184 | 3300032126 | Ga0307415_100004172 | Ga0307415_1000041728 | 140 |
| 185 | 3300032126 | Ga0307415_100025264 | Ga0307415_1000252645 | 140 |
| 186 | 3300046507 | Ga0495606_0351789 | Ga0495606_0351789_336_770 | 140 |
| 187 | 3300046515 | Ga0495620_0161640 | Ga0495620_0161640_344_778 | 140 |
| 188 | 3300046518 | Ga0495631_0046374 | Ga0495631_0046374_1242_1676 | 140 |
| 189 | 3300046523 | Ga0495644_0293371 | Ga0495644_0293371_82_516 | 140 |
| 190 | 3300048905 | Ga0496102_0366172 | Ga0496102_0366172_874_1299 | 140 |
| 191 | 3300048909 | Ga0496106_0273060 | Ga0496106_0273060_270_695 | 140 |
| 192 | 3300048911 | Ga0496108_0846677 | Ga0496108_0846677_295_720 | 140 |
| 193 | 3300048913 | Ga0496110_0816049 | Ga0496110_0816049_227_661 | 140 |
| 194 | 3300048914 | Ga0496111_0223822 | Ga0496111_0223822_746_1180 | 140 |
| 195 | 3300049568 | Ga0501031_0087384 | Ga0501031_0087384_336_758 | 140 |
| 196 | 3300049572 | Ga0501036_0169403 | Ga0501036_0169403_218_640 | 140 |
| 197 | 3300049573 | Ga0501037_0231023 | Ga0501037_0231023_279_701 | 140 |
| 198 | 3300049575 | Ga0501039_0120813 | Ga0501039_0120813_1308_1730 | 140 |
| 199 | 3300049576 | Ga0501040_0522020 | Ga0501040_0522020_327_749 | 140 |
| 200 | 3300049577 | Ga0501041_0201956 | Ga0501041_0201956_783_1205 | 140 |
| 201 | 3300049578 | Ga0501042_0140512 | Ga0501042_0140512_589_1011 | 140 |
| 202 | 3300049580 | Ga0501046_0123792 | Ga0501046_0123792_771_1193 | 140 |
| 203 | 3300049582 | Ga0501048_0104274 | Ga0501048_0104274_425_847 | 140 |
| 204 | 3300049588 | Ga0501072_0062636 | Ga0501072_0062636_426_848 | 140 |
| 205 | 3300049591 | Ga0501075_0236140 | Ga0501075_0236140_216_638 | 140 |
| 206 | 3300049743 | Ga0501081_0072929 | Ga0501081_0072929_598_1020 | 140 |
| 207 | 3300050511 | nmdc:mga08y16_465168_c1 | nmdc:mga08y16_465168_c1_624_1058 | 140 |
| 208 | 3300050511 | nmdc:mga08y16_853779_c1 | nmdc:mga08y16_853779_c1_399_824 | 140 |
| 209 | 3300050512 | nmdc:mga0n895_812931_c1 | nmdc:mga0n895_812931_c1_474_899 | 140 |
| 210 | 3300060353 | Ga0501082_0254756 | Ga0501082_0254756_756_1178 | 140 |
| 211 | 3300003203 | JGI25406J46586_10101872 | JGI25406J46586_101018721 | 141 |
| 212 | 3300005329 | Ga0070683_100361980 | Ga0070683_1003619802 | 141 |
| 213 | 3300005329 | Ga0070683_100653440 | Ga0070683_1006534402 | 141 |
| 214 | 3300005329 | Ga0070683_101059449 | Ga0070683_1010594492 | 141 |
| 215 | 3300005329 | Ga0070683_101934758 | Ga0070683_1019347582 | 141 |
| 216 | 3300005331 | Ga0070670_101148865 | Ga0070670_1011488652 | 141 |
| 217 | 3300005334 | Ga0068869_100774947 | Ga0068869_1007749472 | 141 |
| 218 | 3300005337 | Ga0070682_100788644 | Ga0070682_1007886441 | 141 |
| 219 | 3300005337 | Ga0070682_100990374 | Ga0070682_1009903741 | 141 |
| 220 | 3300005338 | Ga0068868_100094092 | Ga0068868_1000940922 | 141 |
| 221 | 3300005338 | Ga0068868_100332177 | Ga0068868_1003321772 | 141 |
| 222 | 3300005338 | Ga0068868_100410242 | Ga0068868_1004102421 | 141 |
| 223 | 3300005338 | Ga0068868_101052727 | Ga0068868_1010527271 | 141 |
| 224 | 3300005344 | Ga0070661_100443551 | Ga0070661_1004435511 | 141 |
| 225 | 3300005354 | Ga0070675_100484490 | Ga0070675_1004844902 | 141 |
| 226 | 3300005356 | Ga0070674_101246057 | Ga0070674_1012460571 | 141 |
| 227 | 3300005364 | Ga0070673_102059069 | Ga0070673_1020590691 | 141 |
| 228 | 3300005438 | Ga0070701_10850908 | Ga0070701_108509081 | 141 |
| 229 | 3300005455 | Ga0070663_100121582 | Ga0070663_1001215822 | 141 |
| 230 | 3300005455 | Ga0070663_100573403 | Ga0070663_1005734032 | 141 |
| 231 | 3300005456 | Ga0070678_100469907 | Ga0070678_1004699072 | 141 |
| 232 | 3300005457 | Ga0070662_100874358 | Ga0070662_1008743582 | 141 |
| 233 | 3300005458 | Ga0070681_10380064 | Ga0070681_103800642 | 141 |
| 234 | 3300005530 | Ga0070679_101266977 | Ga0070679_1012669772 | 141 |
| 235 | 3300005535 | Ga0070684_100151401 | Ga0070684_1001514012 | 141 |
| 236 | 3300005535 | Ga0070684_100161488 | Ga0070684_1001614884 | 141 |
| 237 | 3300005535 | Ga0070684_100262933 | Ga0070684_1002629331 | 141 |
| 238 | 3300005535 | Ga0070684_100401289 | Ga0070684_1004012891 | 141 |
| 239 | 3300005535 | Ga0070684_100802457 | Ga0070684_1008024571 | 141 |
| 240 | 3300005535 | Ga0070684_101441661 | Ga0070684_1014416612 | 141 |
| 241 | 3300005543 | Ga0070672_100157140 | Ga0070672_1001571401 | 141 |
| 242 | 3300005546 | Ga0070696_100763304 | Ga0070696_1007633041 | 141 |
| 243 | 3300005546 | Ga0070696_101300182 | Ga0070696_1013001821 | 141 |
| 244 | 3300005547 | Ga0070693_100546744 | Ga0070693_1005467441 | 141 |
| 245 | 3300005548 | Ga0070665_100193554 | Ga0070665_1001935543 | 141 |
| 246 | 3300005548 | Ga0070665_101038099 | Ga0070665_1010380991 | 141 |
| 247 | 3300005549 | Ga0070704_101171106 | Ga0070704_1011711062 | 141 |
| 248 | 3300005564 | Ga0070664_101528933 | Ga0070664_1015289332 | 141 |
| 249 | 3300005564 | Ga0070664_101905170 | Ga0070664_1019051702 | 141 |
| 250 | 3300005577 | Ga0068857_100219273 | Ga0068857_1002192732 | 141 |
| 251 | 3300005577 | Ga0068857_101392164 | Ga0068857_1013921642 | 141 |
| 252 | 3300005614 | Ga0068856_100277488 | Ga0068856_1002774882 | 141 |
| 253 | 3300005616 | Ga0068852_101374807 | Ga0068852_1013748072 | 141 |
| 254 | 3300005617 | Ga0068859_101220706 | Ga0068859_1012207061 | 141 |
| 255 | 3300005617 | Ga0068859_101739011 | Ga0068859_1017390111 | 141 |
| 256 | 3300005618 | Ga0068864_100385016 | Ga0068864_1003850162 | 141 |
| 257 | 3300005718 | Ga0068866_11064974 | Ga0068866_110649741 | 141 |
| 258 | 3300005719 | Ga0068861_102539909 | Ga0068861_1025399091 | 141 |
| 259 | 3300005834 | Ga0068851_10884872 | Ga0068851_108848721 | 141 |
| 260 | 3300005841 | Ga0068863_100570794 | Ga0068863_1005707942 | 141 |
| 261 | 3300005841 | Ga0068863_100630084 | Ga0068863_1006300841 | 141 |
| 262 | 3300005842 | Ga0068858_100359236 | Ga0068858_1003592362 | 141 |
| 263 | 3300005844 | Ga0068862_100204669 | Ga0068862_1002046692 | 141 |
| 264 | 3300005937 | Ga0081455_10038969 | Ga0081455_100389694 | 141 |
| 265 | 3300005937 | Ga0081455_10112345 | Ga0081455_101123452 | 141 |
| 266 | 3300005937 | Ga0081455_10211304 | Ga0081455_102113042 | 141 |
| 267 | 3300005981 | Ga0081538_10128134 | Ga0081538_101281342 | 141 |
| 268 | 3300005983 | Ga0081540_1000006 | Ga0081540_100000656 | 141 |
| 269 | 3300005985 | Ga0081539_10030265 | Ga0081539_100302652 | 141 |
| 270 | 3300006237 | Ga0097621_102244562 | Ga0097621_1022445622 | 141 |
| 271 | 3300006871 | Ga0075434_101501561 | Ga0075434_1015015612 | 141 |
| 272 | 3300006880 | Ga0075429_101241438 | Ga0075429_1012414382 | 141 |
| 273 | 3300006881 | Ga0068865_100347783 | Ga0068865_1003477832 | 141 |
| 274 | 3300006881 | Ga0068865_100934468 | Ga0068865_1009344681 | 141 |
| 275 | 3300006931 | Ga0097620_101220763 | Ga0097620_1012207632 | 141 |
| 276 | 3300006931 | Ga0097620_101739083 | Ga0097620_1017390831 | 141 |
| 277 | 3300009098 | Ga0105245_10142928 | Ga0105245_101429281 | 141 |
| 278 | 3300009098 | Ga0105245_10272739 | Ga0105245_102727392 | 141 |
| 279 | 3300009098 | Ga0105245_12361527 | Ga0105245_123615271 | 141 |
| 280 | 3300009147 | Ga0114129_10731041 | Ga0114129_107310412 | 141 |
| 281 | 3300009148 | Ga0105243_10212892 | Ga0105243_102128922 | 141 |
| 282 | 3300009148 | Ga0105243_10364474 | Ga0105243_103644742 | 141 |
| 283 | 3300009176 | Ga0105242_13235296 | Ga0105242_132352961 | 141 |
| 284 | 3300009553 | Ga0105249_10912239 | Ga0105249_109122392 | 141 |
| 285 | 3300009553 | Ga0105249_11709649 | Ga0105249_117096492 | 141 |
| 286 | 3300010375 | Ga0105239_11096772 | Ga0105239_110967721 | 141 |
| 287 | 3300011119 | Ga0105246_10214180 | Ga0105246_102141802 | 141 |
| 288 | 3300013105 | Ga0157369_10395982 | Ga0157369_103959822 | 141 |
| 289 | 3300013105 | Ga0157369_10820974 | Ga0157369_108209742 | 141 |
| 290 | 3300013105 | Ga0157369_12497275 | Ga0157369_124972751 | 141 |
| 291 | 3300013308 | Ga0157375_11667960 | Ga0157375_116679601 | 141 |
| 292 | 3300014326 | Ga0157380_11188470 | Ga0157380_111884702 | 141 |
| 293 | 3300014497 | Ga0182008_10219942 | Ga0182008_102199422 | 141 |
| 294 | 3300014745 | Ga0157377_10176431 | Ga0157377_101764312 | 141 |
| 295 | 3300014745 | Ga0157377_10562862 | Ga0157377_105628622 | 141 |
| 296 | 3300025899 | Ga0207642_10512148 | Ga0207642_105121481 | 141 |
| 297 | 3300025901 | Ga0207688_10285213 | Ga0207688_102852132 | 141 |
| 298 | 3300025912 | Ga0207707_10306328 | Ga0207707_103063282 | 141 |
| 299 | 3300025921 | Ga0207652_10094906 | Ga0207652_100949062 | 141 |
| 300 | 3300025921 | Ga0207652_10767594 | Ga0207652_107675942 | 141 |
| 301 | 3300025926 | Ga0207659_10476576 | Ga0207659_104765762 | 141 |
| 302 | 3300025932 | Ga0207690_10192990 | Ga0207690_101929902 | 141 |
| 303 | 3300025932 | Ga0207690_11072754 | Ga0207690_110727542 | 141 |
| 304 | 3300025933 | Ga0207706_10248668 | Ga0207706_102486681 | 141 |
| 305 | 3300025933 | Ga0207706_10406503 | Ga0207706_104065032 | 141 |
| 306 | 3300025935 | Ga0207709_10081822 | Ga0207709_100818223 | 141 |
| 307 | 3300025935 | Ga0207709_10273776 | Ga0207709_102737762 | 141 |
| 308 | 3300025935 | Ga0207709_10305093 | Ga0207709_103050932 | 141 |
| 309 | 3300025937 | Ga0207669_10895315 | Ga0207669_108953151 | 141 |
| 310 | 3300025938 | Ga0207704_10339116 | Ga0207704_103391162 | 141 |
| 311 | 3300025939 | Ga0207665_10802963 | Ga0207665_108029631 | 141 |
| 312 | 3300025940 | Ga0207691_10259478 | Ga0207691_102594782 | 141 |
| 313 | 3300025944 | Ga0207661_10042152 | Ga0207661_100421524 | 141 |
| 314 | 3300025944 | Ga0207661_10207608 | Ga0207661_102076082 | 141 |
| 315 | 3300025944 | Ga0207661_11410186 | Ga0207661_114101862 | 141 |
| 316 | 3300025945 | Ga0207679_10172974 | Ga0207679_101729742 | 141 |
| 317 | 3300025945 | Ga0207679_10359717 | Ga0207679_103597172 | 141 |
| 318 | 3300025960 | Ga0207651_10876359 | Ga0207651_108763592 | 141 |
| 319 | 3300025961 | Ga0207712_10336708 | Ga0207712_103367081 | 141 |
| 320 | 3300025961 | Ga0207712_11580865 | Ga0207712_115808652 | 141 |
| 321 | 3300025981 | Ga0207640_10436941 | Ga0207640_104369412 | 141 |
| 322 | 3300026023 | Ga0207677_10072272 | Ga0207677_100722722 | 141 |
| 323 | 3300026023 | Ga0207677_10730221 | Ga0207677_107302212 | 141 |
| 324 | 3300026035 | Ga0207703_11703626 | Ga0207703_117036261 | 141 |
| 325 | 3300026035 | Ga0207703_11975853 | Ga0207703_119758531 | 141 |
| 326 | 3300026067 | Ga0207678_10461549 | Ga0207678_104615492 | 141 |
| 327 | 3300026067 | Ga0207678_10582900 | Ga0207678_105829001 | 141 |
| 328 | 3300026075 | Ga0207708_10702192 | Ga0207708_107021922 | 141 |
| 329 | 3300026078 | Ga0207702_10172480 | Ga0207702_101724803 | 141 |
| 330 | 3300026088 | Ga0207641_10328123 | Ga0207641_103281232 | 141 |
| 331 | 3300026095 | Ga0207676_10262578 | Ga0207676_102625781 | 141 |
| 332 | 3300026095 | Ga0207676_10914816 | Ga0207676_109148162 | 141 |
| 333 | 3300026116 | Ga0207674_10312258 | Ga0207674_103122582 | 141 |
| 334 | 3300026116 | Ga0207674_10751461 | Ga0207674_107514612 | 141 |
| 335 | 3300026118 | Ga0207675_100414125 | Ga0207675_1004141252 | 141 |
| 336 | 3300026118 | Ga0207675_100770609 | Ga0207675_1007706092 | 141 |
| 337 | 3300026121 | Ga0207683_10393444 | Ga0207683_103934442 | 141 |
| 338 | 3300026142 | Ga0207698_10779290 | Ga0207698_107792902 | 141 |
| 339 | 3300026142 | Ga0207698_10990098 | Ga0207698_109900982 | 141 |
| 340 | 3300026142 | Ga0207698_12034588 | Ga0207698_120345881 | 141 |
| 341 | 3300027907 | Ga0207428_10124064 | Ga0207428_101240643 | 141 |
| 342 | 3300028379 | Ga0268266_10394743 | Ga0268266_103947432 | 141 |
| 343 | 3300028380 | Ga0268265_10351098 | Ga0268265_103510982 | 141 |
| 344 | 3300031548 | Ga0307408_101022563 | Ga0307408_1010225632 | 141 |
| 345 | 3300031901 | Ga0307406_10029453 | Ga0307406_100294534 | 141 |
| 346 | 3300031901 | Ga0307406_10411712 | Ga0307406_104117122 | 141 |
| 347 | 3300031901 | Ga0307406_10461235 | Ga0307406_104612352 | 141 |
| 348 | 3300031903 | Ga0307407_10069290 | Ga0307407_100692902 | 141 |
| 349 | 3300031903 | Ga0307407_10384351 | Ga0307407_103843511 | 141 |
| 350 | 3300031995 | Ga0307409_100053464 | Ga0307409_1000534642 | 141 |
| 351 | 3300031995 | Ga0307409_100916605 | Ga0307409_1009166052 | 141 |
| 352 | 3300032002 | Ga0307416_103545784 | Ga0307416_1035457841 | 141 |
| 353 | 3300032005 | Ga0307411_10137461 | Ga0307411_101374612 | 141 |
| 354 | 3300032005 | Ga0307411_10511917 | Ga0307411_105119172 | 141 |
| 355 | 3300032126 | Ga0307415_100110453 | Ga0307415_1001104532 | 141 |
| 356 | 3300032126 | Ga0307415_100285887 | Ga0307415_1002858872 | 141 |
| 357 | 3300032126 | Ga0307415_101110287 | Ga0307415_1011102872 | 141 |
| 358 | 3300035089 | Ga0373944_0210051 | Ga0373944_0210051_37_471 | 141 |
| 359 | 3300035725 | Ga0373947_0130354 | Ga0373947_0130354_63_497 | 141 |
| 360 | 3300042005 | Ga0439448_0146369 | Ga0439448_0146369_159_584 | 141 |
| 361 | 3300044684 | Ga0466966_0195557 | Ga0466966_0195557_418_858 | 141 |
| 362 | 3300044684 | Ga0466966_0289227 | Ga0466966_0289227_467_916 | 141 |
| 363 | 3300044693 | Ga0466961_0809079 | Ga0466961_0809079_95_544 | 141 |
| 364 | 3300044706 | Ga0466964_0383600 | Ga0466964_0383600_56_493 | 141 |
| 365 | 3300044765 | Ga0466970_0915480 | Ga0466970_0915480_62_496 | 141 |
| 366 | 3300044842 | Ga0466957_0024325 | Ga0466957_0024325_357_791 | 141 |
| 367 | 3300044901 | Ga0466960_0308830 | Ga0466960_0308830_38_475 | 141 |
| 368 | 3300045976 | Ga0466967_0004558 | Ga0466967_0004558_7575_8036 | 141 |
| 369 | 3300045976 | Ga0466967_0253973 | Ga0466967_0253973_408_848 | 141 |
| 370 | 3300045976 | Ga0466967_0287187 | Ga0466967_0287187_797_1231 | 141 |
| 371 | 3300045976 | Ga0466967_0654749 | Ga0466967_0654749_392_853 | 141 |
| 372 | 3300045976 | Ga0466967_0896065 | Ga0466967_0896065_346_807 | 141 |
| 373 | 3300045976 | Ga0466967_1708066 | Ga0466967_1708066_153_596 | 141 |
| 374 | 3300045976 | Ga0466967_2160359 | Ga0466967_2160359_52_486 | 141 |
| 375 | 3300046455 | Ga0495603_0266962 | Ga0495603_0266962_318_752 | 141 |
| 376 | 3300046457 | Ga0495590_0326072 | Ga0495590_0326072_71_505 | 141 |
| 377 | 3300046518 | Ga0495631_0309704 | Ga0495631_0309704_187_621 | 141 |
| 378 | 3300046542 | Ga0495597_0365612 | Ga0495597_0365612_38_472 | 141 |
| 379 | 3300046558 | Ga0495633_0350242 | Ga0495633_0350242_207_641 | 141 |
| 380 | 3300046616 | Ga0495668_0178981 | Ga0495668_0178981_82_516 | 141 |
| 381 | 3300046665 | Ga0495661_0379985 | Ga0495661_0379985_35_469 | 141 |
| 382 | 3300047323 | Ga0495683_0218882 | Ga0495683_0218882_304_738 | 141 |
| 383 | 3300048903 | Ga0496100_0196691 | Ga0496100_0196691_546_980 | 141 |
| 384 | 3300048903 | Ga0496100_0299483 | Ga0496100_0299483_210_644 | 141 |
| 385 | 3300048903 | Ga0496100_0462285 | Ga0496100_0462285_142_576 | 141 |
| 386 | 3300048904 | Ga0496101_0003399 | Ga0496101_0003399_507_941 | 141 |
| 387 | 3300048905 | Ga0496102_0048761 | Ga0496102_0048761_3366_3800 | 141 |
| 388 | 3300048907 | Ga0496104_1264076 | Ga0496104_1264076_50_484 | 141 |
| 389 | 3300048908 | Ga0496105_0045379 | Ga0496105_0045379_225_659 | 141 |
| 390 | 3300048908 | Ga0496105_0069852 | Ga0496105_0069852_1761_2195 | 141 |
| 391 | 3300048909 | Ga0496106_0034631 | Ga0496106_0034631_52_486 | 141 |
| 392 | 3300048909 | Ga0496106_0056624 | Ga0496106_0056624_1760_2194 | 141 |
| 393 | 3300048910 | Ga0496107_0001173 | Ga0496107_0001173_203_637 | 141 |
| 394 | 3300048911 | Ga0496108_0007985 | Ga0496108_0007985_5043_5477 | 141 |
| 395 | 3300048911 | Ga0496108_0056422 | Ga0496108_0056422_736_1170 | 141 |
| 396 | 3300048912 | Ga0496109_0009001 | Ga0496109_0009001_1244_1678 | 141 |
| 397 | 3300048913 | Ga0496110_0004818 | Ga0496110_0004818_9450_9884 | 141 |
| 398 | 3300048913 | Ga0496110_0048229 | Ga0496110_0048229_3153_3587 | 141 |
| 399 | 3300048913 | Ga0496110_0076930 | Ga0496110_0076930_2358_2792 | 141 |
| 400 | 3300048914 | Ga0496111_0062443 | Ga0496111_0062443_1396_1830 | 141 |
| 401 | 3300048915 | Ga0496112_0015182 | Ga0496112_0015182_5834_6268 | 141 |
| 402 | 3300048915 | Ga0496112_0071749 | Ga0496112_0071749_1520_1954 | 141 |
| 403 | 3300048915 | Ga0496112_0095569 | Ga0496112_0095569_260_694 | 141 |
| 404 | 3300048916 | Ga0496113_0224944 | Ga0496113_0224944_48_482 | 141 |
| 405 | 3300048916 | Ga0496113_0310077 | Ga0496113_0310077_639_1073 | 141 |
| 406 | 3300048916 | Ga0496113_1444560 | Ga0496113_1444560_59_499 | 141 |
| 407 | 3300048917 | Ga0496114_0339256 | Ga0496114_0339256_288_722 | 141 |
| 408 | 3300048917 | Ga0496114_1282599 | Ga0496114_1282599_137_571 | 141 |
| 409 | 3300048917 | Ga0496114_1610977 | Ga0496114_1610977_62_496 | 141 |
| 410 | 3300048918 | Ga0496115_0369204 | Ga0496115_0369204_670_1104 | 141 |
| 411 | 3300048918 | Ga0496115_0648940 | Ga0496115_0648940_154_588 | 141 |
| 412 | 3300048924 | Ga0496121_0014845 | Ga0496121_0014845_1714_2157 | 141 |
| 413 | 3300048924 | Ga0496121_0333225 | Ga0496121_0333225_459_893 | 141 |
| 414 | 3300049572 | Ga0501036_0189679 | Ga0501036_0189679_252_683 | 141 |
| 415 | 3300049572 | Ga0501036_0464455 | Ga0501036_0464455_83_607 | 141 |
| 416 | 3300049572 | Ga0501036_1182844 | Ga0501036_1182844_77_508 | 141 |
| 417 | 3300049573 | Ga0501037_0810425 | Ga0501037_0810425_84_515 | 141 |
| 418 | 3300049574 | Ga0501038_0211535 | Ga0501038_0211535_285_716 | 141 |
| 419 | 3300049575 | Ga0501039_0114186 | Ga0501039_0114186_1444_1875 | 141 |
| 420 | 3300049576 | Ga0501040_0050344 | Ga0501040_0050344_579_1010 | 141 |
| 421 | 3300049576 | Ga0501040_0079345 | Ga0501040_0079345_1448_1879 | 141 |
| 422 | 3300049577 | Ga0501041_0037128 | Ga0501041_0037128_2048_2479 | 141 |
| 423 | 3300049577 | Ga0501041_0042516 | Ga0501041_0042516_108_539 | 141 |
| 424 | 3300049578 | Ga0501042_0140529 | Ga0501042_0140529_531_962 | 141 |
| 425 | 3300049582 | Ga0501048_0088375 | Ga0501048_0088375_111_545 | 141 |
| 426 | 3300049582 | Ga0501048_0114348 | Ga0501048_0114348_1018_1449 | 141 |
| 427 | 3300049582 | Ga0501048_0393615 | Ga0501048_0393615_356_787 | 141 |
| 428 | 3300049583 | Ga0501067_0564362 | Ga0501067_0564362_41_478 | 141 |
| 429 | 3300049587 | Ga0501071_0239023 | Ga0501071_0239023_94_525 | 141 |
| 430 | 3300049587 | Ga0501071_0286740 | Ga0501071_0286740_698_1129 | 141 |
| 431 | 3300049588 | Ga0501072_0095937 | Ga0501072_0095937_164_595 | 141 |
| 432 | 3300049588 | Ga0501072_0723828 | Ga0501072_0723828_333_764 | 141 |
| 433 | 3300049590 | Ga0501074_0368532 | Ga0501074_0368532_202_633 | 141 |
| 434 | 3300049592 | Ga0501076_0120216 | Ga0501076_0120216_920_1351 | 141 |
| 435 | 3300049592 | Ga0501076_0355346 | Ga0501076_0355346_56_487 | 141 |
| 436 | 3300049741 | Ga0501079_0049942 | Ga0501079_0049942_1365_1796 | 141 |
| 437 | 3300049742 | Ga0501080_0139971 | Ga0501080_0139971_1090_1521 | 141 |
| 438 | 3300049744 | Ga0501083_0253383 | Ga0501083_0253383_171_602 | 141 |
| 439 | 3300049822 | Ga0501035_0549290 | Ga0501035_0549290_434_865 | 141 |
| 440 | 3300049823 | Ga0501044_0543280 | Ga0501044_0543280_30_488 | 141 |
| 441 | 3300049824 | Ga0501045_0031340 | Ga0501045_0031340_75_506 | 141 |
| 442 | 3300049824 | Ga0501045_0051448 | Ga0501045_0051448_661_1092 | 141 |
| 443 | 3300050507 | nmdc:mga05p37_489007_c1 | nmdc:mga05p37_489007_c1_281_706 | 141 |
| 444 | 3300050511 | nmdc:mga08y16_652570_c1 | nmdc:mga08y16_652570_c1_367_801 | 141 |
| 445 | 3300054114 | Ga0501084_0137302 | Ga0501084_0137302_353_784 | 141 |
| 446 | 3300054114 | Ga0501084_0236211 | Ga0501084_0236211_112_591 | 141 |
| 447 | 3300054114 | Ga0501084_1786349 | Ga0501084_1786349_59_490 | 141 |
| 448 | 3300060353 | Ga0501082_0024168 | Ga0501082_0024168_3581_4012 | 141 |
| 449 | 3300061719 | Ga0466962_0117270 | Ga0466962_0117270_681_1115 | 141 |
| 450 | 3300061734 | Ga0530510_0236821 | Ga0530510_0236821_888_1319 | 141 |
| 451 | 3300061734 | Ga0530510_0246095 | Ga0530510_0246095_502_981 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1z6r-assembly1.cif.gz_A | crystal structure of mlc from escherichia coli | 0.9436 | 36 | 79 |
| 5duk-assembly1.cif.gz_A | n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 | 0.9363 | 35 | 85 |
| 5duk-assembly1.cif.gz_B | n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 | 0.931 | 35 | 85 |
| 4yif-assembly2.cif.gz_D | crystal structure of rv0880 | 0.9291 | 7 | 141 |
| 4yif-assembly3.cif.gz_E | crystal structure of rv0880 | 0.9266 | 6 | 141 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9559 | 32 | 93 | 1.10.10.10 |
| af_P71699_45_188_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9445 | 7 | 136 | 1.10.10.10 |
| af_B4FTK6_47_112_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9442 | 33 | 95 | 1.10.10.10 |
| 1s3jB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9422 | 32 | 95 | 1.10.10.10 |
| 5dukB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9399 | 35 | 79 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1DYQ5-F1-model_v4 | MarR family transcriptional regulator | 0.9828 | 7 | 138 |
GO:0003700
|
| AF-F1YGT6-F1-model_v4 | Regulatory protein MarR | 0.9818 | 12 | 139 |
GO:0003700
|
| AF-A0A537ZMV1-F1-model_v4 | MarR family transcriptional regulator | 0.9813 | 7 | 140 |
GO:0003700
|
| AF-A0A6N2DSB8-F1-model_v4 | MarR family transcriptional regulator | 0.9797 | 9 | 140 |
GO:0003700
|
| AF-A0A7V8VJY3-F1-model_v4 | MarR family transcriptional regulator | 0.9776 | 9 | 140 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar