F446742

General Info

Members Datasets Scaffolds Average Seq Length
451 210 451 143

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10380064|Ga0070681_103800642
Length 162
Sequence MPTTSAPPLAPRLRFAVTRTARRLRQEAGGGLSPTLNAALATVAGHGPLTPSELAARERIQRPTATRLIAKLEADGLVARTADPADGRSFLIAATADGAALIQELRTRKDAFLAARLRRLPSEDRAVLARAAELLEDLLEGDQEGPEAQRRDRGAGPDASRR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 11.09
Rhizosphere 88.25
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10101872 3300003203 Bacteria 856
2 Ga0070683_100106867 3300005329 Bacteria 2639
3 Ga0070683_100110024 3300005329 Bacteria 2599
4 Ga0070683_100361980 3300005329 Bacteria 1381
5 Ga0070683_100653440 3300005329 Bacteria 1007
6 Ga0070683_101059449 3300005329 Unclassified 779
7 Ga0070683_101934758 3300005329 Bacteria 567
8 Ga0070690_100738624 3300005330 Bacteria 759
9 Ga0070690_100783733 3300005330 Unclassified 738
10 Ga0070670_101148865 3300005331 Bacteria 709
11 Ga0068869_100774947 3300005334 Unclassified 823
12 Ga0070682_100788644 3300005337 Bacteria 771
13 Ga0070682_100990374 3300005337 Unclassified 697
14 Ga0070682_102035170 3300005337 Unclassified 506
15 Ga0068868_100094092 3300005338 Bacteria 2417
16 Ga0068868_100096874 3300005338 Bacteria 2383
17 Ga0068868_100332177 3300005338 Bacteria 1298
18 Ga0068868_100410242 3300005338 Bacteria 1171
19 Ga0068868_101052727 3300005338 Bacteria 747
20 Ga0070660_100080791 3300005339 Bacteria 2552
21 Ga0070691_10589603 3300005341 Unclassified 655
22 Ga0070687_100070541 3300005343 Bacteria 1875
23 Ga0070687_100116308 3300005343 Unclassified 1522
24 Ga0070661_100443551 3300005344 Bacteria 1032
25 Ga0070661_100503410 3300005344 Bacteria 970
26 Ga0070692_10028758 3300005345 Unclassified 2765
27 Ga0070692_11031675 3300005345 Unclassified 577
28 Ga0070675_100484490 3300005354 Unclassified 1113
29 Ga0070675_102169449 3300005354 Unclassified 512
30 Ga0070674_101246057 3300005356 Bacteria 662
31 Ga0070673_101622855 3300005364 Bacteria 611
32 Ga0070673_102059069 3300005364 Bacteria 542
33 Ga0070659_100479572 3300005366 Bacteria 1058
34 Ga0070667_100428579 3300005367 Bacteria 1206
35 Ga0070667_100467606 3300005367 Bacteria 1153
36 Ga0070667_101779089 3300005367 Bacteria 580
37 Ga0070701_10041840 3300005438 Bacteria 2336
38 Ga0070701_10850908 3300005438 Bacteria 626
39 Ga0070705_100300943 3300005440 Unclassified 1149
40 Ga0070700_100077271 3300005441 Bacteria 2140
41 Ga0070700_101297645 3300005441 Bacteria 612
42 Ga0070694_100018268 3300005444 Bacteria 4449
43 Ga0070694_100179976 3300005444 Bacteria 1563
44 Ga0070708_100979409 3300005445 Bacteria 793
45 Ga0070663_100121582 3300005455 Bacteria 1973
46 Ga0070663_100573403 3300005455 Bacteria 946
47 Ga0070663_100629611 3300005455 Bacteria 905
48 Ga0070678_100327437 3300005456 Bacteria 1310
49 Ga0070678_100469907 3300005456 Bacteria 1105
50 Ga0070662_100874358 3300005457 Unclassified 766
51 Ga0070681_10380064 3300005458 Bacteria 1323
52 Ga0068867_100143935 3300005459 Bacteria 1866
53 Ga0068867_100565513 3300005459 Bacteria 987
54 Ga0070685_10081978 3300005466 Bacteria 1935
55 Ga0070679_101266977 3300005530 Bacteria 683
56 Ga0070684_100151401 3300005535 Bacteria 2102
57 Ga0070684_100161488 3300005535 Archaea 2033
58 Ga0070684_100262933 3300005535 Bacteria 1578
59 Ga0070684_100401289 3300005535 Unclassified 1264
60 Ga0070684_100802457 3300005535 Unclassified 880
61 Ga0070684_100818948 3300005535 Bacteria 871
62 Ga0070684_100920004 3300005535 Bacteria 820
63 Ga0070684_101441661 3300005535 Unclassified 649
64 Ga0068853_100174425 3300005539 Unclassified 1947
65 Ga0068853_101940462 3300005539 Unclassified 571
66 Ga0070672_100157140 3300005543 Bacteria 1884
67 Ga0070686_100593692 3300005544 Bacteria 872
68 Ga0070686_100757415 3300005544 Bacteria 779
69 Ga0070686_100874943 3300005544 Bacteria 729
70 Ga0070686_101184314 3300005544 Bacteria 634
71 Ga0070686_101349224 3300005544 Bacteria 597
72 Ga0070696_100763304 3300005546 Bacteria 793
73 Ga0070696_101300182 3300005546 Bacteria 617
74 Ga0070693_100546744 3300005547 Bacteria 828
75 Ga0070665_100193554 3300005548 Bacteria 2034
76 Ga0070665_100445902 3300005548 Bacteria 1304
77 Ga0070665_101038099 3300005548 Bacteria 832
78 Ga0070704_100022917 3300005549 Bacteria 4069
79 Ga0070704_101171106 3300005549 Bacteria 700
80 Ga0068855_100362868 3300005563 Bacteria 1594
81 Ga0070664_100758021 3300005564 Bacteria 906
82 Ga0070664_101528933 3300005564 Bacteria 632
83 Ga0070664_101905170 3300005564 Bacteria 564
84 Ga0068857_100119224 3300005577 Bacteria 2375
85 Ga0068857_100219273 3300005577 Bacteria 1737
86 Ga0068857_101392164 3300005577 Bacteria 682
87 Ga0068856_100260586 3300005614 Bacteria 1749
88 Ga0068856_100277488 3300005614 Bacteria 1692
89 Ga0068856_100512733 3300005614 Bacteria 1220
90 Ga0070702_100014950 3300005615 Bacteria 3950
91 Ga0070702_100404069 3300005615 Bacteria 978
92 Ga0068852_100128722 3300005616 Bacteria 2329
93 Ga0068852_101374807 3300005616 Bacteria 728
94 Ga0068859_100239550 3300005617 Bacteria 1903
95 Ga0068859_101220706 3300005617 Bacteria 828
96 Ga0068859_101739011 3300005617 Bacteria 689
97 Ga0068864_100189013 3300005618 Bacteria 1887
98 Ga0068864_100327500 3300005618 Bacteria 1440
99 Ga0068864_100385016 3300005618 Bacteria 1330
100 Ga0068864_100448824 3300005618 Bacteria 1233
101 Ga0068866_11064974 3300005718 Bacteria 578
102 Ga0068861_102539909 3300005719 Unclassified 516
103 Ga0068851_10884872 3300005834 Bacteria 559
104 Ga0068863_100570794 3300005841 Bacteria 1118
105 Ga0068863_100630084 3300005841 Bacteria 1063
106 Ga0068858_100359236 3300005842 Bacteria 1396
107 Ga0068858_100458532 3300005842 Bacteria 1229
108 Ga0068860_100052827 3300005843 Bacteria 3864
109 Ga0068862_100204669 3300005844 Bacteria 1781
110 Ga0068862_100357853 3300005844 Bacteria 1356
111 Ga0081455_10038969 3300005937 Bacteria 4204
112 Ga0081455_10112345 3300005937 Bacteria 2162
113 Ga0081455_10211304 3300005937 Bacteria 1445
114 Ga0081538_10010378 3300005981 Bacteria 7637
115 Ga0081538_10042074 3300005981 Bacteria 2889
116 Ga0081538_10128134 3300005981 Bacteria 1200
117 Ga0081540_1000006 3300005983 Bacteria 208724
118 Ga0081539_10030265 3300005985 Bacteria 3365
119 Ga0075365_10724305 3300006038 Bacteria 702
120 Ga0097621_102244562 3300006237 Bacteria 522
121 Ga0068871_101036507 3300006358 Bacteria 765
122 Ga0075434_101501561 3300006871 Unclassified 683
123 Ga0075429_101241438 3300006880 Bacteria 650
124 Ga0068865_100347783 3300006881 Unclassified 1200
125 Ga0068865_100544614 3300006881 Unclassified 974
126 Ga0068865_100934468 3300006881 Bacteria 756
127 Ga0068865_100977575 3300006881 Bacteria 740
128 Ga0097620_100239532 3300006931 Bacteria 1903
129 Ga0097620_101220763 3300006931 Bacteria 828
130 Ga0097620_101739083 3300006931 Bacteria 689
131 Ga0111539_10272865 3300009094 Bacteria 1968
132 Ga0111539_10431620 3300009094 Bacteria 1534
133 Ga0105245_10142928 3300009098 Bacteria 2255
134 Ga0105245_10272739 3300009098 Bacteria 1650
135 Ga0105245_10540138 3300009098 Bacteria 1187
136 Ga0105245_10743675 3300009098 Bacteria 1016
137 Ga0105245_10821878 3300009098 Bacteria 968
138 Ga0105245_11879451 3300009098 Unclassified 652
139 Ga0105245_12361527 3300009098 Unclassified 585
140 Ga0114129_10731041 3300009147 Unclassified 1269
141 Ga0105243_10057894 3300009148 Bacteria 3087
142 Ga0105243_10190339 3300009148 Bacteria 1792
143 Ga0105243_10212892 3300009148 Unclassified 1703
144 Ga0105243_10364474 3300009148 Bacteria 1331
145 Ga0105243_12393126 3300009148 Bacteria 566
146 Ga0105242_10868899 3300009176 Bacteria 899
147 Ga0105242_13235296 3300009176 Bacteria 506
148 Ga0105248_10596890 3300009177 Unclassified 1246
149 Ga0105249_10021190 3300009553 Bacteria 5819
150 Ga0105249_10508550 3300009553 Bacteria 1251
151 Ga0105249_10912239 3300009553 Bacteria 946
152 Ga0105249_11709649 3300009553 Bacteria 702
153 Ga0105239_10436047 3300010375 Bacteria 1485
154 Ga0105239_11096772 3300010375 Unclassified 916
155 Ga0105246_10214180 3300011119 Bacteria 1505
156 Ga0105246_10409376 3300011119 Bacteria 1128
157 Ga0105246_11237194 3300011119 Bacteria 689
158 Ga0105246_11673274 3300011119 Bacteria 604
159 Ga0157369_10395982 3300013105 Bacteria 1433
160 Ga0157369_10820974 3300013105 Bacteria 955
161 Ga0157369_12497275 3300013105 Bacteria 523
162 Ga0157374_10279147 3300013296 Bacteria 1649
163 Ga0163162_10283293 3300013306 Bacteria 1789
164 Ga0163162_10374360 3300013306 Bacteria 1557
165 Ga0157375_10012714 3300013308 Bacteria 7470
166 Ga0157375_11667960 3300013308 Unclassified 754
167 Ga0157380_11188470 3300014326 Bacteria 806
168 Ga0182008_10219942 3300014497 Unclassified 971
169 Ga0157377_10071222 3300014745 Bacteria 2010
170 Ga0157377_10105779 3300014745 Bacteria 1684
171 Ga0157377_10131947 3300014745 Bacteria 1527
172 Ga0157377_10176431 3300014745 Bacteria 1340
173 Ga0157377_10183759 3300014745 Bacteria 1317
174 Ga0157377_10562862 3300014745 Bacteria 807
175 Ga0157379_10672635 3300014968 Bacteria 970
176 Ga0157376_10094985 3300014969 Bacteria 2592
177 Ga0206353_10709368 3300020082 Bacteria 1385
178 Ga0207642_10512148 3300025899 Bacteria 736
179 Ga0207688_10285213 3300025901 Bacteria 1007
180 Ga0207688_10335933 3300025901 Bacteria 929
181 Ga0207647_10178069 3300025904 Bacteria 1236
182 Ga0207705_10796867 3300025909 Unclassified 733
183 Ga0207707_10306328 3300025912 Bacteria 1373
184 Ga0207662_10136766 3300025918 Unclassified 1549
185 Ga0207662_10142067 3300025918 Bacteria 1521
186 Ga0207662_10361868 3300025918 Bacteria 976
187 Ga0207652_10094906 3300025921 Bacteria 2627
188 Ga0207652_10767594 3300025921 Bacteria 857
189 Ga0207659_10476576 3300025926 Unclassified 1054
190 Ga0207659_11675838 3300025926 Unclassified 542
191 Ga0207687_11455129 3300025927 Bacteria 589
192 Ga0207690_10192990 3300025932 Bacteria 1541
193 Ga0207690_11072754 3300025932 Bacteria 671
194 Ga0207690_11182603 3300025932 Unclassified 638
195 Ga0207706_10030475 3300025933 Bacteria 4811
196 Ga0207706_10248668 3300025933 Bacteria 1554
197 Ga0207706_10406503 3300025933 Bacteria 1180
198 Ga0207686_11039344 3300025934 Unclassified 666
199 Ga0207709_10081822 3300025935 Bacteria 2083
200 Ga0207709_10094195 3300025935 Bacteria 1965
201 Ga0207709_10214647 3300025935 Bacteria 1383
202 Ga0207709_10273776 3300025935 Bacteria 1244
203 Ga0207709_10305093 3300025935 Bacteria 1185
204 Ga0207669_10895315 3300025937 Bacteria 741
205 Ga0207669_11618762 3300025937 Bacteria 553
206 Ga0207704_10339116 3300025938 Unclassified 1166
207 Ga0207665_10802963 3300025939 Bacteria 744
208 Ga0207691_10259478 3300025940 Bacteria 1498
209 Ga0207661_10042152 3300025944 Bacteria 3598
210 Ga0207661_10149318 3300025944 Bacteria 2019
211 Ga0207661_10207608 3300025944 Bacteria 1725
212 Ga0207661_11410186 3300025944 Unclassified 639
213 Ga0207679_10172974 3300025945 Bacteria 1780
214 Ga0207679_10359717 3300025945 Bacteria 1271
215 Ga0207679_10581835 3300025945 Unclassified 1007
216 Ga0207651_10239140 3300025960 Bacteria 1479
217 Ga0207651_10652633 3300025960 Bacteria 924
218 Ga0207651_10876359 3300025960 Bacteria 799
219 Ga0207712_10336708 3300025961 Bacteria 1250
220 Ga0207712_10542976 3300025961 Bacteria 999
221 Ga0207712_11580865 3300025961 Bacteria 588
222 Ga0207640_10436941 3300025981 Bacteria 1075
223 Ga0207658_10257015 3300025986 Bacteria 1487
224 Ga0207658_10914353 3300025986 Bacteria 799
225 Ga0207677_10072272 3300026023 Bacteria 2438
226 Ga0207677_10730221 3300026023 Bacteria 881
227 Ga0207677_11368661 3300026023 Bacteria 651
228 Ga0207703_10263013 3300026035 Bacteria 1560
229 Ga0207703_11616416 3300026035 Unclassified 623
230 Ga0207703_11703626 3300026035 Unclassified 606
231 Ga0207703_11975853 3300026035 Unclassified 559
232 Ga0207678_10461549 3300026067 Unclassified 1105
233 Ga0207678_10582900 3300026067 Bacteria 980
234 Ga0207678_11357019 3300026067 Bacteria 629
235 Ga0207708_10226863 3300026075 Bacteria 1498
236 Ga0207708_10702192 3300026075 Bacteria 865
237 Ga0207702_10172480 3300026078 Bacteria 1985
238 Ga0207702_10446161 3300026078 Bacteria 1255
239 Ga0207702_10551470 3300026078 Bacteria 1127
240 Ga0207641_10328123 3300026088 Bacteria 1453
241 Ga0207641_10640256 3300026088 Bacteria 1044
242 Ga0207648_10345146 3300026089 Bacteria 1341
243 Ga0207676_10060920 3300026095 Bacteria 2987
244 Ga0207676_10128359 3300026095 Bacteria 2152
245 Ga0207676_10262578 3300026095 Bacteria 1560
246 Ga0207676_10914816 3300026095 Bacteria 861
247 Ga0207676_12218689 3300026095 Bacteria 547
248 Ga0207674_10312258 3300026116 Bacteria 1521
249 Ga0207674_10751461 3300026116 Bacteria 941
250 Ga0207675_100096903 3300026118 Bacteria 2777
251 Ga0207675_100414125 3300026118 Bacteria 1330
252 Ga0207675_100770609 3300026118 Bacteria 974
253 Ga0207675_101592500 3300026118 Bacteria 674
254 Ga0207683_10012992 3300026121 Bacteria 7108
255 Ga0207683_10368952 3300026121 Bacteria 1319
256 Ga0207683_10393444 3300026121 Bacteria 1274
257 Ga0207698_10290471 3300026142 Bacteria 1517
258 Ga0207698_10779290 3300026142 Bacteria 957
259 Ga0207698_10990098 3300026142 Unclassified 851
260 Ga0207698_11641544 3300026142 Bacteria 658
261 Ga0207698_12034588 3300026142 Bacteria 588
262 Ga0207428_10124064 3300027907 Bacteria 1978
263 Ga0268266_10226284 3300028379 Bacteria 1721
264 Ga0268266_10394743 3300028379 Bacteria 1307
265 Ga0268265_10351098 3300028380 Bacteria 1347
266 Ga0268265_11358841 3300028380 Bacteria 712
267 Ga0268264_10120710 3300028381 Bacteria 2309
268 Ga0307408_101022563 3300031548 Bacteria 763
269 Ga0307405_10128068 3300031731 Bacteria 1749
270 Ga0307405_11875699 3300031731 Bacteria 534
271 Ga0307413_10149416 3300031824 Bacteria 1626
272 Ga0307410_10036790 3300031852 Bacteria 3191
273 Ga0307410_10316886 3300031852 Bacteria 1236
274 Ga0307406_10029453 3300031901 Bacteria 3325
275 Ga0307406_10411712 3300031901 Bacteria 1075
276 Ga0307406_10427822 3300031901 Bacteria 1056
277 Ga0307406_10461235 3300031901 Unclassified 1022
278 Ga0307406_11462457 3300031901 Bacteria 600
279 Ga0307407_10043949 3300031903 Bacteria 2515
280 Ga0307407_10069290 3300031903 Bacteria 2093
281 Ga0307407_10384351 3300031903 Bacteria 1003
282 Ga0307412_10121551 3300031911 Bacteria 1881
283 Ga0307412_10678734 3300031911 Bacteria 882
284 Ga0307409_100020771 3300031995 Bacteria 4484
285 Ga0307409_100053464 3300031995 Bacteria 3103
286 Ga0307409_100465476 3300031995 Bacteria 1223
287 Ga0307409_100596051 3300031995 Bacteria 1091
288 Ga0307409_100916605 3300031995 Bacteria 891
289 Ga0307416_100076056 3300032002 Bacteria 2812
290 Ga0307416_103545784 3300032002 Bacteria 522
291 Ga0307414_10093484 3300032004 Bacteria 2242
292 Ga0307411_10137461 3300032005 Bacteria 1797
293 Ga0307411_10208029 3300032005 Bacteria 1508
294 Ga0307411_10511917 3300032005 Bacteria 1017
295 Ga0307411_11471289 3300032005 Bacteria 625
296 Ga0307415_100004172 3300032126 Bacteria 7458
297 Ga0307415_100025264 3300032126 Bacteria 3724
298 Ga0307415_100110453 3300032126 Bacteria 2039
299 Ga0307415_100220051 3300032126 Bacteria 1521
300 Ga0307415_100285887 3300032126 Bacteria 1359
301 Ga0307415_101110287 3300032126 Bacteria 741
302 Ga0373944_0210051 3300035089 Bacteria 707
303 Ga0373945_0124707 3300035116 Bacteria 1027
304 Ga0373946_0311956 3300035171 Bacteria 780
305 Ga0373947_0130354 3300035725 Bacteria 1605
306 Ga0373947_0187436 3300035725 Bacteria 1349
307 Ga0373925_0082477 3300037068 Bacteria 2447
308 Ga0439448_0146369 3300042005 Bacteria 819
309 Ga0466966_0195557 3300044684 Bacteria 1224
310 Ga0466966_0289227 3300044684 Bacteria 985
311 Ga0466961_0809079 3300044693 Unclassified 559
312 Ga0466964_0081614 3300044706 Bacteria 1389
313 Ga0466964_0383600 3300044706 Bacteria 730
314 Ga0466970_0915480 3300044765 Bacteria 516
315 Ga0466957_0024325 3300044842 Bacteria 3583
316 Ga0466960_0308830 3300044901 Bacteria 893
317 Ga0466960_0491501 3300044901 Unclassified 718
318 Ga0466967_0004123 3300045976 Bacteria 9710
319 Ga0466967_0004558 3300045976 Bacteria 9382
320 Ga0466967_0253973 3300045976 Bacteria 1680
321 Ga0466967_0287187 3300045976 Bacteria 1579
322 Ga0466967_0654749 3300045976 Bacteria 1039
323 Ga0466967_0896065 3300045976 Bacteria 882
324 Ga0466967_1708066 3300045976 Bacteria 627
325 Ga0466967_2160359 3300045976 Bacteria 553
326 Ga0495603_0266962 3300046455 Bacteria 985
327 Ga0495590_0326072 3300046457 Bacteria 581
328 Ga0495629_0237333 3300046459 Bacteria 1256
329 Ga0495582_0145619 3300046473 Bacteria 1344
330 Ga0495606_0351789 3300046507 Bacteria 782
331 Ga0495618_0252180 3300046514 Bacteria 1107
332 Ga0495620_0161640 3300046515 Bacteria 870
333 Ga0495631_0046374 3300046518 Bacteria 1911
334 Ga0495631_0309704 3300046518 Bacteria 672
335 Ga0495631_0520187 3300046518 Bacteria 507
336 Ga0495644_0293371 3300046523 Bacteria 636
337 Ga0495640_0133783 3300046533 Bacteria 1603
338 Ga0495597_0365612 3300046542 Bacteria 552
339 Ga0495633_0350242 3300046558 Bacteria 669
340 Ga0495668_0178981 3300046616 Bacteria 1162
341 Ga0495661_0379985 3300046665 Bacteria 690
342 Ga0495674_0818306 3300047319 Bacteria 723
343 Ga0495683_0218882 3300047323 Bacteria 850
344 Ga0496100_0196691 3300048903 Bacteria 1467
345 Ga0496100_0299483 3300048903 Bacteria 1203
346 Ga0496100_0462285 3300048903 Bacteria 974
347 Ga0496100_0689682 3300048903 Bacteria 797
348 Ga0496101_0003399 3300048904 Bacteria 9929
349 Ga0496102_0048761 3300048905 Bacteria 3851
350 Ga0496102_0366172 3300048905 Bacteria 1357
351 Ga0496104_0862775 3300048907 Bacteria 810
352 Ga0496104_1264076 3300048907 Unclassified 641
353 Ga0496105_0045379 3300048908 Bacteria 3626
354 Ga0496105_0069852 3300048908 Bacteria 2903
355 Ga0496105_0103470 3300048908 Bacteria 2351
356 Ga0496105_1250364 3300048908 Bacteria 544
357 Ga0496106_0034631 3300048909 Bacteria 3772
358 Ga0496106_0056624 3300048909 Bacteria 2964
359 Ga0496106_0172868 3300048909 Bacteria 1713
360 Ga0496106_0273060 3300048909 Bacteria 1354
361 Ga0496106_0482087 3300048909 Bacteria 996
362 Ga0496107_0001173 3300048910 Bacteria 15902
363 Ga0496108_0007985 3300048911 Bacteria 8584
364 Ga0496108_0029165 3300048911 Bacteria 4568
365 Ga0496108_0056422 3300048911 Bacteria 3300
366 Ga0496108_0278337 3300048911 Bacteria 1457
367 Ga0496108_0846677 3300048911 Bacteria 787
368 Ga0496109_0009001 3300048912 Bacteria 8502
369 Ga0496109_0050912 3300048912 Bacteria 3771
370 Ga0496109_0540673 3300048912 Bacteria 1099
371 Ga0496110_0004818 3300048913 Bacteria 10511
372 Ga0496110_0048229 3300048913 Bacteria 3733
373 Ga0496110_0076930 3300048913 Bacteria 2968
374 Ga0496110_0816049 3300048913 Bacteria 837
375 Ga0496111_0017188 3300048914 Bacteria 4997
376 Ga0496111_0062443 3300048914 Bacteria 2701
377 Ga0496111_0223822 3300048914 Bacteria 1398
378 Ga0496111_0263196 3300048914 Bacteria 1280
379 Ga0496112_0015182 3300048915 Bacteria 7178
380 Ga0496112_0052792 3300048915 Bacteria 3990
381 Ga0496112_0071749 3300048915 Bacteria 3423
382 Ga0496112_0095569 3300048915 Bacteria 2942
383 Ga0496112_0441158 3300048915 Bacteria 1240
384 Ga0496113_0023382 3300048916 Bacteria 4382
385 Ga0496113_0224944 3300048916 Bacteria 1496
386 Ga0496113_0310077 3300048916 Bacteria 1264
387 Ga0496113_0933046 3300048916 Bacteria 686
388 Ga0496113_1444560 3300048916 Unclassified 532
389 Ga0496114_0339256 3300048917 Bacteria 1329
390 Ga0496114_1282599 3300048917 Bacteria 619
391 Ga0496114_1610977 3300048917 Unclassified 537
392 Ga0496115_0369204 3300048918 Bacteria 1168
393 Ga0496115_0648940 3300048918 Bacteria 834
394 Ga0496121_0014845 3300048924 Bacteria 8219
395 Ga0496121_0333225 3300048924 Unclassified 1017
396 Ga0501031_0087384 3300049568 Bacteria 2033
397 Ga0501036_0169403 3300049572 Bacteria 1840
398 Ga0501036_0189679 3300049572 Bacteria 1730
399 Ga0501036_0464455 3300049572 Bacteria 1054
400 Ga0501036_1182844 3300049572 Unclassified 623
401 Ga0501037_0231023 3300049573 Bacteria 1299
402 Ga0501037_0810425 3300049573 Bacteria 618
403 Ga0501038_0211535 3300049574 Bacteria 1551
404 Ga0501039_0114186 3300049575 Bacteria 2113
405 Ga0501039_0120813 3300049575 Bacteria 2053
406 Ga0501040_0050344 3300049576 Bacteria 2849
407 Ga0501040_0079345 3300049576 Bacteria 2272
408 Ga0501040_0522020 3300049576 Unclassified 856
409 Ga0501041_0037128 3300049577 Bacteria 2951
410 Ga0501041_0042516 3300049577 Bacteria 2762
411 Ga0501041_0201956 3300049577 Bacteria 1246
412 Ga0501042_0140512 3300049578 Bacteria 1741
413 Ga0501042_0140529 3300049578 Bacteria 1741
414 Ga0501046_0123792 3300049580 Bacteria 1966
415 Ga0501048_0088375 3300049582 Bacteria 2186
416 Ga0501048_0104274 3300049582 Bacteria 2001
417 Ga0501048_0114348 3300049582 Bacteria 1906
418 Ga0501048_0393615 3300049582 Bacteria 990
419 Ga0501067_0564362 3300049583 Bacteria 638
420 Ga0501071_0239023 3300049587 Bacteria 1369
421 Ga0501071_0286740 3300049587 Bacteria 1246
422 Ga0501072_0062636 3300049588 Bacteria 2934
423 Ga0501072_0095937 3300049588 Bacteria 2357
424 Ga0501072_0723828 3300049588 Bacteria 781
425 Ga0501074_0368532 3300049590 Bacteria 1019
426 Ga0501075_0236140 3300049591 Bacteria 1394
427 Ga0501076_0120216 3300049592 Bacteria 2127
428 Ga0501076_0355346 3300049592 Bacteria 1203
429 Ga0501079_0049942 3300049741 Bacteria 3229
430 Ga0501080_0139971 3300049742 Bacteria 2237
431 Ga0501081_0072929 3300049743 Bacteria 2394
432 Ga0501083_0253383 3300049744 Bacteria 1146
433 Ga0501035_0549290 3300049822 Bacteria 946
434 Ga0501044_0543280 3300049823 Bacteria 1060
435 Ga0501045_0031340 3300049824 Bacteria 3851
436 Ga0501045_0051448 3300049824 Bacteria 3006
437 nmdc:mga05p37_489007_c1 3300050507 Bacteria 1415
438 nmdc:mga08y16_465168_c1 3300050511 Bacteria 1288
439 nmdc:mga08y16_652570_c1 3300050511 Bacteria 1056
440 nmdc:mga08y16_853779_c1 3300050511 Bacteria 899
441 nmdc:mga0n895_812931_c1 3300050512 Bacteria 924
442 Ga0495601_0120201 3300053077 Bacteria 1706
443 Ga0495619_0181811 3300053085 Bacteria 1455
444 Ga0501084_0137302 3300054114 Bacteria 2058
445 Ga0501084_0236211 3300054114 Bacteria 1543
446 Ga0501084_1786349 3300054114 Unclassified 513
447 Ga0501082_0024168 3300060353 Bacteria 5241
448 Ga0501082_0254756 3300060353 Bacteria 1527
449 Ga0466962_0117270 3300061719 Bacteria 1283
450 Ga0530510_0236821 3300061734 Bacteria 1358
451 Ga0530510_0246095 3300061734 Bacteria 1332

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100783733 Ga0070690_1007837332 121
2 3300005440 Ga0070705_100300943 Ga0070705_1003009432 121
3 3300014969 Ga0157376_10094985 Ga0157376_100949854 121
4 3300026121 Ga0207683_10012992 Ga0207683_100129923 121
5 3300005329 Ga0070683_100106867 Ga0070683_1001068672 124
6 3300005367 Ga0070667_100467606 Ga0070667_1004676062 124
7 3300005577 Ga0068857_100119224 Ga0068857_1001192243 124
8 3300009148 Ga0105243_10190339 Ga0105243_101903393 124
9 3300025935 Ga0207709_10214647 Ga0207709_102146472 124
10 3300025986 Ga0207658_10914353 Ga0207658_109143532 124
11 3300048916 Ga0496113_0933046 Ga0496113_0933046_163_597 124
12 3300013296 Ga0157374_10279147 Ga0157374_102791472 130
13 3300005544 Ga0070686_101184314 Ga0070686_1011843141 131
14 3300025945 Ga0207679_10581835 Ga0207679_105818352 131
15 3300020082 Ga0206353_10709368 Ga0206353_107093682 132
16 3300044706 Ga0466964_0081614 Ga0466964_0081614_785_1219 133
17 3300045976 Ga0466967_0004123 Ga0466967_0004123_3583_4017 133
18 3300046518 Ga0495631_0520187 Ga0495631_0520187_61_471 133
19 3300044901 Ga0466960_0491501 Ga0466960_0491501_234_659 136
20 3300005343 Ga0070687_100116308 Ga0070687_1001163082 138
21 3300005345 Ga0070692_10028758 Ga0070692_100287582 138
22 3300005367 Ga0070667_100428579 Ga0070667_1004285792 138
23 3300005444 Ga0070694_100018268 Ga0070694_1000182683 138
24 3300005444 Ga0070694_100179976 Ga0070694_1001799762 138
25 3300005445 Ga0070708_100979409 Ga0070708_1009794092 138
26 3300005539 Ga0068853_100174425 Ga0068853_1001744253 138
27 3300005544 Ga0070686_100593692 Ga0070686_1005936922 138
28 3300005544 Ga0070686_100874943 Ga0070686_1008749432 138
29 3300005544 Ga0070686_101349224 Ga0070686_1013492241 138
30 3300005549 Ga0070704_100022917 Ga0070704_1000229172 138
31 3300005563 Ga0068855_100362868 Ga0068855_1003628683 138
32 3300005564 Ga0070664_100758021 Ga0070664_1007580211 138
33 3300005614 Ga0068856_100260586 Ga0068856_1002605862 138
34 3300005614 Ga0068856_100512733 Ga0068856_1005127332 138
35 3300005618 Ga0068864_100189013 Ga0068864_1001890132 138
36 3300005843 Ga0068860_100052827 Ga0068860_1000528273 138
37 3300005844 Ga0068862_100357853 Ga0068862_1003578532 138
38 3300005981 Ga0081538_10042074 Ga0081538_100420744 138
39 3300006881 Ga0068865_100977575 Ga0068865_1009775751 138
40 3300009098 Ga0105245_10743675 Ga0105245_107436752 138
41 3300009553 Ga0105249_10021190 Ga0105249_100211904 138
42 3300010375 Ga0105239_10436047 Ga0105239_104360472 138
43 3300011119 Ga0105246_11673274 Ga0105246_116732742 138
44 3300013306 Ga0163162_10374360 Ga0163162_103743602 138
45 3300013308 Ga0157375_10012714 Ga0157375_100127145 138
46 3300014745 Ga0157377_10071222 Ga0157377_100712221 138
47 3300014745 Ga0157377_10183759 Ga0157377_101837592 138
48 3300014968 Ga0157379_10672635 Ga0157379_106726352 138
49 3300025904 Ga0207647_10178069 Ga0207647_101780692 138
50 3300025918 Ga0207662_10136766 Ga0207662_101367662 138
51 3300025918 Ga0207662_10361868 Ga0207662_103618682 138
52 3300025937 Ga0207669_11618762 Ga0207669_116187621 138
53 3300025960 Ga0207651_10239140 Ga0207651_102391402 138
54 3300025986 Ga0207658_10257015 Ga0207658_102570153 138
55 3300026078 Ga0207702_10446161 Ga0207702_104461612 138
56 3300026078 Ga0207702_10551470 Ga0207702_105514702 138
57 3300026095 Ga0207676_10060920 Ga0207676_100609203 138
58 3300026118 Ga0207675_101592500 Ga0207675_1015925002 138
59 3300028380 Ga0268265_11358841 Ga0268265_113588411 138
60 3300028381 Ga0268264_10120710 Ga0268264_101207102 138
61 3300031731 Ga0307405_11875699 Ga0307405_118756991 138
62 3300031852 Ga0307410_10036790 Ga0307410_100367902 138
63 3300031901 Ga0307406_10427822 Ga0307406_104278222 138
64 3300031903 Ga0307407_10043949 Ga0307407_100439492 138
65 3300031911 Ga0307412_10121551 Ga0307412_101215512 138
66 3300031995 Ga0307409_100020771 Ga0307409_1000207713 138
67 3300032004 Ga0307414_10093484 Ga0307414_100934842 138
68 3300032005 Ga0307411_10208029 Ga0307411_102080292 138
69 3300032126 Ga0307415_100220051 Ga0307415_1002200511 138
70 3300035116 Ga0373945_0124707 Ga0373945_0124707_171_605 138
71 3300035171 Ga0373946_0311956 Ga0373946_0311956_230_664 138
72 3300035725 Ga0373947_0187436 Ga0373947_0187436_206_640 138
73 3300037068 Ga0373925_0082477 Ga0373925_0082477_375_809 138
74 3300046459 Ga0495629_0237333 Ga0495629_0237333_678_1112 138
75 3300046473 Ga0495582_0145619 Ga0495582_0145619_687_1121 138
76 3300046514 Ga0495618_0252180 Ga0495618_0252180_40_474 138
77 3300046533 Ga0495640_0133783 Ga0495640_0133783_134_568 138
78 3300047319 Ga0495674_0818306 Ga0495674_0818306_57_491 138
79 3300048903 Ga0496100_0689682 Ga0496100_0689682_84_518 138
80 3300048907 Ga0496104_0862775 Ga0496104_0862775_228_662 138
81 3300048908 Ga0496105_0103470 Ga0496105_0103470_1571_2005 138
82 3300048908 Ga0496105_1250364 Ga0496105_1250364_40_474 138
83 3300048909 Ga0496106_0172868 Ga0496106_0172868_327_761 138
84 3300048909 Ga0496106_0482087 Ga0496106_0482087_326_769 138
85 3300048911 Ga0496108_0029165 Ga0496108_0029165_1643_2077 138
86 3300048911 Ga0496108_0278337 Ga0496108_0278337_642_1076 138
87 3300048912 Ga0496109_0050912 Ga0496109_0050912_1644_2078 138
88 3300048912 Ga0496109_0540673 Ga0496109_0540673_459_890 138
89 3300048914 Ga0496111_0017188 Ga0496111_0017188_4215_4649 138
90 3300048914 Ga0496111_0263196 Ga0496111_0263196_787_1221 138
91 3300048915 Ga0496112_0052792 Ga0496112_0052792_2256_2690 138
92 3300048915 Ga0496112_0441158 Ga0496112_0441158_457_888 138
93 3300048916 Ga0496113_0023382 Ga0496113_0023382_2572_3006 138
94 3300053077 Ga0495601_0120201 Ga0495601_0120201_1001_1435 138
95 3300053085 Ga0495619_0181811 Ga0495619_0181811_79_513 138
96 3300005548 Ga0070665_100445902 Ga0070665_1004459022 139
97 3300028379 Ga0268266_10226284 Ga0268266_102262842 139
98 3300005329 Ga0070683_100110024 Ga0070683_1001100242 140
99 3300005330 Ga0070690_100738624 Ga0070690_1007386242 140
100 3300005337 Ga0070682_102035170 Ga0070682_1020351701 140
101 3300005338 Ga0068868_100096874 Ga0068868_1000968744 140
102 3300005339 Ga0070660_100080791 Ga0070660_1000807912 140
103 3300005341 Ga0070691_10589603 Ga0070691_105896031 140
104 3300005343 Ga0070687_100070541 Ga0070687_1000705411 140
105 3300005344 Ga0070661_100503410 Ga0070661_1005034101 140
106 3300005345 Ga0070692_11031675 Ga0070692_110316752 140
107 3300005354 Ga0070675_102169449 Ga0070675_1021694491 140
108 3300005364 Ga0070673_101622855 Ga0070673_1016228551 140
109 3300005366 Ga0070659_100479572 Ga0070659_1004795722 140
110 3300005367 Ga0070667_101779089 Ga0070667_1017790892 140
111 3300005438 Ga0070701_10041840 Ga0070701_100418402 140
112 3300005441 Ga0070700_100077271 Ga0070700_1000772712 140
113 3300005441 Ga0070700_101297645 Ga0070700_1012976451 140
114 3300005455 Ga0070663_100629611 Ga0070663_1006296112 140
115 3300005456 Ga0070678_100327437 Ga0070678_1003274371 140
116 3300005459 Ga0068867_100143935 Ga0068867_1001439352 140
117 3300005459 Ga0068867_100565513 Ga0068867_1005655132 140
118 3300005466 Ga0070685_10081978 Ga0070685_100819782 140
119 3300005535 Ga0070684_100818948 Ga0070684_1008189481 140
120 3300005535 Ga0070684_100920004 Ga0070684_1009200042 140
121 3300005539 Ga0068853_101940462 Ga0068853_1019404621 140
122 3300005544 Ga0070686_100757415 Ga0070686_1007574152 140
123 3300005615 Ga0070702_100014950 Ga0070702_1000149505 140
124 3300005615 Ga0070702_100404069 Ga0070702_1004040692 140
125 3300005616 Ga0068852_100128722 Ga0068852_1001287222 140
126 3300005617 Ga0068859_100239550 Ga0068859_1002395502 140
127 3300005618 Ga0068864_100327500 Ga0068864_1003275002 140
128 3300005618 Ga0068864_100448824 Ga0068864_1004488242 140
129 3300005842 Ga0068858_100458532 Ga0068858_1004585322 140
130 3300005981 Ga0081538_10010378 Ga0081538_100103788 140
131 3300006038 Ga0075365_10724305 Ga0075365_107243052 140
132 3300006358 Ga0068871_101036507 Ga0068871_1010365071 140
133 3300006881 Ga0068865_100544614 Ga0068865_1005446142 140
134 3300006931 Ga0097620_100239532 Ga0097620_1002395322 140
135 3300009094 Ga0111539_10272865 Ga0111539_102728652 140
136 3300009094 Ga0111539_10431620 Ga0111539_104316202 140
137 3300009098 Ga0105245_10540138 Ga0105245_105401382 140
138 3300009098 Ga0105245_10821878 Ga0105245_108218781 140
139 3300009098 Ga0105245_11879451 Ga0105245_118794511 140
140 3300009148 Ga0105243_10057894 Ga0105243_100578944 140
141 3300009148 Ga0105243_12393126 Ga0105243_123931261 140
142 3300009176 Ga0105242_10868899 Ga0105242_108688992 140
143 3300009177 Ga0105248_10596890 Ga0105248_105968902 140
144 3300009553 Ga0105249_10508550 Ga0105249_105085502 140
145 3300011119 Ga0105246_10409376 Ga0105246_104093762 140
146 3300011119 Ga0105246_11237194 Ga0105246_112371941 140
147 3300013306 Ga0163162_10283293 Ga0163162_102832932 140
148 3300014745 Ga0157377_10105779 Ga0157377_101057793 140
149 3300014745 Ga0157377_10131947 Ga0157377_101319472 140
150 3300025901 Ga0207688_10335933 Ga0207688_103359332 140
151 3300025909 Ga0207705_10796867 Ga0207705_107968672 140
152 3300025918 Ga0207662_10142067 Ga0207662_101420671 140
153 3300025926 Ga0207659_11675838 Ga0207659_116758381 140
154 3300025927 Ga0207687_11455129 Ga0207687_114551291 140
155 3300025932 Ga0207690_11182603 Ga0207690_111826032 140
156 3300025933 Ga0207706_10030475 Ga0207706_100304752 140
157 3300025934 Ga0207686_11039344 Ga0207686_110393441 140
158 3300025935 Ga0207709_10094195 Ga0207709_100941952 140
159 3300025944 Ga0207661_10149318 Ga0207661_101493182 140
160 3300025960 Ga0207651_10652633 Ga0207651_106526332 140
161 3300025961 Ga0207712_10542976 Ga0207712_105429761 140
162 3300026023 Ga0207677_11368661 Ga0207677_113686612 140
163 3300026035 Ga0207703_10263013 Ga0207703_102630132 140
164 3300026035 Ga0207703_11616416 Ga0207703_116164162 140
165 3300026067 Ga0207678_11357019 Ga0207678_113570191 140
166 3300026075 Ga0207708_10226863 Ga0207708_102268632 140
167 3300026088 Ga0207641_10640256 Ga0207641_106402562 140
168 3300026089 Ga0207648_10345146 Ga0207648_103451462 140
169 3300026095 Ga0207676_10128359 Ga0207676_101283592 140
170 3300026095 Ga0207676_12218689 Ga0207676_122186891 140
171 3300026118 Ga0207675_100096903 Ga0207675_1000969033 140
172 3300026121 Ga0207683_10368952 Ga0207683_103689522 140
173 3300026142 Ga0207698_10290471 Ga0207698_102904712 140
174 3300026142 Ga0207698_11641544 Ga0207698_116415442 140
175 3300031731 Ga0307405_10128068 Ga0307405_101280681 140
176 3300031824 Ga0307413_10149416 Ga0307413_101494162 140
177 3300031852 Ga0307410_10316886 Ga0307410_103168862 140
178 3300031901 Ga0307406_11462457 Ga0307406_114624571 140
179 3300031911 Ga0307412_10678734 Ga0307412_106787341 140
180 3300031995 Ga0307409_100465476 Ga0307409_1004654762 140
181 3300031995 Ga0307409_100596051 Ga0307409_1005960512 140
182 3300032002 Ga0307416_100076056 Ga0307416_1000760563 140
183 3300032005 Ga0307411_11471289 Ga0307411_114712892 140
184 3300032126 Ga0307415_100004172 Ga0307415_1000041728 140
185 3300032126 Ga0307415_100025264 Ga0307415_1000252645 140
186 3300046507 Ga0495606_0351789 Ga0495606_0351789_336_770 140
187 3300046515 Ga0495620_0161640 Ga0495620_0161640_344_778 140
188 3300046518 Ga0495631_0046374 Ga0495631_0046374_1242_1676 140
189 3300046523 Ga0495644_0293371 Ga0495644_0293371_82_516 140
190 3300048905 Ga0496102_0366172 Ga0496102_0366172_874_1299 140
191 3300048909 Ga0496106_0273060 Ga0496106_0273060_270_695 140
192 3300048911 Ga0496108_0846677 Ga0496108_0846677_295_720 140
193 3300048913 Ga0496110_0816049 Ga0496110_0816049_227_661 140
194 3300048914 Ga0496111_0223822 Ga0496111_0223822_746_1180 140
195 3300049568 Ga0501031_0087384 Ga0501031_0087384_336_758 140
196 3300049572 Ga0501036_0169403 Ga0501036_0169403_218_640 140
197 3300049573 Ga0501037_0231023 Ga0501037_0231023_279_701 140
198 3300049575 Ga0501039_0120813 Ga0501039_0120813_1308_1730 140
199 3300049576 Ga0501040_0522020 Ga0501040_0522020_327_749 140
200 3300049577 Ga0501041_0201956 Ga0501041_0201956_783_1205 140
201 3300049578 Ga0501042_0140512 Ga0501042_0140512_589_1011 140
202 3300049580 Ga0501046_0123792 Ga0501046_0123792_771_1193 140
203 3300049582 Ga0501048_0104274 Ga0501048_0104274_425_847 140
204 3300049588 Ga0501072_0062636 Ga0501072_0062636_426_848 140
205 3300049591 Ga0501075_0236140 Ga0501075_0236140_216_638 140
206 3300049743 Ga0501081_0072929 Ga0501081_0072929_598_1020 140
207 3300050511 nmdc:mga08y16_465168_c1 nmdc:mga08y16_465168_c1_624_1058 140
208 3300050511 nmdc:mga08y16_853779_c1 nmdc:mga08y16_853779_c1_399_824 140
209 3300050512 nmdc:mga0n895_812931_c1 nmdc:mga0n895_812931_c1_474_899 140
210 3300060353 Ga0501082_0254756 Ga0501082_0254756_756_1178 140
211 3300003203 JGI25406J46586_10101872 JGI25406J46586_101018721 141
212 3300005329 Ga0070683_100361980 Ga0070683_1003619802 141
213 3300005329 Ga0070683_100653440 Ga0070683_1006534402 141
214 3300005329 Ga0070683_101059449 Ga0070683_1010594492 141
215 3300005329 Ga0070683_101934758 Ga0070683_1019347582 141
216 3300005331 Ga0070670_101148865 Ga0070670_1011488652 141
217 3300005334 Ga0068869_100774947 Ga0068869_1007749472 141
218 3300005337 Ga0070682_100788644 Ga0070682_1007886441 141
219 3300005337 Ga0070682_100990374 Ga0070682_1009903741 141
220 3300005338 Ga0068868_100094092 Ga0068868_1000940922 141
221 3300005338 Ga0068868_100332177 Ga0068868_1003321772 141
222 3300005338 Ga0068868_100410242 Ga0068868_1004102421 141
223 3300005338 Ga0068868_101052727 Ga0068868_1010527271 141
224 3300005344 Ga0070661_100443551 Ga0070661_1004435511 141
225 3300005354 Ga0070675_100484490 Ga0070675_1004844902 141
226 3300005356 Ga0070674_101246057 Ga0070674_1012460571 141
227 3300005364 Ga0070673_102059069 Ga0070673_1020590691 141
228 3300005438 Ga0070701_10850908 Ga0070701_108509081 141
229 3300005455 Ga0070663_100121582 Ga0070663_1001215822 141
230 3300005455 Ga0070663_100573403 Ga0070663_1005734032 141
231 3300005456 Ga0070678_100469907 Ga0070678_1004699072 141
232 3300005457 Ga0070662_100874358 Ga0070662_1008743582 141
233 3300005458 Ga0070681_10380064 Ga0070681_103800642 141
234 3300005530 Ga0070679_101266977 Ga0070679_1012669772 141
235 3300005535 Ga0070684_100151401 Ga0070684_1001514012 141
236 3300005535 Ga0070684_100161488 Ga0070684_1001614884 141
237 3300005535 Ga0070684_100262933 Ga0070684_1002629331 141
238 3300005535 Ga0070684_100401289 Ga0070684_1004012891 141
239 3300005535 Ga0070684_100802457 Ga0070684_1008024571 141
240 3300005535 Ga0070684_101441661 Ga0070684_1014416612 141
241 3300005543 Ga0070672_100157140 Ga0070672_1001571401 141
242 3300005546 Ga0070696_100763304 Ga0070696_1007633041 141
243 3300005546 Ga0070696_101300182 Ga0070696_1013001821 141
244 3300005547 Ga0070693_100546744 Ga0070693_1005467441 141
245 3300005548 Ga0070665_100193554 Ga0070665_1001935543 141
246 3300005548 Ga0070665_101038099 Ga0070665_1010380991 141
247 3300005549 Ga0070704_101171106 Ga0070704_1011711062 141
248 3300005564 Ga0070664_101528933 Ga0070664_1015289332 141
249 3300005564 Ga0070664_101905170 Ga0070664_1019051702 141
250 3300005577 Ga0068857_100219273 Ga0068857_1002192732 141
251 3300005577 Ga0068857_101392164 Ga0068857_1013921642 141
252 3300005614 Ga0068856_100277488 Ga0068856_1002774882 141
253 3300005616 Ga0068852_101374807 Ga0068852_1013748072 141
254 3300005617 Ga0068859_101220706 Ga0068859_1012207061 141
255 3300005617 Ga0068859_101739011 Ga0068859_1017390111 141
256 3300005618 Ga0068864_100385016 Ga0068864_1003850162 141
257 3300005718 Ga0068866_11064974 Ga0068866_110649741 141
258 3300005719 Ga0068861_102539909 Ga0068861_1025399091 141
259 3300005834 Ga0068851_10884872 Ga0068851_108848721 141
260 3300005841 Ga0068863_100570794 Ga0068863_1005707942 141
261 3300005841 Ga0068863_100630084 Ga0068863_1006300841 141
262 3300005842 Ga0068858_100359236 Ga0068858_1003592362 141
263 3300005844 Ga0068862_100204669 Ga0068862_1002046692 141
264 3300005937 Ga0081455_10038969 Ga0081455_100389694 141
265 3300005937 Ga0081455_10112345 Ga0081455_101123452 141
266 3300005937 Ga0081455_10211304 Ga0081455_102113042 141
267 3300005981 Ga0081538_10128134 Ga0081538_101281342 141
268 3300005983 Ga0081540_1000006 Ga0081540_100000656 141
269 3300005985 Ga0081539_10030265 Ga0081539_100302652 141
270 3300006237 Ga0097621_102244562 Ga0097621_1022445622 141
271 3300006871 Ga0075434_101501561 Ga0075434_1015015612 141
272 3300006880 Ga0075429_101241438 Ga0075429_1012414382 141
273 3300006881 Ga0068865_100347783 Ga0068865_1003477832 141
274 3300006881 Ga0068865_100934468 Ga0068865_1009344681 141
275 3300006931 Ga0097620_101220763 Ga0097620_1012207632 141
276 3300006931 Ga0097620_101739083 Ga0097620_1017390831 141
277 3300009098 Ga0105245_10142928 Ga0105245_101429281 141
278 3300009098 Ga0105245_10272739 Ga0105245_102727392 141
279 3300009098 Ga0105245_12361527 Ga0105245_123615271 141
280 3300009147 Ga0114129_10731041 Ga0114129_107310412 141
281 3300009148 Ga0105243_10212892 Ga0105243_102128922 141
282 3300009148 Ga0105243_10364474 Ga0105243_103644742 141
283 3300009176 Ga0105242_13235296 Ga0105242_132352961 141
284 3300009553 Ga0105249_10912239 Ga0105249_109122392 141
285 3300009553 Ga0105249_11709649 Ga0105249_117096492 141
286 3300010375 Ga0105239_11096772 Ga0105239_110967721 141
287 3300011119 Ga0105246_10214180 Ga0105246_102141802 141
288 3300013105 Ga0157369_10395982 Ga0157369_103959822 141
289 3300013105 Ga0157369_10820974 Ga0157369_108209742 141
290 3300013105 Ga0157369_12497275 Ga0157369_124972751 141
291 3300013308 Ga0157375_11667960 Ga0157375_116679601 141
292 3300014326 Ga0157380_11188470 Ga0157380_111884702 141
293 3300014497 Ga0182008_10219942 Ga0182008_102199422 141
294 3300014745 Ga0157377_10176431 Ga0157377_101764312 141
295 3300014745 Ga0157377_10562862 Ga0157377_105628622 141
296 3300025899 Ga0207642_10512148 Ga0207642_105121481 141
297 3300025901 Ga0207688_10285213 Ga0207688_102852132 141
298 3300025912 Ga0207707_10306328 Ga0207707_103063282 141
299 3300025921 Ga0207652_10094906 Ga0207652_100949062 141
300 3300025921 Ga0207652_10767594 Ga0207652_107675942 141
301 3300025926 Ga0207659_10476576 Ga0207659_104765762 141
302 3300025932 Ga0207690_10192990 Ga0207690_101929902 141
303 3300025932 Ga0207690_11072754 Ga0207690_110727542 141
304 3300025933 Ga0207706_10248668 Ga0207706_102486681 141
305 3300025933 Ga0207706_10406503 Ga0207706_104065032 141
306 3300025935 Ga0207709_10081822 Ga0207709_100818223 141
307 3300025935 Ga0207709_10273776 Ga0207709_102737762 141
308 3300025935 Ga0207709_10305093 Ga0207709_103050932 141
309 3300025937 Ga0207669_10895315 Ga0207669_108953151 141
310 3300025938 Ga0207704_10339116 Ga0207704_103391162 141
311 3300025939 Ga0207665_10802963 Ga0207665_108029631 141
312 3300025940 Ga0207691_10259478 Ga0207691_102594782 141
313 3300025944 Ga0207661_10042152 Ga0207661_100421524 141
314 3300025944 Ga0207661_10207608 Ga0207661_102076082 141
315 3300025944 Ga0207661_11410186 Ga0207661_114101862 141
316 3300025945 Ga0207679_10172974 Ga0207679_101729742 141
317 3300025945 Ga0207679_10359717 Ga0207679_103597172 141
318 3300025960 Ga0207651_10876359 Ga0207651_108763592 141
319 3300025961 Ga0207712_10336708 Ga0207712_103367081 141
320 3300025961 Ga0207712_11580865 Ga0207712_115808652 141
321 3300025981 Ga0207640_10436941 Ga0207640_104369412 141
322 3300026023 Ga0207677_10072272 Ga0207677_100722722 141
323 3300026023 Ga0207677_10730221 Ga0207677_107302212 141
324 3300026035 Ga0207703_11703626 Ga0207703_117036261 141
325 3300026035 Ga0207703_11975853 Ga0207703_119758531 141
326 3300026067 Ga0207678_10461549 Ga0207678_104615492 141
327 3300026067 Ga0207678_10582900 Ga0207678_105829001 141
328 3300026075 Ga0207708_10702192 Ga0207708_107021922 141
329 3300026078 Ga0207702_10172480 Ga0207702_101724803 141
330 3300026088 Ga0207641_10328123 Ga0207641_103281232 141
331 3300026095 Ga0207676_10262578 Ga0207676_102625781 141
332 3300026095 Ga0207676_10914816 Ga0207676_109148162 141
333 3300026116 Ga0207674_10312258 Ga0207674_103122582 141
334 3300026116 Ga0207674_10751461 Ga0207674_107514612 141
335 3300026118 Ga0207675_100414125 Ga0207675_1004141252 141
336 3300026118 Ga0207675_100770609 Ga0207675_1007706092 141
337 3300026121 Ga0207683_10393444 Ga0207683_103934442 141
338 3300026142 Ga0207698_10779290 Ga0207698_107792902 141
339 3300026142 Ga0207698_10990098 Ga0207698_109900982 141
340 3300026142 Ga0207698_12034588 Ga0207698_120345881 141
341 3300027907 Ga0207428_10124064 Ga0207428_101240643 141
342 3300028379 Ga0268266_10394743 Ga0268266_103947432 141
343 3300028380 Ga0268265_10351098 Ga0268265_103510982 141
344 3300031548 Ga0307408_101022563 Ga0307408_1010225632 141
345 3300031901 Ga0307406_10029453 Ga0307406_100294534 141
346 3300031901 Ga0307406_10411712 Ga0307406_104117122 141
347 3300031901 Ga0307406_10461235 Ga0307406_104612352 141
348 3300031903 Ga0307407_10069290 Ga0307407_100692902 141
349 3300031903 Ga0307407_10384351 Ga0307407_103843511 141
350 3300031995 Ga0307409_100053464 Ga0307409_1000534642 141
351 3300031995 Ga0307409_100916605 Ga0307409_1009166052 141
352 3300032002 Ga0307416_103545784 Ga0307416_1035457841 141
353 3300032005 Ga0307411_10137461 Ga0307411_101374612 141
354 3300032005 Ga0307411_10511917 Ga0307411_105119172 141
355 3300032126 Ga0307415_100110453 Ga0307415_1001104532 141
356 3300032126 Ga0307415_100285887 Ga0307415_1002858872 141
357 3300032126 Ga0307415_101110287 Ga0307415_1011102872 141
358 3300035089 Ga0373944_0210051 Ga0373944_0210051_37_471 141
359 3300035725 Ga0373947_0130354 Ga0373947_0130354_63_497 141
360 3300042005 Ga0439448_0146369 Ga0439448_0146369_159_584 141
361 3300044684 Ga0466966_0195557 Ga0466966_0195557_418_858 141
362 3300044684 Ga0466966_0289227 Ga0466966_0289227_467_916 141
363 3300044693 Ga0466961_0809079 Ga0466961_0809079_95_544 141
364 3300044706 Ga0466964_0383600 Ga0466964_0383600_56_493 141
365 3300044765 Ga0466970_0915480 Ga0466970_0915480_62_496 141
366 3300044842 Ga0466957_0024325 Ga0466957_0024325_357_791 141
367 3300044901 Ga0466960_0308830 Ga0466960_0308830_38_475 141
368 3300045976 Ga0466967_0004558 Ga0466967_0004558_7575_8036 141
369 3300045976 Ga0466967_0253973 Ga0466967_0253973_408_848 141
370 3300045976 Ga0466967_0287187 Ga0466967_0287187_797_1231 141
371 3300045976 Ga0466967_0654749 Ga0466967_0654749_392_853 141
372 3300045976 Ga0466967_0896065 Ga0466967_0896065_346_807 141
373 3300045976 Ga0466967_1708066 Ga0466967_1708066_153_596 141
374 3300045976 Ga0466967_2160359 Ga0466967_2160359_52_486 141
375 3300046455 Ga0495603_0266962 Ga0495603_0266962_318_752 141
376 3300046457 Ga0495590_0326072 Ga0495590_0326072_71_505 141
377 3300046518 Ga0495631_0309704 Ga0495631_0309704_187_621 141
378 3300046542 Ga0495597_0365612 Ga0495597_0365612_38_472 141
379 3300046558 Ga0495633_0350242 Ga0495633_0350242_207_641 141
380 3300046616 Ga0495668_0178981 Ga0495668_0178981_82_516 141
381 3300046665 Ga0495661_0379985 Ga0495661_0379985_35_469 141
382 3300047323 Ga0495683_0218882 Ga0495683_0218882_304_738 141
383 3300048903 Ga0496100_0196691 Ga0496100_0196691_546_980 141
384 3300048903 Ga0496100_0299483 Ga0496100_0299483_210_644 141
385 3300048903 Ga0496100_0462285 Ga0496100_0462285_142_576 141
386 3300048904 Ga0496101_0003399 Ga0496101_0003399_507_941 141
387 3300048905 Ga0496102_0048761 Ga0496102_0048761_3366_3800 141
388 3300048907 Ga0496104_1264076 Ga0496104_1264076_50_484 141
389 3300048908 Ga0496105_0045379 Ga0496105_0045379_225_659 141
390 3300048908 Ga0496105_0069852 Ga0496105_0069852_1761_2195 141
391 3300048909 Ga0496106_0034631 Ga0496106_0034631_52_486 141
392 3300048909 Ga0496106_0056624 Ga0496106_0056624_1760_2194 141
393 3300048910 Ga0496107_0001173 Ga0496107_0001173_203_637 141
394 3300048911 Ga0496108_0007985 Ga0496108_0007985_5043_5477 141
395 3300048911 Ga0496108_0056422 Ga0496108_0056422_736_1170 141
396 3300048912 Ga0496109_0009001 Ga0496109_0009001_1244_1678 141
397 3300048913 Ga0496110_0004818 Ga0496110_0004818_9450_9884 141
398 3300048913 Ga0496110_0048229 Ga0496110_0048229_3153_3587 141
399 3300048913 Ga0496110_0076930 Ga0496110_0076930_2358_2792 141
400 3300048914 Ga0496111_0062443 Ga0496111_0062443_1396_1830 141
401 3300048915 Ga0496112_0015182 Ga0496112_0015182_5834_6268 141
402 3300048915 Ga0496112_0071749 Ga0496112_0071749_1520_1954 141
403 3300048915 Ga0496112_0095569 Ga0496112_0095569_260_694 141
404 3300048916 Ga0496113_0224944 Ga0496113_0224944_48_482 141
405 3300048916 Ga0496113_0310077 Ga0496113_0310077_639_1073 141
406 3300048916 Ga0496113_1444560 Ga0496113_1444560_59_499 141
407 3300048917 Ga0496114_0339256 Ga0496114_0339256_288_722 141
408 3300048917 Ga0496114_1282599 Ga0496114_1282599_137_571 141
409 3300048917 Ga0496114_1610977 Ga0496114_1610977_62_496 141
410 3300048918 Ga0496115_0369204 Ga0496115_0369204_670_1104 141
411 3300048918 Ga0496115_0648940 Ga0496115_0648940_154_588 141
412 3300048924 Ga0496121_0014845 Ga0496121_0014845_1714_2157 141
413 3300048924 Ga0496121_0333225 Ga0496121_0333225_459_893 141
414 3300049572 Ga0501036_0189679 Ga0501036_0189679_252_683 141
415 3300049572 Ga0501036_0464455 Ga0501036_0464455_83_607 141
416 3300049572 Ga0501036_1182844 Ga0501036_1182844_77_508 141
417 3300049573 Ga0501037_0810425 Ga0501037_0810425_84_515 141
418 3300049574 Ga0501038_0211535 Ga0501038_0211535_285_716 141
419 3300049575 Ga0501039_0114186 Ga0501039_0114186_1444_1875 141
420 3300049576 Ga0501040_0050344 Ga0501040_0050344_579_1010 141
421 3300049576 Ga0501040_0079345 Ga0501040_0079345_1448_1879 141
422 3300049577 Ga0501041_0037128 Ga0501041_0037128_2048_2479 141
423 3300049577 Ga0501041_0042516 Ga0501041_0042516_108_539 141
424 3300049578 Ga0501042_0140529 Ga0501042_0140529_531_962 141
425 3300049582 Ga0501048_0088375 Ga0501048_0088375_111_545 141
426 3300049582 Ga0501048_0114348 Ga0501048_0114348_1018_1449 141
427 3300049582 Ga0501048_0393615 Ga0501048_0393615_356_787 141
428 3300049583 Ga0501067_0564362 Ga0501067_0564362_41_478 141
429 3300049587 Ga0501071_0239023 Ga0501071_0239023_94_525 141
430 3300049587 Ga0501071_0286740 Ga0501071_0286740_698_1129 141
431 3300049588 Ga0501072_0095937 Ga0501072_0095937_164_595 141
432 3300049588 Ga0501072_0723828 Ga0501072_0723828_333_764 141
433 3300049590 Ga0501074_0368532 Ga0501074_0368532_202_633 141
434 3300049592 Ga0501076_0120216 Ga0501076_0120216_920_1351 141
435 3300049592 Ga0501076_0355346 Ga0501076_0355346_56_487 141
436 3300049741 Ga0501079_0049942 Ga0501079_0049942_1365_1796 141
437 3300049742 Ga0501080_0139971 Ga0501080_0139971_1090_1521 141
438 3300049744 Ga0501083_0253383 Ga0501083_0253383_171_602 141
439 3300049822 Ga0501035_0549290 Ga0501035_0549290_434_865 141
440 3300049823 Ga0501044_0543280 Ga0501044_0543280_30_488 141
441 3300049824 Ga0501045_0031340 Ga0501045_0031340_75_506 141
442 3300049824 Ga0501045_0051448 Ga0501045_0051448_661_1092 141
443 3300050507 nmdc:mga05p37_489007_c1 nmdc:mga05p37_489007_c1_281_706 141
444 3300050511 nmdc:mga08y16_652570_c1 nmdc:mga08y16_652570_c1_367_801 141
445 3300054114 Ga0501084_0137302 Ga0501084_0137302_353_784 141
446 3300054114 Ga0501084_0236211 Ga0501084_0236211_112_591 141
447 3300054114 Ga0501084_1786349 Ga0501084_1786349_59_490 141
448 3300060353 Ga0501082_0024168 Ga0501082_0024168_3581_4012 141
449 3300061719 Ga0466962_0117270 Ga0466962_0117270_681_1115 141
450 3300061734 Ga0530510_0236821 Ga0530510_0236821_888_1319 141
451 3300061734 Ga0530510_0246095 Ga0530510_0246095_502_981 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

31

89

0.95

PF01047

MarR

MarR family

32

90

0.94

PF13463

HTH_27

Winged helix DNA-binding domain

32

98

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.9436 36 79
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9363 35 85
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.931 35 85
4yif-assembly2.cif.gz_D crystal structure of rv0880 0.9291 7 141
4yif-assembly3.cif.gz_E crystal structure of rv0880 0.9266 6 141
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9559 32 93 1.10.10.10
af_P71699_45_188_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9445 7 136 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9442 33 95 1.10.10.10
1s3jB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9422 32 95 1.10.10.10
5dukB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9399 35 79 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W1DYQ5-F1-model_v4 MarR family transcriptional regulator 0.9828 7 138 GO:0003700
AF-F1YGT6-F1-model_v4 Regulatory protein MarR 0.9818 12 139 GO:0003700
AF-A0A537ZMV1-F1-model_v4 MarR family transcriptional regulator 0.9813 7 140 GO:0003700
AF-A0A6N2DSB8-F1-model_v4 MarR family transcriptional regulator 0.9797 9 140 GO:0003700
AF-A0A7V8VJY3-F1-model_v4 MarR family transcriptional regulator 0.9776 9 140 GO:0003700

Feature Viewer

pLDDT pTM Quality
93.52 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map