F446737

General Info

Members Datasets Scaffolds Average Seq Length
451 243 451 228

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100410558|Ga0070713_1004105582
Length 270
Sequence MNLPACESAAAPAAGANIAADTTARLAANRRIFGNYYVRSPSFPLMPRVLVVDDEPAVRRALERALKLDSYDVELAADGEEALDRLVQSEIDAVILDIAMPRLDGLEVCRRMRTAGDRTPVLMLTARDAIDDRVEGLDVGADDYLVKPFALRELQARLRALLRRAGDGAGGEVLHYADLVLDPVAHEVRRGDRVIDLSKTEFSLLELFMQHPRQVLSRSAIFEHVWGYDFGPTSNALGVYMGYLRRKTEEGGEPRLLHTIRGVGYVLREE

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 7.54
Rhizosphere 85.14
Stem 0
Stem Tuber 0
Unclassified 6.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100273389 3300005329 Bacteria 1607
2 Ga0070683_100341484 3300005329 Unclassified 1426
3 Ga0070670_100450427 3300005331 Bacteria 1141
4 Ga0068869_100194026 3300005334 Bacteria 1598
5 Ga0070682_100093158 3300005337 Bacteria 1975
6 Ga0070682_100116514 3300005337 Bacteria 1787
7 Ga0068868_100038150 3300005338 Bacteria 3728
8 Ga0068868_100061269 3300005338 Bacteria 2980
9 Ga0070660_100148223 3300005339 Bacteria 1886
10 Ga0070687_100025587 3300005343 Bacteria 2833
11 Ga0070692_10028779 3300005345 Bacteria 2764
12 Ga0070668_100092661 3300005347 Bacteria 2383
13 Ga0070671_100189629 3300005355 Bacteria 1742
14 Ga0070674_100172672 3300005356 Bacteria 1650
15 Ga0070674_100579062 3300005356 Bacteria 945
16 Ga0070688_100080007 3300005365 Bacteria 2113
17 Ga0070709_10024102 3300005434 Bacteria 3579
18 Ga0070714_100050762 3300005435 Bacteria 3535
19 Ga0070714_100132991 3300005435 Bacteria 2224
20 Ga0070714_100143147 3300005435 Bacteria 2148
21 Ga0070714_100248004 3300005435 Bacteria 1645
22 Ga0070714_100302520 3300005435 Bacteria 1491
23 Ga0070713_100410558 3300005436 Bacteria 1266
24 Ga0070710_10051518 3300005437 Bacteria 2311
25 Ga0070701_10160024 3300005438 Bacteria 1304
26 Ga0070711_100394009 3300005439 Bacteria 1122
27 Ga0070705_100180946 3300005440 Bacteria 1428
28 Ga0070700_100020738 3300005441 Bacteria 3813
29 Ga0070700_100032583 3300005441 Bacteria 3133
30 Ga0070700_100247954 3300005441 Bacteria 1276
31 Ga0070700_100252952 3300005441 Bacteria 1265
32 Ga0070681_10121528 3300005458 Bacteria 2546
33 Ga0068867_100391039 3300005459 Bacteria 1170
34 Ga0070707_100000025 3300005468 Bacteria 124890
35 Ga0070698_100260921 3300005471 Bacteria 1665
36 Ga0070699_100005998 3300005518 Bacteria 10621
37 Ga0070684_100002782 3300005535 Bacteria 12957
38 Ga0070684_100230115 3300005535 Bacteria 1692
39 Ga0070684_100549406 3300005535 Bacteria 1072
40 Ga0070697_100025186 3300005536 Bacteria 4744
41 Ga0068853_100054155 3300005539 Bacteria 3457
42 Ga0070686_100026392 3300005544 Bacteria 3506
43 Ga0070696_100472918 3300005546 Bacteria 992
44 Ga0070693_100187078 3300005547 Bacteria 1337
45 Ga0070665_100370220 3300005548 Bacteria 1439
46 Ga0070665_100556558 3300005548 Bacteria 1159
47 Ga0068855_100082298 3300005563 Unclassified 3731
48 Ga0070664_100031409 3300005564 Bacteria 4437
49 Ga0070664_100265533 3300005564 Bacteria 1545
50 Ga0070664_100315159 3300005564 Bacteria 1416
51 Ga0068854_100621352 3300005578 Bacteria 925
52 Ga0070702_100004116 3300005615 Bacteria 6603
53 Ga0070702_100035388 3300005615 Bacteria 2759
54 Ga0070702_100191355 3300005615 Bacteria 1347
55 Ga0068852_100042309 3300005616 Bacteria 3856
56 Ga0068852_100255967 3300005616 Bacteria 1679
57 Ga0068859_100373778 3300005617 Bacteria 1521
58 Ga0068864_100148815 3300005618 Bacteria 2119
59 Ga0068866_10027283 3300005718 Bacteria 2706
60 Ga0068861_100165577 3300005719 Bacteria 1828
61 Ga0068861_100395895 3300005719 Bacteria 1224
62 Ga0068863_100261696 3300005841 Bacteria 1673
63 Ga0068858_100406990 3300005842 Bacteria 1308
64 Ga0068860_100108537 3300005843 Bacteria 2652
65 Ga0068860_100396474 3300005843 Bacteria 1365
66 Ga0068860_100480977 3300005843 Bacteria 1238
67 Ga0068862_100036836 3300005844 Bacteria 4146
68 Ga0081455_10038374 3300005937 Bacteria 4242
69 Ga0081538_10000097 3300005981 Bacteria 85125
70 Ga0081540_1002305 3300005983 Bacteria 15660
71 Ga0081539_10005993 3300005985 Bacteria 11962
72 Ga0081539_10029706 3300005985 Bacteria 3408
73 Ga0070717_10009896 3300006028 Bacteria 7182
74 Ga0070717_10014653 3300006028 Bacteria 6034
75 Ga0070717_10017799 3300006028 Bacteria 5537
76 Ga0070717_10068029 3300006028 Bacteria 2965
77 Ga0070717_10141211 3300006028 Bacteria 2077
78 Ga0070717_10307217 3300006028 Bacteria 1411
79 Ga0070717_10891827 3300006028 Bacteria 809
80 Ga0075365_10117048 3300006038 Bacteria 1835
81 Ga0075365_10119788 3300006038 Bacteria 1815
82 Ga0070712_100000006 3300006175 Bacteria 161357
83 Ga0070712_100089541 3300006175 Bacteria 2251
84 Ga0070712_100095362 3300006175 Bacteria 2189
85 Ga0070712_100109400 3300006175 Bacteria 2060
86 Ga0075434_100026917 3300006871 Bacteria 5641
87 Ga0075434_100180491 3300006871 Bacteria 2131
88 Ga0068865_100090568 3300006881 Bacteria 2218
89 Ga0068865_100331146 3300006881 Bacteria 1228
90 Ga0097620_100373734 3300006931 Bacteria 1521
91 Ga0075435_100180145 3300007076 Bacteria 1786
92 Ga0105251_10048202 3300009011 Bacteria 2043
93 Ga0105240_10134380 3300009093 Bacteria 2963
94 Ga0111539_10518878 3300009094 Bacteria 1388
95 Ga0111539_10577742 3300009094 Bacteria 1309
96 Ga0105245_10051338 3300009098 Bacteria 3697
97 Ga0105245_10124852 3300009098 Bacteria 2408
98 Ga0105245_10217794 3300009098 Bacteria 1840
99 Ga0105245_10679921 3300009098 Bacteria 1061
100 Ga0105243_10216545 3300009148 Bacteria 1690
101 Ga0105243_10274145 3300009148 Bacteria 1516
102 Ga0105241_10232035 3300009174 Bacteria 1556
103 Ga0105242_10359915 3300009176 Bacteria 1346
104 Ga0105248_10336019 3300009177 Bacteria 1701
105 Ga0105249_10112159 3300009553 Bacteria 2579
106 Ga0105249_10294381 3300009553 Bacteria 1626
107 Ga0105239_10093541 3300010375 Bacteria 3319
108 Ga0105239_10277277 3300010375 Bacteria 1887
109 Ga0157369_10238038 3300013105 Unclassified 1902
110 Ga0157378_10030679 3300013297 Bacteria 4749
111 Ga0163162_10152607 3300013306 Bacteria 2428
112 Ga0163162_10183885 3300013306 Bacteria 2216
113 Ga0163162_10322244 3300013306 Bacteria 1678
114 Ga0163162_11319213 3300013306 Bacteria 820
115 Ga0163163_10279860 3300014325 Bacteria 1720
116 Ga0157380_10247373 3300014326 Bacteria 1612
117 Ga0157377_10329052 3300014745 Bacteria 1018
118 Ga0157376_10126083 3300014969 Bacteria 2277
119 Ga0213874_10014936 3300021377 Bacteria 2039
120 Ga0213874_10017019 3300021377 Bacteria 1944
121 Ga0213876_10007272 3300021384 Bacteria 6028
122 Ga0213876_10011115 3300021384 Bacteria 4815
123 Ga0213876_10022352 3300021384 Bacteria 3345
124 Ga0213875_10008014 3300021388 Bacteria 5427
125 Ga0207656_10250421 3300025321 Bacteria 868
126 Ga0207692_10044539 3300025898 Bacteria 2214
127 Ga0207692_10168686 3300025898 Bacteria 1267
128 Ga0207642_10011750 3300025899 Bacteria 3137
129 Ga0207642_10020453 3300025899 Bacteria 2584
130 Ga0207710_10022235 3300025900 Bacteria 2722
131 Ga0207688_10008801 3300025901 Bacteria 5492
132 Ga0207688_10321720 3300025901 Bacteria 949
133 Ga0207699_10181377 3300025906 Bacteria 1416
134 Ga0207645_10094995 3300025907 Bacteria 1920
135 Ga0207643_10004576 3300025908 Bacteria 7432
136 Ga0207643_10155759 3300025908 Bacteria 1372
137 Ga0207654_10164790 3300025911 Bacteria 1434
138 Ga0207695_10084091 3300025913 Bacteria 3213
139 Ga0207695_10341396 3300025913 Bacteria 1385
140 Ga0207671_10153411 3300025914 Bacteria 1780
141 Ga0207693_10000078 3300025915 Bacteria 86652
142 Ga0207693_10001773 3300025915 Bacteria 18926
143 Ga0207693_10084143 3300025915 Bacteria 2492
144 Ga0207662_10019922 3300025918 Bacteria 3823
145 Ga0207646_10000002 3300025922 Bacteria 550880
146 Ga0207694_10452550 3300025924 Bacteria 1072
147 Ga0207650_10155411 3300025925 Bacteria 1809
148 Ga0207687_10028698 3300025927 Bacteria 3739
149 Ga0207687_10028735 3300025927 Bacteria 3736
150 Ga0207687_10262991 3300025927 Bacteria 1376
151 Ga0207700_10125704 3300025928 Bacteria 2086
152 Ga0207700_10195551 3300025928 Bacteria 1702
153 Ga0207700_10595945 3300025928 Bacteria 983
154 Ga0207664_10002159 3300025929 Bacteria 12936
155 Ga0207664_10060662 3300025929 Bacteria 3015
156 Ga0207664_10326228 3300025929 Bacteria 1355
157 Ga0207644_10285647 3300025931 Bacteria 1326
158 Ga0207686_10279210 3300025934 Bacteria 1232
159 Ga0207709_10028885 3300025935 Bacteria 3210
160 Ga0207709_10211626 3300025935 Bacteria 1392
161 Ga0207669_10134926 3300025937 Bacteria 1703
162 Ga0207704_10533012 3300025938 Bacteria 952
163 Ga0207704_10657523 3300025938 Bacteria 864
164 Ga0207689_10067945 3300025942 Bacteria 2929
165 Ga0207689_10306214 3300025942 Bacteria 1317
166 Ga0207689_10322353 3300025942 Bacteria 1282
167 Ga0207661_10092967 3300025944 Bacteria 2516
168 Ga0207661_10306687 3300025944 Bacteria 1424
169 Ga0207661_10693302 3300025944 Bacteria 937
170 Ga0207679_10128390 3300025945 Bacteria 2030
171 Ga0207651_10546584 3300025960 Bacteria 1007
172 Ga0207712_10131723 3300025961 Bacteria 1906
173 Ga0207712_10809182 3300025961 Bacteria 824
174 Ga0207668_10248714 3300025972 Bacteria 1443
175 Ga0207668_10390294 3300025972 Bacteria 1174
176 Ga0207640_10234864 3300025981 Bacteria 1413
177 Ga0207640_10735273 3300025981 Bacteria 849
178 Ga0207677_10035366 3300026023 Bacteria 3244
179 Ga0207639_10123882 3300026041 Bacteria 2128
180 Ga0207678_10850032 3300026067 Bacteria 806
181 Ga0207708_10007805 3300026075 Bacteria 7924
182 Ga0207708_10016372 3300026075 Bacteria 5574
183 Ga0207708_10207586 3300026075 Bacteria 1565
184 Ga0207708_10299258 3300026075 Bacteria 1308
185 Ga0207648_10111346 3300026089 Bacteria 2403
186 Ga0207676_10058391 3300026095 Bacteria 3043
187 Ga0207676_10232076 3300026095 Bacteria 1650
188 Ga0207674_10152000 3300026116 Bacteria 2271
189 Ga0207675_100529769 3300026118 Bacteria 1175
190 Ga0207675_100909426 3300026118 Bacteria 896
191 Ga0207683_10169544 3300026121 Bacteria 1976
192 Ga0207683_10463727 3300026121 Bacteria 1168
193 Ga0207698_10319868 3300026142 Bacteria 1453
194 Ga0207698_10852884 3300026142 Bacteria 916
195 Ga0268264_10172779 3300028381 Bacteria 1955
196 Ga0265319_1010715 3300028563 Bacteria 3811
197 Ga0265319_1071342 3300028563 Bacteria 1113
198 Ga0265334_10032734 3300028573 Bacteria 2072
199 Ga0265318_10019760 3300028577 Bacteria 2728
200 Ga0265338_10037418 3300028800 Bacteria 4619
201 Ga0265320_10004759 3300031240 Bacteria 8833
202 Ga0265325_10032200 3300031241 Bacteria 2800
203 Ga0265340_10005234 3300031247 Bacteria 7202
204 Ga0265340_10018711 3300031247 Bacteria 3571
205 Ga0265314_10087805 3300031711 Bacteria 2032
206 Ga0307410_10262172 3300031852 Bacteria 1348
207 Ga0307407_10131121 3300031903 Bacteria 1604
208 Ga0307409_100139625 3300031995 Bacteria 2086
209 Ga0307411_10158678 3300032005 Bacteria 1691
210 Ga0307411_10524445 3300032005 Bacteria 1006
211 Ga0307415_100117464 3300032126 Bacteria 1987
212 Ga0307415_100148637 3300032126 Bacteria 1800
213 Ga0373923_0085557 3300035111 Bacteria 1373
214 Ga0373953_0045037 3300035117 Bacteria 1766
215 Ga0373957_0045595 3300035120 Bacteria 1662
216 Ga0373955_0235317 3300035172 Bacteria 1096
217 Ga0373924_0034743 3300035410 Bacteria 2042
218 Ga0373933_0015790 3300035724 Bacteria 4213
219 Ga0373937_0019717 3300036401 Bacteria 6039
220 Ga0395899_0140184 3300037312 Bacteria 1721
221 Ga0395900_0004676 3300037418 Bacteria 14434
222 Ga0395900_0061930 3300037418 Bacteria 3846
223 Ga0395900_0137468 3300037418 Bacteria 2503
224 Ga0395900_0459078 3300037418 Bacteria 1229
225 Ga0395900_0641993 3300037418 Bacteria 999
226 Ga0395898_0000458 3300037466 Bacteria 81883
227 Ga0395898_0000490 3300037466 Bacteria 78132
228 Ga0395905_0486791 3300037471 Bacteria 1133
229 Ga0436364_0185829 3300037853 Bacteria 6598
230 Ga0436364_0562411 3300037853 Bacteria 15673
231 Ga0436364_0605207 3300037853 Bacteria 2187
232 Ga0436364_0608591 3300037853 Bacteria 4922
233 Ga0436364_0778331 3300037853 Bacteria 1181
234 Ga0436364_0778406 3300037853 Bacteria 1530
235 Ga0436364_1039013 3300037853 Bacteria 1464
236 Ga0436364_1157926 3300037853 Bacteria 4985
237 Ga0395901_0084144 3300038443 Bacteria 3325
238 Ga0395901_0782149 3300038443 Bacteria 945
239 Ga0395901_0880819 3300038443 Bacteria 878
240 Ga0436365_0297333 3300039437 Bacteria 23456
241 Ga0436365_0443181 3300039437 Bacteria 7969
242 Ga0436365_0731979 3300039437 Bacteria 12381
243 Ga0436365_1001435 3300039437 Bacteria 3428
244 Ga0436365_1783583 3300039437 Bacteria 1470
245 Ga0436365_1890546 3300039437 Bacteria 17740
246 Ga0436360_0546571 3300039438 Bacteria 1790
247 Ga0436363_0019223 3300039450 Bacteria 915
248 Ga0436363_0154603 3300039450 Bacteria 2828
249 Ga0436363_0393580 3300039450 Bacteria 1192
250 Ga0436363_0743432 3300039450 Bacteria 11547
251 Ga0436363_1056306 3300039450 Bacteria 3863
252 Ga0436363_1089578 3300039450 Bacteria 860
253 Ga0436363_1500658 3300039450 Bacteria 5778
254 Ga0436363_1571055 3300039450 Bacteria 1673
255 Ga0436362_0943471 3300039453 Bacteria 5439
256 Ga0451791_1240560 3300041451 Bacteria 1470
257 Ga0466969_0001975 3300044656 Bacteria 10971
258 Ga0466965_0023207 3300044683 Bacteria 2995
259 Ga0466965_0083639 3300044683 Bacteria 1616
260 Ga0466965_0131995 3300044683 Bacteria 1296
261 Ga0466966_0016412 3300044684 Bacteria 4894
262 Ga0466966_0080699 3300044684 Bacteria 2026
263 Ga0466966_0087450 3300044684 Bacteria 1937
264 Ga0466966_0170371 3300044684 Bacteria 1323
265 Ga0466966_0282006 3300044684 Bacteria 999
266 Ga0466961_0063932 3300044693 Bacteria 2339
267 Ga0466961_0203656 3300044693 Bacteria 1223
268 Ga0466961_0243643 3300044693 Bacteria 1105
269 Ga0466963_0003323 3300044694 Bacteria 9178
270 Ga0466963_0003551 3300044694 Bacteria 8955
271 Ga0466963_0004207 3300044694 Bacteria 8343
272 Ga0466963_0015569 3300044694 Bacteria 4712
273 Ga0466963_0050286 3300044694 Bacteria 2759
274 Ga0466963_0070026 3300044694 Bacteria 2359
275 Ga0466963_0095988 3300044694 Bacteria 2025
276 Ga0466963_0119218 3300044694 Bacteria 1815
277 Ga0466963_0123127 3300044694 Bacteria 1786
278 Ga0466963_0177263 3300044694 Bacteria 1487
279 Ga0466963_0358021 3300044694 Bacteria 1028
280 Ga0466963_0424119 3300044694 Bacteria 938
281 Ga0466963_0433444 3300044694 Bacteria 927
282 Ga0466964_0067082 3300044706 Bacteria 1507
283 Ga0466964_0208666 3300044706 Bacteria 942
284 Ga0466971_0165525 3300044719 Bacteria 1036
285 Ga0466971_0192303 3300044719 Bacteria 962
286 Ga0466968_0131784 3300044735 Bacteria 1138
287 Ga0466970_0223989 3300044765 Bacteria 1050
288 Ga0466957_0003395 3300044842 Bacteria 8743
289 Ga0466957_0125969 3300044842 Bacteria 1637
290 Ga0466957_0213867 3300044842 Bacteria 1270
291 Ga0466957_0392573 3300044842 Bacteria 948
292 Ga0466960_0000295 3300044901 Bacteria 17349
293 Ga0466960_0016906 3300044901 Bacteria 3172
294 Ga0466960_0020216 3300044901 Bacteria 2946
295 Ga0466960_0077464 3300044901 Bacteria 1667
296 Ga0466960_0125929 3300044901 Bacteria 1347
297 Ga0466960_0157207 3300044901 Bacteria 1218
298 Ga0466959_0002653 3300045049 Bacteria 11487
299 Ga0466959_0004573 3300045049 Bacteria 9288
300 Ga0466959_0015733 3300045049 Bacteria 5517
301 Ga0466959_0038131 3300045049 Bacteria 3551
302 Ga0466959_0084964 3300045049 Bacteria 2278
303 Ga0466959_0164293 3300045049 Bacteria 1559
304 Ga0466959_0398155 3300045049 Bacteria 936
305 Ga0466959_0452539 3300045049 Bacteria 870
306 Ga0466958_0001090 3300045836 Bacteria 12494
307 Ga0466958_0012186 3300045836 Bacteria 4861
308 Ga0466958_0046674 3300045836 Bacteria 2614
309 Ga0466958_0103435 3300045836 Bacteria 1773
310 Ga0466958_0282637 3300045836 Bacteria 1064
311 Ga0466967_0002636 3300045976 Bacteria 11300
312 Ga0466967_0005296 3300045976 Bacteria 8903
313 Ga0466967_0016009 3300045976 Bacteria 5898
314 Ga0466967_0099850 3300045976 Bacteria 2651
315 Ga0466967_0166710 3300045976 Bacteria 2070
316 Ga0466967_0274931 3300045976 Bacteria 1615
317 Ga0466967_0402701 3300045976 Bacteria 1332
318 Ga0495592_0025384 3300046454 Bacteria 4499
319 Ga0495651_0030878 3300046462 Bacteria 4178
320 Ga0495653_0038490 3300046463 Bacteria 3754
321 Ga0495650_0000049 3300046471 Bacteria 325092
322 Ga0495664_0053494 3300046477 Bacteria 2401
323 Ga0495608_0003201 3300046511 Bacteria 11717
324 Ga0495628_0003431 3300046516 Bacteria 14190
325 Ga0495630_0084987 3300046517 Bacteria 2389
326 Ga0495652_0026665 3300046529 Bacteria 5102
327 Ga0495652_0283865 3300046529 Bacteria 1211
328 Ga0495640_0013080 3300046533 Bacteria 6320
329 Ga0495667_0004117 3300046559 Bacteria 9771
330 Ga0495634_0357485 3300046642 Bacteria 873
331 Ga0495657_0009078 3300046675 Bacteria 7557
332 Ga0495599_0030369 3300046678 Bacteria 3391
333 Ga0495623_0183112 3300046679 Bacteria 1216
334 Ga0495646_0047362 3300046680 Bacteria 2617
335 Ga0495658_0269793 3300046683 Bacteria 1072
336 Ga0495613_0144676 3300046689 Bacteria 1697
337 Ga0495600_0004356 3300046809 Bacteria 8471
338 Ga0495604_0009995 3300047317 Bacteria 7512
339 Ga0495674_0006771 3300047319 Bacteria 10971
340 Ga0495680_0005847 3300047322 Bacteria 11517
341 Ga0495602_0034458 3300048088 Bacteria 4736
342 Ga0496100_0000425 3300048903 Bacteria 20471
343 Ga0496100_0025007 3300048903 Bacteria 3648
344 Ga0496100_0332107 3300048903 Bacteria 1144
345 Ga0496101_0001515 3300048904 Bacteria 13899
346 Ga0496101_0239571 3300048904 Bacteria 1411
347 Ga0496101_0249224 3300048904 Bacteria 1383
348 Ga0496101_0306257 3300048904 Bacteria 1245
349 Ga0496102_0159907 3300048905 Bacteria 2119
350 Ga0496103_0208572 3300048906 Bacteria 1256
351 Ga0496104_0033651 3300048907 Bacteria 4777
352 Ga0496105_0070116 3300048908 Bacteria 2897
353 Ga0496105_0763635 3300048908 Bacteria 737
354 Ga0496106_0105890 3300048909 Bacteria 2185
355 Ga0496106_0157916 3300048909 Bacteria 1792
356 Ga0496107_0008339 3300048910 Bacteria 7169
357 Ga0496107_0418609 3300048910 Bacteria 996
358 Ga0496108_0028423 3300048911 Bacteria 4626
359 Ga0496108_0111225 3300048911 Bacteria 2342
360 Ga0496108_0483853 3300048911 Bacteria 1081
361 Ga0496109_0004722 3300048912 Bacteria 11381
362 Ga0496109_0243431 3300048912 Bacteria 1693
363 Ga0496110_0058935 3300048913 Bacteria 3382
364 Ga0496110_0254374 3300048913 Bacteria 1599
365 Ga0496111_0141498 3300048914 Bacteria 1782
366 Ga0496111_0193233 3300048914 Bacteria 1513
367 Ga0496112_0002991 3300048915 Bacteria 13802
368 Ga0496112_0343299 3300048915 Bacteria 1436
369 Ga0496113_0087219 3300048916 Bacteria 2399
370 Ga0496113_0446984 3300048916 Bacteria 1038
371 Ga0496115_0062532 3300048918 Bacteria 3003
372 Ga0496115_0131261 3300048918 Bacteria 2065
373 Ga0496115_0193959 3300048918 Bacteria 1678
374 Ga0496115_0540012 3300048918 Bacteria 933
375 Ga0496121_0182509 3300048924 Bacteria 1513
376 Ga0496124_0076174 3300048927 Bacteria 2770
377 Ga0501031_0075363 3300049568 Unclassified 2197
378 Ga0501032_0002728 3300049569 Bacteria 13755
379 Ga0501032_0256193 3300049569 Bacteria 1135
380 Ga0501034_0010201 3300049571 Bacteria 9799
381 Ga0501034_0521029 3300049571 Bacteria 1101
382 Ga0501036_0148260 3300049572 Bacteria 1979
383 Ga0501036_0796594 3300049572 Bacteria 778
384 Ga0501037_0098069 3300049573 Bacteria 2117
385 Ga0501037_0134437 3300049573 Bacteria 1772
386 Ga0501038_0036851 3300049574 Bacteria 4292
387 Ga0501038_0138265 3300049574 Bacteria 1995
388 Ga0501038_0167714 3300049574 Bacteria 1780
389 Ga0501039_0083525 3300049575 Bacteria 2487
390 Ga0501040_0042403 3300049576 Bacteria 3099
391 Ga0501040_0085119 3300049576 Bacteria 2194
392 Ga0501041_0041172 3300049577 Unclassified 2805
393 Ga0501042_0046319 3300049578 Bacteria 3100
394 Ga0501042_0169374 3300049578 Bacteria 1576
395 Ga0501042_0694776 3300049578 Bacteria 740
396 Ga0501046_0044364 3300049580 Bacteria 3536
397 Ga0501046_0297175 3300049580 Bacteria 1180
398 Ga0501047_0096506 3300049581 Bacteria 2835
399 Ga0501048_0071880 3300049582 Bacteria 2442
400 Ga0501067_0285981 3300049583 Bacteria 918
401 Ga0501068_0171206 3300049584 Bacteria 1371
402 Ga0501070_0005800 3300049586 Bacteria 10537
403 Ga0501070_0141318 3300049586 Bacteria 1988
404 Ga0501070_0344658 3300049586 Bacteria 1210
405 Ga0501071_0045220 3300049587 Unclassified 3160
406 Ga0501071_0483080 3300049587 Bacteria 950
407 Ga0501072_0008180 3300049588 Bacteria 7941
408 Ga0501072_0091337 3300049588 Bacteria 2418
409 Ga0501072_0157883 3300049588 Bacteria 1809
410 Ga0501072_0483304 3300049588 Bacteria 980
411 Ga0501074_0061999 3300049590 Bacteria 2694
412 Ga0501074_0391271 3300049590 Bacteria 986
413 Ga0501075_0015265 3300049591 Bacteria 5510
414 Ga0501075_0063217 3300049591 Unclassified 2790
415 Ga0501075_0184645 3300049591 Unclassified 1591
416 Ga0501075_0193331 3300049591 Bacteria 1552
417 Ga0501075_0487691 3300049591 Bacteria 940
418 Ga0501076_0023862 3300049592 Bacteria 4719
419 Ga0501076_0044366 3300049592 Bacteria 3506
420 Ga0501076_0615978 3300049592 Bacteria 896
421 Ga0501077_0094124 3300049593 Unclassified 1899
422 Ga0501079_0016367 3300049741 Bacteria 5665
423 Ga0501079_0026055 3300049741 Bacteria 4484
424 Ga0501079_0052103 3300049741 Unclassified 3160
425 Ga0501080_0028678 3300049742 Bacteria 5181
426 Ga0501080_0096282 3300049742 Unclassified 2748
427 Ga0501080_0363371 3300049742 Bacteria 1306
428 Ga0501081_0095656 3300049743 Bacteria 2094
429 Ga0501081_0146406 3300049743 Bacteria 1695
430 Ga0501035_0469673 3300049822 Bacteria 1039
431 Ga0501044_0011938 3300049823 Bacteria 9414
432 Ga0501044_0645423 3300049823 Bacteria 948
433 Ga0501044_1042022 3300049823 Bacteria 689
434 Ga0501045_0016344 3300049824 Bacteria 5269
435 nmdc:mga0n895_526530_c1 3300050512 Bacteria 1189
436 nmdc:mga0rr50_126879_c1 3300050513 Bacteria 2038
437 nmdc:mga0a205_289002_c1 3300050515 Bacteria 1514
438 Ga0495601_0191704 3300053077 Bacteria 1336
439 Ga0495655_0094333 3300053083 Bacteria 877
440 Ga0495595_0004022 3300053084 Bacteria 5881
441 Ga0495619_0016438 3300053085 Bacteria 4684
442 Ga0500646_0000086 3300053090 Bacteria 26159
443 Ga0501084_0077869 3300054114 Bacteria 2779
444 Ga0501084_0097809 3300054114 Bacteria 2464
445 Ga0501082_0038506 3300060353 Bacteria 4126
446 Ga0501082_0379414 3300060353 Bacteria 1233
447 Ga0501082_0655512 3300060353 Bacteria 919
448 Ga0466962_0023790 3300061719 Bacteria 2944
449 Ga0466962_0041917 3300061719 Bacteria 2190
450 Ga0530510_0065861 3300061734 Bacteria 2626
451 Ga0530510_0138517 3300061734 Bacteria 1792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_1042022 Ga0501044_1042022_103_660 185
2 3300060353 Ga0501082_0655512 Ga0501082_0655512_308_907 198
3 3300041451 Ga0451791_1240560 Ga0451791_1240560_648_1247 199
4 3300025944 Ga0207661_10693302 Ga0207661_106933022 218
5 3300044684 Ga0466966_0080699 Ga0466966_0080699_1202_1861 218
6 3300044694 Ga0466963_0004207 Ga0466963_0004207_1230_1889 218
7 3300044694 Ga0466963_0070026 Ga0466963_0070026_10_666 218
8 3300044694 Ga0466963_0119218 Ga0466963_0119218_538_1197 218
9 3300044694 Ga0466963_0123127 Ga0466963_0123127_140_796 218
10 3300044901 Ga0466960_0016906 Ga0466960_0016906_456_1169 218
11 3300045049 Ga0466959_0015733 Ga0466959_0015733_780_1439 218
12 3300045836 Ga0466958_0012186 Ga0466958_0012186_3925_4584 218
13 3300045976 Ga0466967_0005296 Ga0466967_0005296_2565_3221 218
14 3300045976 Ga0466967_0016009 Ga0466967_0016009_2672_3385 218
15 3300045976 Ga0466967_0274931 Ga0466967_0274931_38_697 218
16 3300049588 Ga0501072_0091337 Ga0501072_0091337_836_1531 218
17 3300049591 Ga0501075_0487691 Ga0501075_0487691_24_719 218
18 3300053077 Ga0495601_0191704 Ga0495601_0191704_562_1239 219
19 3300005334 Ga0068869_100194026 Ga0068869_1001940262 220
20 3300005338 Ga0068868_100061269 Ga0068868_1000612692 220
21 3300005339 Ga0070660_100148223 Ga0070660_1001482232 220
22 3300005347 Ga0070668_100092661 Ga0070668_1000926612 220
23 3300005547 Ga0070693_100187078 Ga0070693_1001870782 220
24 3300005578 Ga0068854_100621352 Ga0068854_1006213521 220
25 3300005616 Ga0068852_100042309 Ga0068852_1000423092 220
26 3300005844 Ga0068862_100036836 Ga0068862_1000368364 220
27 3300006175 Ga0070712_100095362 Ga0070712_1000953622 220
28 3300010375 Ga0105239_10093541 Ga0105239_100935412 220
29 3300013306 Ga0163162_10183885 Ga0163162_101838851 220
30 3300025901 Ga0207688_10008801 Ga0207688_100088013 220
31 3300025915 Ga0207693_10084143 Ga0207693_100841432 220
32 3300025924 Ga0207694_10452550 Ga0207694_104525502 220
33 3300025927 Ga0207687_10262991 Ga0207687_102629912 220
34 3300025972 Ga0207668_10390294 Ga0207668_103902942 220
35 3300026116 Ga0207674_10152000 Ga0207674_101520002 220
36 3300026121 Ga0207683_10463727 Ga0207683_104637271 220
37 3300026142 Ga0207698_10319868 Ga0207698_103198682 220
38 3300044694 Ga0466963_0095988 Ga0466963_0095988_1161_1823 220
39 3300044694 Ga0466963_0177263 Ga0466963_0177263_477_1139 220
40 3300044706 Ga0466964_0067082 Ga0466964_0067082_388_1050 220
41 3300044719 Ga0466971_0165525 Ga0466971_0165525_14_676 220
42 3300044842 Ga0466957_0213867 Ga0466957_0213867_429_1091 220
43 3300045976 Ga0466967_0166710 Ga0466967_0166710_838_1500 220
44 3300048904 Ga0496101_0306257 Ga0496101_0306257_287_949 220
45 3300049583 Ga0501067_0285981 Ga0501067_0285981_212_874 220
46 3300049588 Ga0501072_0483304 Ga0501072_0483304_98_760 220
47 3300061719 Ga0466962_0041917 Ga0466962_0041917_624_1286 220
48 3300005355 Ga0070671_100189629 Ga0070671_1001896292 221
49 3300005356 Ga0070674_100579062 Ga0070674_1005790622 221
50 3300044901 Ga0466960_0125929 Ga0466960_0125929_185_886 221
51 3300049578 Ga0501042_0694776 Ga0501042_0694776_19_684 221
52 3300005331 Ga0070670_100450427 Ga0070670_1004504272 222
53 3300005337 Ga0070682_100093158 Ga0070682_1000931582 222
54 3300005337 Ga0070682_100116514 Ga0070682_1001165141 222
55 3300005343 Ga0070687_100025587 Ga0070687_1000255872 222
56 3300005345 Ga0070692_10028779 Ga0070692_100287792 222
57 3300005365 Ga0070688_100080007 Ga0070688_1000800072 222
58 3300005438 Ga0070701_10160024 Ga0070701_101600241 222
59 3300005441 Ga0070700_100020738 Ga0070700_1000207383 222
60 3300005459 Ga0068867_100391039 Ga0068867_1003910392 222
61 3300005535 Ga0070684_100230115 Ga0070684_1002301151 222
62 3300005544 Ga0070686_100026392 Ga0070686_1000263922 222
63 3300005564 Ga0070664_100031409 Ga0070664_1000314092 222
64 3300005564 Ga0070664_100265533 Ga0070664_1002655332 222
65 3300005719 Ga0068861_100165577 Ga0068861_1001655772 222
66 3300005719 Ga0068861_100395895 Ga0068861_1003958952 222
67 3300005841 Ga0068863_100261696 Ga0068863_1002616962 222
68 3300005842 Ga0068858_100406990 Ga0068858_1004069902 222
69 3300005843 Ga0068860_100108537 Ga0068860_1001085372 222
70 3300005983 Ga0081540_1002305 Ga0081540_10023058 222
71 3300005985 Ga0081539_10005993 Ga0081539_100059937 222
72 3300005985 Ga0081539_10029706 Ga0081539_100297063 222
73 3300006871 Ga0075434_100180491 Ga0075434_1001804912 222
74 3300007076 Ga0075435_100180145 Ga0075435_1001801452 222
75 3300009011 Ga0105251_10048202 Ga0105251_100482022 222
76 3300009098 Ga0105245_10051338 Ga0105245_100513383 222
77 3300009148 Ga0105243_10216545 Ga0105243_102165452 222
78 3300009176 Ga0105242_10359915 Ga0105242_103599152 222
79 3300009177 Ga0105248_10336019 Ga0105248_103360192 222
80 3300009553 Ga0105249_10294381 Ga0105249_102943812 222
81 3300010375 Ga0105239_10277277 Ga0105239_102772772 222
82 3300013297 Ga0157378_10030679 Ga0157378_100306791 222
83 3300013306 Ga0163162_10152607 Ga0163162_101526072 222
84 3300013306 Ga0163162_10322244 Ga0163162_103222442 222
85 3300014325 Ga0163163_10279860 Ga0163163_102798601 222
86 3300014326 Ga0157380_10247373 Ga0157380_102473731 222
87 3300014969 Ga0157376_10126083 Ga0157376_101260832 222
88 3300025899 Ga0207642_10020453 Ga0207642_100204532 222
89 3300025900 Ga0207710_10022235 Ga0207710_100222351 222
90 3300025908 Ga0207643_10004576 Ga0207643_100045764 222
91 3300025914 Ga0207671_10153411 Ga0207671_101534112 222
92 3300025918 Ga0207662_10019922 Ga0207662_100199224 222
93 3300025925 Ga0207650_10155411 Ga0207650_101554112 222
94 3300025927 Ga0207687_10028698 Ga0207687_100286982 222
95 3300025934 Ga0207686_10279210 Ga0207686_102792102 222
96 3300025942 Ga0207689_10306214 Ga0207689_103062142 222
97 3300025944 Ga0207661_10092967 Ga0207661_100929672 222
98 3300025981 Ga0207640_10735273 Ga0207640_107352731 222
99 3300026041 Ga0207639_10123882 Ga0207639_101238822 222
100 3300026075 Ga0207708_10016372 Ga0207708_100163722 222
101 3300026095 Ga0207676_10058391 Ga0207676_100583911 222
102 3300026121 Ga0207683_10169544 Ga0207683_101695442 222
103 3300028381 Ga0268264_10172779 Ga0268264_101727792 222
104 3300031852 Ga0307410_10262172 Ga0307410_102621722 222
105 3300032126 Ga0307415_100117464 Ga0307415_1001174642 222
106 3300037312 Ga0395899_0140184 Ga0395899_0140184_268_936 222
107 3300037418 Ga0395900_0061930 Ga0395900_0061930_1046_1714 222
108 3300037471 Ga0395905_0486791 Ga0395905_0486791_368_1036 222
109 3300046683 Ga0495658_0269793 Ga0495658_0269793_231_899 222
110 3300048903 Ga0496100_0025007 Ga0496100_0025007_1563_2234 222
111 3300048903 Ga0496100_0332107 Ga0496100_0332107_67_780 222
112 3300048904 Ga0496101_0239571 Ga0496101_0239571_366_1037 222
113 3300048904 Ga0496101_0249224 Ga0496101_0249224_549_1253 222
114 3300048906 Ga0496103_0208572 Ga0496103_0208572_18_722 222
115 3300048908 Ga0496105_0070116 Ga0496105_0070116_706_1410 222
116 3300048909 Ga0496106_0105890 Ga0496106_0105890_684_1397 222
117 3300048910 Ga0496107_0008339 Ga0496107_0008339_6405_7109 222
118 3300048911 Ga0496108_0028423 Ga0496108_0028423_1273_1986 222
119 3300048913 Ga0496110_0058935 Ga0496110_0058935_285_989 222
120 3300048914 Ga0496111_0141498 Ga0496111_0141498_1008_1721 222
121 3300048918 Ga0496115_0062532 Ga0496115_0062532_1592_2305 222
122 3300050513 nmdc:mga0rr50_126879_c1 nmdc:mga0rr50_126879_c1_64_777 222
123 3300053083 Ga0495655_0094333 Ga0495655_0094333_145_834 222
124 3300005434 Ga0070709_10024102 Ga0070709_100241023 223
125 3300005435 Ga0070714_100132991 Ga0070714_1001329911 223
126 3300005435 Ga0070714_100143147 Ga0070714_1001431472 223
127 3300005435 Ga0070714_100248004 Ga0070714_1002480042 223
128 3300005435 Ga0070714_100302520 Ga0070714_1003025202 223
129 3300005437 Ga0070710_10051518 Ga0070710_100515182 223
130 3300005439 Ga0070711_100394009 Ga0070711_1003940092 223
131 3300005535 Ga0070684_100549406 Ga0070684_1005494062 223
132 3300005546 Ga0070696_100472918 Ga0070696_1004729182 223
133 3300005615 Ga0070702_100191355 Ga0070702_1001913552 223
134 3300005981 Ga0081538_10000097 Ga0081538_1000009791 223
135 3300006028 Ga0070717_10009896 Ga0070717_100098962 223
136 3300006028 Ga0070717_10307217 Ga0070717_103072172 223
137 3300006028 Ga0070717_10891827 Ga0070717_108918271 223
138 3300006175 Ga0070712_100089541 Ga0070712_1000895412 223
139 3300006175 Ga0070712_100109400 Ga0070712_1001094002 223
140 3300006881 Ga0068865_100331146 Ga0068865_1003311462 223
141 3300009098 Ga0105245_10124852 Ga0105245_101248522 223
142 3300009098 Ga0105245_10217794 Ga0105245_102177942 223
143 3300009148 Ga0105243_10274145 Ga0105243_102741452 223
144 3300021377 Ga0213874_10014936 Ga0213874_100149362 223
145 3300021384 Ga0213876_10022352 Ga0213876_100223522 223
146 3300025898 Ga0207692_10044539 Ga0207692_100445392 223
147 3300025898 Ga0207692_10168686 Ga0207692_101686862 223
148 3300025906 Ga0207699_10181377 Ga0207699_101813772 223
149 3300025915 Ga0207693_10001773 Ga0207693_100017732 223
150 3300025928 Ga0207700_10125704 Ga0207700_101257041 223
151 3300025929 Ga0207664_10060662 Ga0207664_100606623 223
152 3300025929 Ga0207664_10326228 Ga0207664_103262281 223
153 3300025931 Ga0207644_10285647 Ga0207644_102856472 223
154 3300025935 Ga0207709_10211626 Ga0207709_102116262 223
155 3300025938 Ga0207704_10533012 Ga0207704_105330122 223
156 3300026118 Ga0207675_100909426 Ga0207675_1009094261 223
157 3300031903 Ga0307407_10131121 Ga0307407_101311212 223
158 3300031995 Ga0307409_100139625 Ga0307409_1001396252 223
159 3300032005 Ga0307411_10158678 Ga0307411_101586782 223
160 3300035111 Ga0373923_0085557 Ga0373923_0085557_300_974 223
161 3300035117 Ga0373953_0045037 Ga0373953_0045037_578_1252 223
162 3300035120 Ga0373957_0045595 Ga0373957_0045595_582_1256 223
163 3300035172 Ga0373955_0235317 Ga0373955_0235317_112_786 223
164 3300035410 Ga0373924_0034743 Ga0373924_0034743_946_1620 223
165 3300035724 Ga0373933_0015790 Ga0373933_0015790_686_1360 223
166 3300036401 Ga0373937_0019717 Ga0373937_0019717_3508_4182 223
167 3300037853 Ga0436364_0185829 Ga0436364_0185829_3350_4024 223
168 3300037853 Ga0436364_0608591 Ga0436364_0608591_3887_4561 223
169 3300037853 Ga0436364_0778331 Ga0436364_0778331_155_829 223
170 3300037853 Ga0436364_0778406 Ga0436364_0778406_717_1391 223
171 3300037853 Ga0436364_1039013 Ga0436364_1039013_232_906 223
172 3300039437 Ga0436365_0443181 Ga0436365_0443181_2475_3149 223
173 3300039437 Ga0436365_1001435 Ga0436365_1001435_1552_2226 223
174 3300039437 Ga0436365_1783583 Ga0436365_1783583_542_1216 223
175 3300039438 Ga0436360_0546571 Ga0436360_0546571_715_1389 223
176 3300039450 Ga0436363_0019223 Ga0436363_0019223_177_851 223
177 3300039450 Ga0436363_0154603 Ga0436363_0154603_1645_2319 223
178 3300039450 Ga0436363_0393580 Ga0436363_0393580_328_1002 223
179 3300039450 Ga0436363_1056306 Ga0436363_1056306_1820_2494 223
180 3300039450 Ga0436363_1089578 Ga0436363_1089578_139_813 223
181 3300039450 Ga0436363_1500658 Ga0436363_1500658_2973_3647 223
182 3300039450 Ga0436363_1571055 Ga0436363_1571055_250_924 223
183 3300044683 Ga0466965_0131995 Ga0466965_0131995_476_1159 223
184 3300044684 Ga0466966_0282006 Ga0466966_0282006_105_779 223
185 3300044693 Ga0466961_0063932 Ga0466961_0063932_1349_2023 223
186 3300044693 Ga0466961_0243643 Ga0466961_0243643_207_881 223
187 3300044694 Ga0466963_0003323 Ga0466963_0003323_5443_6117 223
188 3300044694 Ga0466963_0050286 Ga0466963_0050286_1534_2208 223
189 3300044694 Ga0466963_0358021 Ga0466963_0358021_338_1012 223
190 3300044694 Ga0466963_0424119 Ga0466963_0424119_38_712 223
191 3300044901 Ga0466960_0020216 Ga0466960_0020216_937_1608 223
192 3300044901 Ga0466960_0157207 Ga0466960_0157207_374_1045 223
193 3300045049 Ga0466959_0002653 Ga0466959_0002653_697_1371 223
194 3300045049 Ga0466959_0038131 Ga0466959_0038131_1483_2157 223
195 3300045836 Ga0466958_0282637 Ga0466958_0282637_41_715 223
196 3300045976 Ga0466967_0402701 Ga0466967_0402701_16_690 223
197 3300046454 Ga0495592_0025384 Ga0495592_0025384_1684_2358 223
198 3300046462 Ga0495651_0030878 Ga0495651_0030878_857_1531 223
199 3300046463 Ga0495653_0038490 Ga0495653_0038490_340_1014 223
200 3300046477 Ga0495664_0053494 Ga0495664_0053494_932_1606 223
201 3300046511 Ga0495608_0003201 Ga0495608_0003201_6222_6896 223
202 3300046516 Ga0495628_0003431 Ga0495628_0003431_2619_3293 223
203 3300046517 Ga0495630_0084987 Ga0495630_0084987_1001_1675 223
204 3300046529 Ga0495652_0026665 Ga0495652_0026665_4408_5082 223
205 3300046533 Ga0495640_0013080 Ga0495640_0013080_440_1114 223
206 3300046559 Ga0495667_0004117 Ga0495667_0004117_7691_8365 223
207 3300046642 Ga0495634_0357485 Ga0495634_0357485_133_807 223
208 3300046675 Ga0495657_0009078 Ga0495657_0009078_1538_2212 223
209 3300046678 Ga0495599_0030369 Ga0495599_0030369_2578_3252 223
210 3300046679 Ga0495623_0183112 Ga0495623_0183112_286_960 223
211 3300046680 Ga0495646_0047362 Ga0495646_0047362_423_1097 223
212 3300046689 Ga0495613_0144676 Ga0495613_0144676_729_1403 223
213 3300046809 Ga0495600_0004356 Ga0495600_0004356_2746_3420 223
214 3300047317 Ga0495604_0009995 Ga0495604_0009995_5702_6376 223
215 3300047319 Ga0495674_0006771 Ga0495674_0006771_8057_8731 223
216 3300047322 Ga0495680_0005847 Ga0495680_0005847_6417_7091 223
217 3300048088 Ga0495602_0034458 Ga0495602_0034458_1030_1704 223
218 3300048907 Ga0496104_0033651 Ga0496104_0033651_663_1337 223
219 3300048908 Ga0496105_0763635 Ga0496105_0763635_34_708 223
220 3300048911 Ga0496108_0483853 Ga0496108_0483853_326_1000 223
221 3300048915 Ga0496112_0002991 Ga0496112_0002991_1663_2337 223
222 3300048916 Ga0496113_0087219 Ga0496113_0087219_85_759 223
223 3300048916 Ga0496113_0446984 Ga0496113_0446984_89_763 223
224 3300048918 Ga0496115_0193959 Ga0496115_0193959_144_818 223
225 3300048918 Ga0496115_0540012 Ga0496115_0540012_200_874 223
226 3300048927 Ga0496124_0076174 Ga0496124_0076174_2047_2718 223
227 3300049571 Ga0501034_0521029 Ga0501034_0521029_273_944 223
228 3300049587 Ga0501071_0483080 Ga0501071_0483080_124_798 223
229 3300050512 nmdc:mga0n895_526530_c1 nmdc:mga0n895_526530_c1_347_1063 223
230 3300053084 Ga0495595_0004022 Ga0495595_0004022_445_1119 223
231 3300053085 Ga0495619_0016438 Ga0495619_0016438_3479_4153 223
232 3300061719 Ga0466962_0023790 Ga0466962_0023790_2082_2756 223
233 3300005435 Ga0070714_100050762 Ga0070714_1000507622 224
234 3300005440 Ga0070705_100180946 Ga0070705_1001809462 224
235 3300005441 Ga0070700_100247954 Ga0070700_1002479541 224
236 3300005441 Ga0070700_100252952 Ga0070700_1002529522 224
237 3300005548 Ga0070665_100370220 Ga0070665_1003702202 224
238 3300005615 Ga0070702_100035388 Ga0070702_1000353882 224
239 3300005616 Ga0068852_100255967 Ga0068852_1002559672 224
240 3300005843 Ga0068860_100480977 Ga0068860_1004809772 224
241 3300006028 Ga0070717_10017799 Ga0070717_100177995 224
242 3300006028 Ga0070717_10068029 Ga0070717_100680292 224
243 3300006028 Ga0070717_10141211 Ga0070717_101412112 224
244 3300006871 Ga0075434_100026917 Ga0075434_1000269173 224
245 3300009098 Ga0105245_10679921 Ga0105245_106799212 224
246 3300013306 Ga0163162_11319213 Ga0163162_113192131 224
247 3300025321 Ga0207656_10250421 Ga0207656_102504212 224
248 3300025928 Ga0207700_10195551 Ga0207700_101955512 224
249 3300025929 Ga0207664_10002159 Ga0207664_100021593 224
250 3300025961 Ga0207712_10809182 Ga0207712_108091821 224
251 3300025972 Ga0207668_10248714 Ga0207668_102487142 224
252 3300025981 Ga0207640_10234864 Ga0207640_102348642 224
253 3300026067 Ga0207678_10850032 Ga0207678_108500321 224
254 3300026075 Ga0207708_10207586 Ga0207708_102075862 224
255 3300026075 Ga0207708_10299258 Ga0207708_102992581 224
256 3300026118 Ga0207675_100529769 Ga0207675_1005297691 224
257 3300026142 Ga0207698_10852884 Ga0207698_108528842 224
258 3300032005 Ga0307411_10524445 Ga0307411_105244451 224
259 3300032126 Ga0307415_100148637 Ga0307415_1001486371 224
260 3300037418 Ga0395900_0004676 Ga0395900_0004676_1408_2085 224
261 3300037418 Ga0395900_0137468 Ga0395900_0137468_789_1463 224
262 3300037418 Ga0395900_0641993 Ga0395900_0641993_67_744 224
263 3300037466 Ga0395898_0000458 Ga0395898_0000458_64237_64911 224
264 3300037466 Ga0395898_0000490 Ga0395898_0000490_70294_70971 224
265 3300037853 Ga0436364_0605207 Ga0436364_0605207_1473_2150 224
266 3300037853 Ga0436364_1157926 Ga0436364_1157926_1180_1857 224
267 3300038443 Ga0395901_0084144 Ga0395901_0084144_2226_2903 224
268 3300038443 Ga0395901_0782149 Ga0395901_0782149_32_706 224
269 3300039437 Ga0436365_0731979 Ga0436365_0731979_6509_7186 224
270 3300044656 Ga0466969_0001975 Ga0466969_0001975_8697_9374 224
271 3300044683 Ga0466965_0023207 Ga0466965_0023207_1980_2654 224
272 3300044683 Ga0466965_0083639 Ga0466965_0083639_675_1352 224
273 3300044684 Ga0466966_0016412 Ga0466966_0016412_2135_2809 224
274 3300044684 Ga0466966_0087450 Ga0466966_0087450_411_1085 224
275 3300044693 Ga0466961_0203656 Ga0466961_0203656_347_1021 224
276 3300044694 Ga0466963_0003551 Ga0466963_0003551_6838_7515 224
277 3300044694 Ga0466963_0015569 Ga0466963_0015569_1128_1802 224
278 3300044694 Ga0466963_0433444 Ga0466963_0433444_33_707 224
279 3300044735 Ga0466968_0131784 Ga0466968_0131784_81_755 224
280 3300044765 Ga0466970_0223989 Ga0466970_0223989_265_939 224
281 3300044842 Ga0466957_0003395 Ga0466957_0003395_3084_3758 224
282 3300044842 Ga0466957_0392573 Ga0466957_0392573_92_769 224
283 3300044901 Ga0466960_0000295 Ga0466960_0000295_7002_7676 224
284 3300044901 Ga0466960_0077464 Ga0466960_0077464_697_1371 224
285 3300045049 Ga0466959_0004573 Ga0466959_0004573_5215_5889 224
286 3300045049 Ga0466959_0164293 Ga0466959_0164293_675_1349 224
287 3300045049 Ga0466959_0398155 Ga0466959_0398155_219_893 224
288 3300045049 Ga0466959_0452539 Ga0466959_0452539_167_841 224
289 3300045836 Ga0466958_0001090 Ga0466958_0001090_2739_3413 224
290 3300045836 Ga0466958_0103435 Ga0466958_0103435_780_1454 224
291 3300045976 Ga0466967_0002636 Ga0466967_0002636_9206_9880 224
292 3300046471 Ga0495650_0000049 Ga0495650_0000049_49097_49771 224
293 3300046529 Ga0495652_0283865 Ga0495652_0283865_520_1197 224
294 3300048911 Ga0496108_0111225 Ga0496108_0111225_596_1285 224
295 3300048914 Ga0496111_0193233 Ga0496111_0193233_723_1397 224
296 3300048924 Ga0496121_0182509 Ga0496121_0182509_802_1476 224
297 3300049571 Ga0501034_0010201 Ga0501034_0010201_4851_5525 224
298 3300049580 Ga0501046_0297175 Ga0501046_0297175_451_1125 224
299 3300049581 Ga0501047_0096506 Ga0501047_0096506_1146_1820 224
300 3300049586 Ga0501070_0141318 Ga0501070_0141318_353_1027 224
301 3300049591 Ga0501075_0184645 Ga0501075_0184645_131_808 224
302 3300049592 Ga0501076_0615978 Ga0501076_0615978_98_772 224
303 3300049742 Ga0501080_0363371 Ga0501080_0363371_109_786 224
304 3300005338 Ga0068868_100038150 Ga0068868_1000381503 225
305 3300005356 Ga0070674_100172672 Ga0070674_1001726722 225
306 3300005441 Ga0070700_100032583 Ga0070700_1000325833 225
307 3300005615 Ga0070702_100004116 Ga0070702_1000041163 225
308 3300005617 Ga0068859_100373778 Ga0068859_1003737782 225
309 3300005618 Ga0068864_100148815 Ga0068864_1001488152 225
310 3300005718 Ga0068866_10027283 Ga0068866_100272833 225
311 3300005843 Ga0068860_100396474 Ga0068860_1003964741 225
312 3300006038 Ga0075365_10117048 Ga0075365_101170482 225
313 3300006881 Ga0068865_100090568 Ga0068865_1000905682 225
314 3300006931 Ga0097620_100373734 Ga0097620_1003737342 225
315 3300009093 Ga0105240_10134380 Ga0105240_101343802 225
316 3300009174 Ga0105241_10232035 Ga0105241_102320352 225
317 3300009553 Ga0105249_10112159 Ga0105249_101121592 225
318 3300025899 Ga0207642_10011750 Ga0207642_100117504 225
319 3300025907 Ga0207645_10094995 Ga0207645_100949952 225
320 3300025908 Ga0207643_10155759 Ga0207643_101557593 225
321 3300025911 Ga0207654_10164790 Ga0207654_101647902 225
322 3300025913 Ga0207695_10341396 Ga0207695_103413962 225
323 3300025927 Ga0207687_10028735 Ga0207687_100287352 225
324 3300025935 Ga0207709_10028885 Ga0207709_100288852 225
325 3300025937 Ga0207669_10134926 Ga0207669_101349262 225
326 3300025938 Ga0207704_10657523 Ga0207704_106575231 225
327 3300025942 Ga0207689_10067945 Ga0207689_100679453 225
328 3300026023 Ga0207677_10035366 Ga0207677_100353663 225
329 3300026075 Ga0207708_10007805 Ga0207708_100078054 225
330 3300026089 Ga0207648_10111346 Ga0207648_101113462 225
331 3300026095 Ga0207676_10232076 Ga0207676_102320762 225
332 3300031247 Ga0265340_10005234 Ga0265340_100052343 225
333 3300044684 Ga0466966_0170371 Ga0466966_0170371_233_916 225
334 3300045049 Ga0466959_0084964 Ga0466959_0084964_317_1000 225
335 3300045976 Ga0466967_0099850 Ga0466967_0099850_1854_2549 225
336 3300048905 Ga0496102_0159907 Ga0496102_0159907_742_1419 225
337 3300048909 Ga0496106_0157916 Ga0496106_0157916_20_697 225
338 3300048910 Ga0496107_0418609 Ga0496107_0418609_250_927 225
339 3300048912 Ga0496109_0243431 Ga0496109_0243431_755_1432 225
340 3300048913 Ga0496110_0254374 Ga0496110_0254374_385_1062 225
341 3300049569 Ga0501032_0002728 Ga0501032_0002728_7790_8470 225
342 3300049572 Ga0501036_0148260 Ga0501036_0148260_52_729 225
343 3300049573 Ga0501037_0098069 Ga0501037_0098069_484_1164 225
344 3300049574 Ga0501038_0036851 Ga0501038_0036851_2115_2795 225
345 3300049574 Ga0501038_0167714 Ga0501038_0167714_84_761 225
346 3300049576 Ga0501040_0085119 Ga0501040_0085119_1471_2148 225
347 3300049578 Ga0501042_0046319 Ga0501042_0046319_563_1240 225
348 3300049582 Ga0501048_0071880 Ga0501048_0071880_457_1134 225
349 3300049586 Ga0501070_0005800 Ga0501070_0005800_7262_7942 225
350 3300049588 Ga0501072_0157883 Ga0501072_0157883_812_1489 225
351 3300049590 Ga0501074_0061999 Ga0501074_0061999_277_954 225
352 3300049591 Ga0501075_0015265 Ga0501075_0015265_4280_4957 225
353 3300049591 Ga0501075_0193331 Ga0501075_0193331_124_801 225
354 3300049592 Ga0501076_0044366 Ga0501076_0044366_1897_2574 225
355 3300049741 Ga0501079_0016367 Ga0501079_0016367_1615_2292 225
356 3300049741 Ga0501079_0026055 Ga0501079_0026055_2025_2702 225
357 3300049742 Ga0501080_0028678 Ga0501080_0028678_2840_3517 225
358 3300049743 Ga0501081_0095656 Ga0501081_0095656_851_1528 225
359 3300049823 Ga0501044_0011938 Ga0501044_0011938_6674_7354 225
360 3300049824 Ga0501045_0016344 Ga0501045_0016344_3855_4532 225
361 3300050515 nmdc:mga0a205_289002_c1 nmdc:mga0a205_289002_c1_61_741 225
362 3300054114 Ga0501084_0077869 Ga0501084_0077869_48_725 225
363 3300060353 Ga0501082_0038506 Ga0501082_0038506_1898_2575 225
364 3300061734 Ga0530510_0138517 Ga0530510_0138517_381_1058 225
365 3300005329 Ga0070683_100341484 Ga0070683_1003414842 226
366 3300005468 Ga0070707_100000025 Ga0070707_100000025109 226
367 3300005471 Ga0070698_100260921 Ga0070698_1002609212 226
368 3300005518 Ga0070699_100005998 Ga0070699_1000059987 226
369 3300005536 Ga0070697_100025186 Ga0070697_1000251865 226
370 3300005539 Ga0068853_100054155 Ga0068853_1000541553 226
371 3300005563 Ga0068855_100082298 Ga0068855_1000822982 226
372 3300006028 Ga0070717_10014653 Ga0070717_100146532 226
373 3300009094 Ga0111539_10518878 Ga0111539_105188781 226
374 3300009094 Ga0111539_10577742 Ga0111539_105777422 226
375 3300013105 Ga0157369_10238038 Ga0157369_102380381 226
376 3300021377 Ga0213874_10017019 Ga0213874_100170192 226
377 3300021384 Ga0213876_10007272 Ga0213876_100072727 226
378 3300021384 Ga0213876_10011115 Ga0213876_100111152 226
379 3300021388 Ga0213875_10008014 Ga0213875_100080145 226
380 3300025901 Ga0207688_10321720 Ga0207688_103217202 226
381 3300025913 Ga0207695_10084091 Ga0207695_100840912 226
382 3300025922 Ga0207646_10000002 Ga0207646_10000002470 226
383 3300025928 Ga0207700_10595945 Ga0207700_105959452 226
384 3300025942 Ga0207689_10322353 Ga0207689_103223532 226
385 3300025961 Ga0207712_10131723 Ga0207712_101317232 226
386 3300028563 Ga0265319_1071342 Ga0265319_10713422 226
387 3300037853 Ga0436364_0562411 Ga0436364_0562411_4935_5630 226
388 3300039437 Ga0436365_0297333 Ga0436365_0297333_5782_6522 226
389 3300039437 Ga0436365_1890546 Ga0436365_1890546_7791_8486 226
390 3300039450 Ga0436363_0743432 Ga0436363_0743432_5483_6178 226
391 3300039453 Ga0436362_0943471 Ga0436362_0943471_438_1178 226
392 3300044842 Ga0466957_0125969 Ga0466957_0125969_239_967 226
393 3300045836 Ga0466958_0046674 Ga0466958_0046674_1475_2203 226
394 3300048903 Ga0496100_0000425 Ga0496100_0000425_7212_7898 226
395 3300048904 Ga0496101_0001515 Ga0496101_0001515_13167_13853 226
396 3300048918 Ga0496115_0131261 Ga0496115_0131261_438_1133 226
397 3300049823 Ga0501044_0645423 Ga0501044_0645423_253_936 226
398 3300006038 Ga0075365_10119788 Ga0075365_101197882 227
399 3300005548 Ga0070665_100556558 Ga0070665_1005565582 228
400 3300006175 Ga0070712_100000006 Ga0070712_10000000644 228
401 3300014745 Ga0157377_10329052 Ga0157377_103290522 228
402 3300025915 Ga0207693_10000078 Ga0207693_1000007827 228
403 3300028563 Ga0265319_1010715 Ga0265319_10107154 228
404 3300028577 Ga0265318_10019760 Ga0265318_100197603 228
405 3300028800 Ga0265338_10037418 Ga0265338_100374184 228
406 3300031240 Ga0265320_10004759 Ga0265320_100047595 228
407 3300031711 Ga0265314_10087805 Ga0265314_100878052 228
408 3300044719 Ga0466971_0192303 Ga0466971_0192303_175_867 228
409 3300048912 Ga0496109_0004722 Ga0496109_0004722_5028_5750 228
410 3300031241 Ga0265325_10032200 Ga0265325_100322001 229
411 3300037418 Ga0395900_0459078 Ga0395900_0459078_454_1146 229
412 3300038443 Ga0395901_0880819 Ga0395901_0880819_30_722 229
413 3300049584 Ga0501068_0171206 Ga0501068_0171206_195_887 229
414 3300005436 Ga0070713_100410558 Ga0070713_1004105582 230
415 3300025960 Ga0207651_10546584 Ga0207651_105465842 230
416 3300044706 Ga0466964_0208666 Ga0466964_0208666_132_827 230
417 3300005937 Ga0081455_10038374 Ga0081455_100383745 231
418 3300031247 Ga0265340_10018711 Ga0265340_100187112 231
419 3300049568 Ga0501031_0075363 Ga0501031_0075363_965_1693 231
420 3300049569 Ga0501032_0256193 Ga0501032_0256193_134_862 231
421 3300049572 Ga0501036_0796594 Ga0501036_0796594_34_762 231
422 3300049573 Ga0501037_0134437 Ga0501037_0134437_686_1414 231
423 3300049574 Ga0501038_0138265 Ga0501038_0138265_831_1559 231
424 3300049575 Ga0501039_0083525 Ga0501039_0083525_145_873 231
425 3300049576 Ga0501040_0042403 Ga0501040_0042403_1667_2395 231
426 3300049577 Ga0501041_0041172 Ga0501041_0041172_1138_1866 231
427 3300049578 Ga0501042_0169374 Ga0501042_0169374_244_972 231
428 3300049580 Ga0501046_0044364 Ga0501046_0044364_1887_2615 231
429 3300049586 Ga0501070_0344658 Ga0501070_0344658_382_1110 231
430 3300049587 Ga0501071_0045220 Ga0501071_0045220_2079_2807 231
431 3300049588 Ga0501072_0008180 Ga0501072_0008180_5141_5869 231
432 3300049590 Ga0501074_0391271 Ga0501074_0391271_84_812 231
433 3300049591 Ga0501075_0063217 Ga0501075_0063217_178_906 231
434 3300049592 Ga0501076_0023862 Ga0501076_0023862_1971_2699 231
435 3300049593 Ga0501077_0094124 Ga0501077_0094124_592_1320 231
436 3300049741 Ga0501079_0052103 Ga0501079_0052103_456_1184 231
437 3300049742 Ga0501080_0096282 Ga0501080_0096282_325_1053 231
438 3300049743 Ga0501081_0146406 Ga0501081_0146406_382_1110 231
439 3300049822 Ga0501035_0469673 Ga0501035_0469673_210_938 231
440 3300053090 Ga0500646_0000086 Ga0500646_0000086_6286_6984 231
441 3300054114 Ga0501084_0097809 Ga0501084_0097809_1640_2368 231
442 3300060353 Ga0501082_0379414 Ga0501082_0379414_14_742 231
443 3300061734 Ga0530510_0065861 Ga0530510_0065861_1875_2603 231
444 3300028573 Ga0265334_10032734 Ga0265334_100327342 232
445 3300005329 Ga0070683_100273389 Ga0070683_1002733892 236
446 3300005458 Ga0070681_10121528 Ga0070681_101215282 236
447 3300005535 Ga0070684_100002782 Ga0070684_10000278213 236
448 3300005564 Ga0070664_100315159 Ga0070664_1003151592 236
449 3300025944 Ga0207661_10306687 Ga0207661_103066872 236
450 3300025945 Ga0207679_10128390 Ga0207679_101283902 236
451 3300048915 Ga0496112_0343299 Ga0496112_0343299_481_1191 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

49

159

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

192

267

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9866 9 126
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.986 9 126
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9853 9 126
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9852 8 125
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9783 7 123
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9831 8 87 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9812 9 89 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9789 9 87 3.40.50.2300
af_P23836_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9777 9 87 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9775 5 124 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1P8YLH9-F1-model_v4 Response regulator 0.9474 9 215 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-U0EDQ2-F1-model_v4 deleted 0.9429 6 236
AF-A0A3N6B5R0-F1-model_v4 deleted 0.9425 8 232
AF-A0A1Q3TPI6-F1-model_v4 DNA-binding response regulator 0.9423 8 231 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A850DDH1-F1-model_v4 Response regulator transcription factor 0.9405 9 233 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
85.37 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map