F446626

General Info

Members Datasets Scaffolds Average Seq Length
450 325 900 190

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0024800|Ga0373936_0024800_981_1643
Length 220
Sequence VDISNAGVRNLMNRPAGATAQRDPWRVLVTVAQIPDTGLHRDIEANQATREAMAEAADLREISAAHASFDLVPKSSGQVHVTGRVQARIGQTCVVTLEPIESEIDEPVDLIFTPAEQLPQFAHAADESPDSEAEIVDPLEPIENGTIDLGRLATDILYLAIDPYPRKPDAVFEPPVVAADPEDHPFAALKALRGDADAAGPASAGEMREGEKQKGKPNGK

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
236 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
241 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
242 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
243 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
244 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
245 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
246 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
247 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
248 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
249 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
250 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
251 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
252 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
253 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
254 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
259 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
260 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
264 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
265 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
266 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
267 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
268 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
269 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
270 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
271 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
272 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
273 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
274 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
275 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
277 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
278 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
279 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
280 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
281 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
282 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
283 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
284 2791355199
285 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
286 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
287 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
288 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
289 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
290 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
291 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
292 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
293 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
294 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
295 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
296 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
297 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
298 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
299 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
300 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
301 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
302 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
303 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
304 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
305 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
306 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
307 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
308 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
309 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
310 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
311 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
312 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
313 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
314 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
315 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
316 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
317 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
318 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
319 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
320 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
321 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
322 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
323 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
324 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
325 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.31
Metatranscriptomes 0
Isolates 10.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.33
Nodule 8
Rhizoplane 6.22
Rhizosphere 60
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0024800 3300035113 Bacteria 2344
2 JGI25153J46596_10004068 3300003215 Bacteria 7963
3 JGI25153J46596_10028490 3300003215 Bacteria 1935
4 rootH2_10062700 3300003320 Bacteria 1374
5 JGI25404J52841_10005715 3300003659 Bacteria 2574
6 Ga0065165_1040202 3300005262 Bacteria 1396
7 Ga0070676_10276640 3300005328 Bacteria 1129
8 Ga0070683_100192580 3300005329 Bacteria 1936
9 Ga0070680_100246469 3300005336 Bacteria 1510
10 Ga0070680_100420216 3300005336 Bacteria 1140
11 Ga0070682_100041914 3300005337 Bacteria 2824
12 Ga0070660_100112250 3300005339 Bacteria 2170
13 Ga0070691_10240110 3300005341 Bacteria 968
14 Ga0070661_100089282 3300005344 Bacteria 2282
15 Ga0070692_10310680 3300005345 Bacteria 966
16 Ga0070674_100099203 3300005356 Bacteria 2118
17 Ga0070673_100434442 3300005364 Bacteria 1179
18 Ga0070659_100186179 3300005366 Bacteria 1705
19 Ga0070667_100247727 3300005367 Bacteria 1592
20 Ga0070667_100516632 3300005367 Bacteria 1096
21 Ga0070709_10011971 3300005434 Bacteria 4848
22 Ga0070709_10058828 3300005434 Bacteria 2439
23 Ga0070709_10609432 3300005434 Bacteria 841
24 Ga0070714_100018170 3300005435 Bacteria 5705
25 Ga0070713_100037946 3300005436 Bacteria 3899
26 Ga0070713_100084093 3300005436 Bacteria 2722
27 Ga0070713_100396208 3300005436 Bacteria 1289
28 Ga0070710_10002013 3300005437 Bacteria 9610
29 Ga0070710_10071677 3300005437 Bacteria 1999
30 Ga0070701_10112240 3300005438 Bacteria 1524
31 Ga0070711_100014164 3300005439 Bacteria 5020
32 Ga0070711_100015664 3300005439 Bacteria 4799
33 Ga0070705_100360146 3300005440 Bacteria 1064
34 Ga0070700_100107960 3300005441 Bacteria 1845
35 Ga0070694_101012482 3300005444 Bacteria 690
36 Ga0070663_100035375 3300005455 Bacteria 3465
37 Ga0070663_100062892 3300005455 Bacteria 2677
38 Ga0070663_100090394 3300005455 Bacteria 2267
39 Ga0070663_100165205 3300005455 Bacteria 1707
40 Ga0070678_100030444 3300005456 Bacteria 3710
41 Ga0070678_100093526 3300005456 Bacteria 2312
42 Ga0070662_100052941 3300005457 Bacteria 2937
43 Ga0070681_10025556 3300005458 Bacteria 5940
44 Ga0070681_10310800 3300005458 Bacteria 1485
45 Ga0070681_10376421 3300005458 Bacteria 1330
46 Ga0068867_100284756 3300005459 Bacteria 1356
47 Ga0070685_10532494 3300005466 Bacteria 836
48 Ga0070706_100237580 3300005467 Bacteria 1701
49 Ga0070698_100009493 3300005471 Bacteria 10421
50 Ga0070698_100338238 3300005471 Bacteria 1437
51 Ga0070679_100014960 3300005530 Bacteria 7454
52 Ga0070684_100927076 3300005535 Bacteria 816
53 Ga0068853_100212506 3300005539 Bacteria 1764
54 Ga0070672_100218837 3300005543 Bacteria 1597
55 Ga0070672_100551178 3300005543 Bacteria 1001
56 Ga0070693_100102823 3300005547 Bacteria 1744
57 Ga0070693_100227389 3300005547 Bacteria 1226
58 Ga0070665_101234522 3300005548 Bacteria 758
59 Ga0068855_100052296 3300005563 Bacteria 4809
60 Ga0068855_101457792 3300005563 Bacteria 704
61 Ga0068854_100053991 3300005578 Bacteria 2888
62 Ga0068856_100137650 3300005614 Bacteria 2448
63 Ga0068856_101188208 3300005614 Bacteria 779
64 Ga0070702_100216720 3300005615 Bacteria 1277
65 Ga0068852_100039048 3300005616 Bacteria 3994
66 Ga0068852_100362623 3300005616 Bacteria 1418
67 Ga0068852_100376563 3300005616 Bacteria 1392
68 Ga0068852_100978342 3300005616 Bacteria 865
69 Ga0068861_100097199 3300005719 Bacteria 2335
70 Ga0068863_100694870 3300005841 Bacteria 1011
71 Ga0068858_100125790 3300005842 Bacteria 2400
72 Ga0068860_100304294 3300005843 Bacteria 1562
73 Ga0068862_100172110 3300005844 Bacteria 1939
74 Ga0081455_10067430 3300005937 Bacteria 2982
75 Ga0081540_1003795 3300005983 Bacteria 11825
76 Ga0081540_1024746 3300005983 Bacteria 3476
77 Ga0081540_1044699 3300005983 Bacteria 2258
78 Ga0081539_10058668 3300005985 Bacteria 2123
79 Ga0070717_10244656 3300006028 Bacteria 1583
80 Ga0075365_10039494 3300006038 Bacteria 3073
81 Ga0075365_10432628 3300006038 Bacteria 929
82 Ga0075364_10289977 3300006051 Bacteria 1114
83 Ga0070712_100040637 3300006175 Bacteria 3189
84 Ga0075367_10241987 3300006178 Bacteria 1131
85 Ga0075433_10424478 3300006852 Bacteria 1172
86 Ga0075434_100242139 3300006871 Bacteria 1824
87 Ga0075436_100397431 3300006914 Bacteria 998
88 Ga0099794_10028444 3300007265 Bacteria 2601
89 Ga0105240_10002351 3300009093 Bacteria 30510
90 Ga0105240_10089450 3300009093 Bacteria 3765
91 Ga0105240_10160357 3300009093 Bacteria 2672
92 Ga0111539_10150726 3300009094 Bacteria 2722
93 Ga0105245_10076305 3300009098 Bacteria 3053
94 Ga0105245_10254969 3300009098 Bacteria 1706
95 Ga0105243_10026993 3300009148 Bacteria 4397
96 Ga0105241_10054298 3300009174 Bacteria 3066
97 Ga0105241_10088520 3300009174 Bacteria 2438
98 Ga0105241_10150547 3300009174 Bacteria 1903
99 Ga0105241_10591089 3300009174 Bacteria 1002
100 Ga0105242_10153684 3300009176 Bacteria 2008
101 Ga0105237_10005556 3300009545 Bacteria 14219
102 Ga0105237_10299974 3300009545 Bacteria 1610
103 Ga0105237_10463056 3300009545 Bacteria 1274
104 Ga0105238_10506301 3300009551 Bacteria 1209
105 Ga0105238_10708271 3300009551 Bacteria 1019
106 Ga0105249_10274632 3300009553 Bacteria 1680
107 Ga0105239_10116074 3300010375 Bacteria 2970
108 Ga0105239_10171142 3300010375 Bacteria 2429
109 Ga0105239_10390983 3300010375 Bacteria 1573
110 Ga0105239_10608986 3300010375 Bacteria 1246
111 Ga0105246_10037124 3300011119 Bacteria 3268
112 Ga0157370_10086076 3300013104 Bacteria 2953
113 Ga0157369_10080589 3300013105 Bacteria 3485
114 Ga0157374_10563801 3300013296 Bacteria 1147
115 Ga0157378_10016765 3300013297 Bacteria 6419
116 Ga0157372_10255844 3300013307 Bacteria 2033
117 Ga0157380_10169735 3300014326 Bacteria 1905
118 Ga0157380_10291192 3300014326 Bacteria 1499
119 Ga0157379_10657427 3300014968 Bacteria 981
120 Ga0157376_10316469 3300014969 Bacteria 1482
121 Ga0163161_10557087 3300017792 Bacteria 940
122 Ga0209148_1001286 3300025254 Bacteria 13659
123 Ga0209233_1011972 3300025261 Bacteria 2534
124 Ga0209233_1029648 3300025261 Bacteria 1298
125 Ga0209455_1002705 3300025272 Bacteria 6668
126 Ga0209758_1003597 3300025297 Bacteria 13865
127 Ga0209758_1014026 3300025297 Bacteria 4307
128 Ga0207426_1005795 3300025302 Bacteria 5535
129 Ga0209257_1024320 3300025304 Bacteria 2100
130 Ga0207692_10001752 3300025898 Bacteria 8233
131 Ga0207692_10192455 3300025898 Bacteria 1195
132 Ga0207688_10019953 3300025901 Bacteria 3656
133 Ga0207688_10304798 3300025901 Bacteria 974
134 Ga0207647_10238371 3300025904 Bacteria 1045
135 Ga0207699_10041517 3300025906 Bacteria 2658
136 Ga0207699_10070326 3300025906 Bacteria 2136
137 Ga0207645_10047651 3300025907 Bacteria 2737
138 Ga0207705_10020230 3300025909 Bacteria 4760
139 Ga0207684_10116150 3300025910 Bacteria 2293
140 Ga0207654_10088577 3300025911 Bacteria 1881
141 Ga0207654_10099003 3300025911 Bacteria 1793
142 Ga0207654_10521609 3300025911 Bacteria 841
143 Ga0207707_10120934 3300025912 Bacteria 2289
144 Ga0207707_10121544 3300025912 Bacteria 2283
145 Ga0207707_10234941 3300025912 Bacteria 1595
146 Ga0207695_10000278 3300025913 Bacteria 127446
147 Ga0207695_10073482 3300025913 Bacteria 3484
148 Ga0207671_10005180 3300025914 Bacteria 12117
149 Ga0207693_10019182 3300025915 Bacteria 5442
150 Ga0207693_10312789 3300025915 Bacteria 1230
151 Ga0207663_10006350 3300025916 Bacteria 6042
152 Ga0207663_10283487 3300025916 Bacteria 1231
153 Ga0207660_10261506 3300025917 Bacteria 1369
154 Ga0207660_10376839 3300025917 Bacteria 1140
155 Ga0207657_10188265 3300025919 Bacteria 1666
156 Ga0207649_10068053 3300025920 Bacteria 2263
157 Ga0207649_10195583 3300025920 Bacteria 1425
158 Ga0207652_10016438 3300025921 Bacteria 6042
159 Ga0207652_10171277 3300025921 Bacteria 1948
160 Ga0207687_10105546 3300025927 Bacteria 2082
161 Ga0207700_10038213 3300025928 Bacteria 3483
162 Ga0207700_10041009 3300025928 Bacteria 3383
163 Ga0207700_10061434 3300025928 Bacteria 2849
164 Ga0207700_10104431 3300025928 Bacteria 2267
165 Ga0207664_10316312 3300025929 Bacteria 1377
166 Ga0207664_10480380 3300025929 Bacteria 1111
167 Ga0207644_10415668 3300025931 Bacteria 1101
168 Ga0207686_10107017 3300025934 Bacteria 1878
169 Ga0207709_10627346 3300025935 Bacteria 854
170 Ga0207704_10540707 3300025938 Bacteria 945
171 Ga0207691_10042708 3300025940 Bacteria 4178
172 Ga0207651_10325720 3300025960 Bacteria 1286
173 Ga0207668_10116687 3300025972 Bacteria 2013
174 Ga0207640_10313971 3300025981 Bacteria 1245
175 Ga0207658_10458908 3300025986 Bacteria 1129
176 Ga0207677_11088386 3300026023 Bacteria 728
177 Ga0207703_10821071 3300026035 Bacteria 888
178 Ga0207639_10019559 3300026041 Bacteria 4831
179 Ga0207639_10257255 3300026041 Bacteria 1525
180 Ga0207678_10204312 3300026067 Bacteria 1690
181 Ga0207708_10146053 3300026075 Bacteria 1859
182 Ga0207702_10123984 3300026078 Bacteria 2316
183 Ga0207702_11843987 3300026078 Bacteria 596
184 Ga0207648_10046604 3300026089 Bacteria 3801
185 Ga0207675_100235763 3300026118 Bacteria 1767
186 Ga0207683_10048974 3300026121 Bacteria 3698
187 Ga0207698_10031877 3300026142 Bacteria 3811
188 Ga0207698_10160972 3300026142 Bacteria 1963
189 Ga0207698_10327651 3300026142 Bacteria 1437
190 Ga0207698_10675264 3300026142 Bacteria 1026
191 Ga0207428_10063792 3300027907 Bacteria 2910
192 Ga0268266_10075279 3300028379 Bacteria 2932
193 Ga0268265_10433480 3300028380 Bacteria 1223
194 Ga0265340_10077864 3300031247 Bacteria 1564
195 Ga0265339_10004830 3300031249 Bacteria 9111
196 Ga0307508_10000009 3300031616 Bacteria 256966
197 Ga0307407_10560559 3300031903 Bacteria 846
198 Ga0373927_0019887 3300035695 Bacteria 4403
199 Ga0373947_0201470 3300035725 Bacteria 1302
200 Ga0373925_0120086 3300037068 Bacteria 2040
201 Ga0373925_0190337 3300037068 Bacteria 1628
202 Ga0395905_0092863 3300037471 Bacteria 2830
203 Ga0436364_0062450 3300037853 Unclassified 672
204 Ga0436365_0353234 3300039437 Bacteria 2668
205 Ga0436365_0432306 3300039437 Bacteria 847
206 Ga0436365_0453215 3300039437 Bacteria 997
207 Ga0436365_0599269 3300039437 Bacteria 2343
208 Ga0436360_0220398 3300039438 Bacteria 1377
209 Ga0436363_0354975 3300039450 Bacteria 2230
210 Ga0436363_1512041 3300039450 Bacteria 5904
211 Ga0451802_0641381 3300041460 Bacteria 911
212 Ga0439459_0012833 3300042438 Bacteria 1498
213 Ga0466969_0004649 3300044656 Bacteria 7316
214 Ga0466966_0000464 3300044684 Bacteria 25987
215 Ga0466961_0000064 3300044693 Bacteria 63553
216 Ga0466964_0024408 3300044706 Bacteria 2356
217 Ga0466964_0091242 3300044706 Bacteria 1326
218 Ga0466957_0040819 3300044842 Bacteria 2804
219 Ga0466959_0001347 3300045049 Bacteria 14976
220 Ga0466967_0031972 3300045976 Bacteria 4438
221 Ga0466967_0484256 3300045976 Bacteria 1212
222 Ga0466967_0936259 3300045976 Bacteria 862
223 Ga0495629_0016152 3300046459 Bacteria 5358
224 Ga0495638_0002815 3300046460 Bacteria 13927
225 Ga0495651_0035409 3300046462 Bacteria 3886
226 Ga0495650_0166111 3300046471 Bacteria 784
227 Ga0495580_0069051 3300046472 Bacteria 2470
228 Ga0495664_0070628 3300046477 Bacteria 2085
229 Ga0495584_0214330 3300046491 Bacteria 979
230 Ga0495585_0218105 3300046492 Bacteria 964
231 Ga0495606_0022854 3300046507 Bacteria 4543
232 Ga0495608_0071548 3300046511 Bacteria 2263
233 Ga0495610_0203159 3300046512 Bacteria 810
234 Ga0495618_0113978 3300046514 Bacteria 1731
235 Ga0495644_0046305 3300046523 Bacteria 1635
236 Ga0495648_0000160 3300046524 Bacteria 80523
237 Ga0495648_0015314 3300046524 Bacteria 5575
238 Ga0495648_0301713 3300046524 Bacteria 750
239 Ga0495652_0010320 3300046529 Bacteria 8461
240 Ga0495652_0220825 3300046529 Bacteria 1424
241 Ga0495640_0322407 3300046533 Bacteria 957
242 Ga0495645_0070051 3300046543 Bacteria 2531
243 Ga0495645_0119343 3300046543 Bacteria 1858
244 Ga0495622_0116809 3300046557 Bacteria 1219
245 Ga0495667_0032133 3300046559 Bacteria 3520
246 Ga0495668_0299174 3300046616 Bacteria 882
247 Ga0495634_0172080 3300046642 Bacteria 1360
248 Ga0495634_0509630 3300046642 Bacteria 705
249 Ga0495635_0018631 3300046663 Bacteria 4843
250 Ga0495635_0018889 3300046663 Bacteria 4811
251 Ga0495657_0003906 3300046675 Bacteria 11991
252 Ga0495657_0028446 3300046675 Bacteria 3932
253 Ga0495599_0223835 3300046678 Bacteria 1150
254 Ga0495599_0315705 3300046678 Bacteria 941
255 Ga0495623_0074156 3300046679 Bacteria 2115
256 Ga0495669_0029717 3300046684 Bacteria 2397
257 Ga0495613_0013791 3300046689 Bacteria 5995
258 Ga0495613_0382203 3300046689 Bacteria 963
259 Ga0495624_0105328 3300046690 Bacteria 1735
260 Ga0495624_0303512 3300046690 Bacteria 962
261 Ga0495670_0250727 3300046691 Bacteria 944
262 Ga0495671_0024559 3300046692 Bacteria 3138
263 Ga0495649_0024407 3300046694 Bacteria 3372
264 Ga0495600_0025477 3300046809 Bacteria 3812
265 Ga0495600_0037075 3300046809 Bacteria 3169
266 Ga0495581_0026333 3300047315 Bacteria 3372
267 Ga0495604_0006308 3300047317 Bacteria 9408
268 Ga0495604_0029331 3300047317 Bacteria 4376
269 Ga0495636_0244805 3300047318 Bacteria 828
270 Ga0495674_0020558 3300047319 Bacteria 6110
271 Ga0495676_0464774 3300047321 Bacteria 833
272 Ga0495680_0029028 3300047322 Bacteria 4532
273 Ga0495675_0007600 3300047444 Bacteria 6684
274 Ga0495673_0062295 3300047469 Bacteria 1594
275 Ga0495673_0138644 3300047469 Bacteria 950
276 Ga0495686_0147715 3300047472 Bacteria 1382
277 Ga0495602_0027475 3300048088 Bacteria 5467
278 Ga0495602_0248950 3300048088 Bacteria 1325
279 Ga0496100_0137305 3300048903 Bacteria 1729
280 Ga0496101_0404898 3300048904 Bacteria 1075
281 Ga0496102_0270213 3300048905 Bacteria 1603
282 Ga0496102_0992120 3300048905 Bacteria 760
283 Ga0496104_0016935 3300048907 Bacteria 6630
284 Ga0496104_0145652 3300048907 Bacteria 2274
285 Ga0496104_0223385 3300048907 Bacteria 1796
286 Ga0496105_0046464 3300048908 Bacteria 3583
287 Ga0496105_0498472 3300048908 Bacteria 956
288 Ga0496105_0876167 3300048908 Bacteria 678
289 Ga0496106_0015567 3300048909 Bacteria 5625
290 Ga0496106_0139231 3300048909 Bacteria 1908
291 Ga0496107_0483795 3300048910 Bacteria 918
292 Ga0496108_0031040 3300048911 Bacteria 4430
293 Ga0496108_0306770 3300048911 Bacteria 1383
294 Ga0496108_0679023 3300048911 Bacteria 894
295 Ga0496109_0052552 3300048912 Bacteria 3714
296 Ga0496109_0092437 3300048912 Bacteria 2798
297 Ga0496110_0055563 3300048913 Bacteria 3484
298 Ga0496111_0126208 3300048914 Bacteria 1892
299 Ga0496111_0393876 3300048914 Bacteria 1024
300 Ga0496112_0011862 3300048915 Bacteria 7982
301 Ga0496112_0041980 3300048915 Bacteria 4475
302 Ga0496113_0009465 3300048916 Bacteria 6391
303 Ga0496113_0052266 3300048916 Bacteria 3051
304 Ga0496114_0367546 3300048917 Bacteria 1273
305 Ga0496114_1041376 3300048917 Bacteria 702
306 Ga0496117_0112088 3300048920 Bacteria 1697
307 Ga0496118_0101540 3300048921 Bacteria 1942
308 Ga0496119_0017667 3300048922 Bacteria 5354
309 Ga0496120_0020396 3300048923 Bacteria 4213
310 Ga0496120_0073869 3300048923 Bacteria 1864
311 Ga0496121_0000495 3300048924 Bacteria 75339
312 Ga0496121_0097845 3300048924 Bacteria 2272
313 Ga0496121_0228109 3300048924 Bacteria 1306
314 Ga0496124_0031657 3300048927 Bacteria 4680
315 Ga0496125_0033470 3300048928 Bacteria 4548
316 Ga0496125_0056636 3300048928 Bacteria 3182
317 Ga0496126_0036229 3300048929 Bacteria 4615
318 Ga0496126_0120484 3300048929 Bacteria 2276
319 Ga0496126_0208001 3300048929 Bacteria 1649
320 Ga0496126_0359883 3300048929 Bacteria 1189
321 Ga0496126_0452219 3300048929 Bacteria 1033
322 Ga0495682_0011828 3300049460 Bacteria 3354
323 Ga0501033_0209926 3300049570 Bacteria 1389
324 Ga0501038_0423471 3300049574 Bacteria 1027
325 Ga0501046_0024946 3300049580 Bacteria 4899
326 Ga0501047_0039854 3300049581 Bacteria 4544
327 Ga0501070_0012856 3300049586 Bacteria 7053
328 Ga0501080_0013807 3300049742 Bacteria 7435
329 Ga0501044_0025310 3300049823 Bacteria 6289
330 nmdc:mga07m45_603254_c1 3300050496 Bacteria 634
331 nmdc:mga08y16_39585_c1 3300050511 Bacteria 4946
332 nmdc:mga0n895_231155_c1 3300050512 Bacteria 1877
333 nmdc:mga0a205_501415_c1 3300050515 Bacteria 1071
334 nmdc:mga0sz30_33594_c1 3300050516 Bacteria 2133
335 Ga0495612_0039668 3300053078 Bacteria 1916
336 Ga0495655_0001297 3300053083 Bacteria 3853
337 Ga0495595_0072582 3300053084 Bacteria 1629
338 Ga0495619_0452852 3300053085 Bacteria 884
339 Ga0495619_0618087 3300053085 Bacteria 741
340 Ga0500578_0038441 3300053086 Bacteria 3074
341 Ga0500578_0344817 3300053086 Bacteria 872
342 Ga0500643_000025 3300053087 Bacteria 259605
343 Ga0500647_0029656 3300053091 Bacteria 2596
344 Ga0500583_0082228 3300053092 Bacteria 1557
345 Ga0500651_0177511 3300053093 Bacteria 1266
346 Ga0500566_0000038 3300053094 Bacteria 66925
347 Ga0500566_0016608 3300053094 Bacteria 4321
348 Ga0500566_0086744 3300053094 Bacteria 1734
349 Ga0500641_0016335 3300053096 Bacteria 2764
350 Ga0500650_0189129 3300053098 Bacteria 941
351 Ga0500554_103781 3300053102 Bacteria 952
352 Ga0500555_000764 3300053103 Bacteria 11829
353 Ga0500562_001783 3300053108 Bacteria 5381
354 Ga0500569_052584 3300053109 Bacteria 1233
355 Ga0500572_000010 3300053111 Bacteria 67071
356 Ga0500572_000687 3300053111 Bacteria 11057
357 Ga0500591_072618 3300053115 Bacteria 1554
358 Ga0500592_006146 3300053116 Bacteria 1911
359 Ga0500595_000143 3300053119 Bacteria 46542
360 Ga0500595_016482 3300053119 Bacteria 2751
361 Ga0500608_017389 3300053122 Bacteria 3265
362 Ga0500614_001505 3300053123 Bacteria 5555
363 Ga0500621_053088 3300053126 Bacteria 1639
364 Ga0500642_0002233 3300053130 Bacteria 5646
365 Ga0500642_0052312 3300053130 Bacteria 1807
366 Ga0500652_251685 3300053131 Bacteria 699
367 Ga0500655_010175 3300053133 Bacteria 1697
368 Ga0500658_0074977 3300053134 Bacteria 1435
369 Ga0500559_0001831 3300053136 Bacteria 11598
370 Ga0500559_0054013 3300053136 Bacteria 1779
371 Ga0500559_0067704 3300053136 Bacteria 1603
372 Ga0500559_0090362 3300053136 Bacteria 1401
373 Ga0500568_0005395 3300053139 Bacteria 6612
374 Ga0500589_265385 3300053147 Bacteria 623
375 Ga0500590_162852 3300053148 Bacteria 991
376 Ga0500603_003083 3300053150 Bacteria 3597
377 Ga0500616_0027098 3300053153 Bacteria 3167
378 Ga0500622_0026935 3300053156 Bacteria 3031
379 Ga0500627_0062766 3300053158 Bacteria 1636
380 Ga0500630_001647 3300053159 Bacteria 10690
381 Ga0500633_0041662 3300053160 Bacteria 1546
382 Ga0500634_0064985 3300053161 Bacteria 1926
383 Ga0500638_006620 3300053162 Bacteria 4764
384 Ga0500638_107277 3300053162 Bacteria 1294
385 Ga0500639_000034 3300053163 Bacteria 66994
386 Ga0500639_024226 3300053163 Bacteria 3208
387 Ga0500639_125744 3300053163 Bacteria 1223
388 Ga0500636_0118714 3300053177 Bacteria 1486
389 Ga0500637_0007438 3300053178 Bacteria 5475
390 Ga0500637_0111158 3300053178 Bacteria 1589
391 Ga0500645_024868 3300053730 Bacteria 1828
392 Ga0500645_058507 3300053730 Bacteria 1116
393 Ga0500645_088861 3300053730 Bacteria 877
394 Ga0500596_000711 3300053735 Bacteria 6504
395 Ga0500596_000922 3300053735 Bacteria 5877
396 Ga0500599_001283 3300053736 Bacteria 2865
397 Ga0500601_000063 3300053737 Bacteria 22142
398 Ga0500661_001416 3300055283 Bacteria 4485
399 Ga0500661_002571 3300055283 Bacteria 3426
400 Ga0500661_007906 3300055283 Bacteria 1960
401 Ga0530510_0338905 3300061734 Bacteria 1129
402 2513638005 2513237094 Bacteria 8789602
403 2513691757 2513237101 Bacteria 7952346
404 2514010699 2513237161 Bacteria 8871253
405 2524439790 2524023205 Bacteria 8918781
406 2723845833 2721755755 Bacteria 8322773
407 2745081767 2744054633 Bacteria 8678936
408 2793064813 2791355196 Bacteria 7323613
409 2793077175
410 2824708516 2824704595 Bacteria 9667483
411 2824760224 2824753945 Bacteria 9787441
412 2824767213 2824763712 Bacteria 9792355
413 2838128600 2838122688 Bacteria 8803140
414 2841947300 2841941048 Bacteria 8688029
415 2841950746 2841949485 Bacteria 8680857
416 2841967060 2841966195 Bacteria 8673214
417 2841975807 2841974524 Bacteria 8931498
418 2841991065 2841983080 Bacteria 8395090
419 2844318291 2844315083 Bacteria 8138177
420 2849080090 2849076700 Bacteria 7039503
421 2874609521 2874604998 Bacteria 7834745
422 2876770833 2876761206 Bacteria 10111113
423 2888394680 2888388044 Bacteria 7304136
424 2889040674 2889033259 Bacteria 9099371
425 2903729238 2903727486 Bacteria 8281579
426 2903777838 2903768456 Bacteria 9749579
427 2904717070 2904711408 Bacteria 9771557
428 2906605184 2906602504 Bacteria 8295279
429 2906631513 2906626472 Bacteria 8826946
430 2922367776 2922361189 Bacteria 7436256
431 2922392321 2922386360 Bacteria 7017218
432 2932796406 2932794094 Bacteria 7915132
433 2932808969 2932801729 Bacteria 7987968
434 2935774119 2935769743 Bacteria 7878163
435 2935789511 2935785616 Bacteria 7962367
436 2935801346 2935793552 Bacteria 8012592
437 2935886682 2935883170 Bacteria 7964738
438 2941534046 2941531003 Bacteria 7653939
439 3005598365 3005594810 Bacteria 8716512
440 3005721524 3005718088 Bacteria 8283608
441 8006971956 8006964411 Bacteria 8966052
442 8006981369 8006973647 Bacteria 10679141
443 8006996409 8006994254 Bacteria 8309700
444 8016592870 8016583857 Bacteria 10421953
445 8016627663 8016622563 Bacteria 7999408
446 8019554769 8019547302 Bacteria 7996444
447 8019657422 8019648815 Bacteria 10014479
448 8056674660 8056673599 Bacteria 7871253
449 8056688544 8056681323 Bacteria 8472857
450 8056972651 8056967851 Bacteria 9038162
451 Ga0373936_0024800
452 JGI25153J46596_10004068
453 JGI25153J46596_10028490
454 rootH2_10062700
455 JGI25404J52841_10005715
456 Ga0065165_1040202
457 Ga0070676_10276640
458 Ga0070683_100192580
459 Ga0070680_100246469
460 Ga0070680_100420216
461 Ga0070682_100041914
462 Ga0070660_100112250
463 Ga0070691_10240110
464 Ga0070661_100089282
465 Ga0070692_10310680
466 Ga0070674_100099203
467 Ga0070673_100434442
468 Ga0070659_100186179
469 Ga0070667_100247727
470 Ga0070667_100516632
471 Ga0070709_10011971
472 Ga0070709_10058828
473 Ga0070709_10609432
474 Ga0070714_100018170
475 Ga0070713_100037946
476 Ga0070713_100084093
477 Ga0070713_100396208
478 Ga0070710_10002013
479 Ga0070710_10071677
480 Ga0070701_10112240
481 Ga0070711_100014164
482 Ga0070711_100015664
483 Ga0070705_100360146
484 Ga0070700_100107960
485 Ga0070694_101012482
486 Ga0070663_100035375
487 Ga0070663_100062892
488 Ga0070663_100090394
489 Ga0070663_100165205
490 Ga0070678_100030444
491 Ga0070678_100093526
492 Ga0070662_100052941
493 Ga0070681_10025556
494 Ga0070681_10310800
495 Ga0070681_10376421
496 Ga0068867_100284756
497 Ga0070685_10532494
498 Ga0070706_100237580
499 Ga0070698_100009493
500 Ga0070698_100338238
501 Ga0070679_100014960
502 Ga0070684_100927076
503 Ga0068853_100212506
504 Ga0070672_100218837
505 Ga0070672_100551178
506 Ga0070693_100102823
507 Ga0070693_100227389
508 Ga0070665_101234522
509 Ga0068855_100052296
510 Ga0068855_101457792
511 Ga0068854_100053991
512 Ga0068856_100137650
513 Ga0068856_101188208
514 Ga0070702_100216720
515 Ga0068852_100039048
516 Ga0068852_100362623
517 Ga0068852_100376563
518 Ga0068852_100978342
519 Ga0068861_100097199
520 Ga0068863_100694870
521 Ga0068858_100125790
522 Ga0068860_100304294
523 Ga0068862_100172110
524 Ga0081455_10067430
525 Ga0081540_1003795
526 Ga0081540_1024746
527 Ga0081540_1044699
528 Ga0081539_10058668
529 Ga0070717_10244656
530 Ga0075365_10039494
531 Ga0075365_10432628
532 Ga0075364_10289977
533 Ga0070712_100040637
534 Ga0075367_10241987
535 Ga0075433_10424478
536 Ga0075434_100242139
537 Ga0075436_100397431
538 Ga0099794_10028444
539 Ga0105240_10002351
540 Ga0105240_10089450
541 Ga0105240_10160357
542 Ga0111539_10150726
543 Ga0105245_10076305
544 Ga0105245_10254969
545 Ga0105243_10026993
546 Ga0105241_10054298
547 Ga0105241_10088520
548 Ga0105241_10150547
549 Ga0105241_10591089
550 Ga0105242_10153684
551 Ga0105237_10005556
552 Ga0105237_10299974
553 Ga0105237_10463056
554 Ga0105238_10506301
555 Ga0105238_10708271
556 Ga0105249_10274632
557 Ga0105239_10116074
558 Ga0105239_10171142
559 Ga0105239_10390983
560 Ga0105239_10608986
561 Ga0105246_10037124
562 Ga0157370_10086076
563 Ga0157369_10080589
564 Ga0157374_10563801
565 Ga0157378_10016765
566 Ga0157372_10255844
567 Ga0157380_10169735
568 Ga0157380_10291192
569 Ga0157379_10657427
570 Ga0157376_10316469
571 Ga0163161_10557087
572 Ga0209148_1001286
573 Ga0209233_1011972
574 Ga0209233_1029648
575 Ga0209455_1002705
576 Ga0209758_1003597
577 Ga0209758_1014026
578 Ga0207426_1005795
579 Ga0209257_1024320
580 Ga0207692_10001752
581 Ga0207692_10192455
582 Ga0207688_10019953
583 Ga0207688_10304798
584 Ga0207647_10238371
585 Ga0207699_10041517
586 Ga0207699_10070326
587 Ga0207645_10047651
588 Ga0207705_10020230
589 Ga0207684_10116150
590 Ga0207654_10088577
591 Ga0207654_10099003
592 Ga0207654_10521609
593 Ga0207707_10120934
594 Ga0207707_10121544
595 Ga0207707_10234941
596 Ga0207695_10000278
597 Ga0207695_10073482
598 Ga0207671_10005180
599 Ga0207693_10019182
600 Ga0207693_10312789
601 Ga0207663_10006350
602 Ga0207663_10283487
603 Ga0207660_10261506
604 Ga0207660_10376839
605 Ga0207657_10188265
606 Ga0207649_10068053
607 Ga0207649_10195583
608 Ga0207652_10016438
609 Ga0207652_10171277
610 Ga0207687_10105546
611 Ga0207700_10038213
612 Ga0207700_10041009
613 Ga0207700_10061434
614 Ga0207700_10104431
615 Ga0207664_10316312
616 Ga0207664_10480380
617 Ga0207644_10415668
618 Ga0207686_10107017
619 Ga0207709_10627346
620 Ga0207704_10540707
621 Ga0207691_10042708
622 Ga0207651_10325720
623 Ga0207668_10116687
624 Ga0207640_10313971
625 Ga0207658_10458908
626 Ga0207677_11088386
627 Ga0207703_10821071
628 Ga0207639_10019559
629 Ga0207639_10257255
630 Ga0207678_10204312
631 Ga0207708_10146053
632 Ga0207702_10123984
633 Ga0207702_11843987
634 Ga0207648_10046604
635 Ga0207675_100235763
636 Ga0207683_10048974
637 Ga0207698_10031877
638 Ga0207698_10160972
639 Ga0207698_10327651
640 Ga0207698_10675264
641 Ga0207428_10063792
642 Ga0268266_10075279
643 Ga0268265_10433480
644 Ga0265340_10077864
645 Ga0265339_10004830
646 Ga0307508_10000009
647 Ga0307407_10560559
648 Ga0373927_0019887
649 Ga0373947_0201470
650 Ga0373925_0120086
651 Ga0373925_0190337
652 Ga0395905_0092863
653 Ga0436364_0062450
654 Ga0436365_0353234
655 Ga0436365_0432306
656 Ga0436365_0453215
657 Ga0436365_0599269
658 Ga0436360_0220398
659 Ga0436363_0354975
660 Ga0436363_1512041
661 Ga0451802_0641381
662 Ga0439459_0012833
663 Ga0466969_0004649
664 Ga0466966_0000464
665 Ga0466961_0000064
666 Ga0466964_0024408
667 Ga0466964_0091242
668 Ga0466957_0040819
669 Ga0466959_0001347
670 Ga0466967_0031972
671 Ga0466967_0484256
672 Ga0466967_0936259
673 Ga0495629_0016152
674 Ga0495638_0002815
675 Ga0495651_0035409
676 Ga0495650_0166111
677 Ga0495580_0069051
678 Ga0495664_0070628
679 Ga0495584_0214330
680 Ga0495585_0218105
681 Ga0495606_0022854
682 Ga0495608_0071548
683 Ga0495610_0203159
684 Ga0495618_0113978
685 Ga0495644_0046305
686 Ga0495648_0000160
687 Ga0495648_0015314
688 Ga0495648_0301713
689 Ga0495652_0010320
690 Ga0495652_0220825
691 Ga0495640_0322407
692 Ga0495645_0070051
693 Ga0495645_0119343
694 Ga0495622_0116809
695 Ga0495667_0032133
696 Ga0495668_0299174
697 Ga0495634_0172080
698 Ga0495634_0509630
699 Ga0495635_0018631
700 Ga0495635_0018889
701 Ga0495657_0003906
702 Ga0495657_0028446
703 Ga0495599_0223835
704 Ga0495599_0315705
705 Ga0495623_0074156
706 Ga0495669_0029717
707 Ga0495613_0013791
708 Ga0495613_0382203
709 Ga0495624_0105328
710 Ga0495624_0303512
711 Ga0495670_0250727
712 Ga0495671_0024559
713 Ga0495649_0024407
714 Ga0495600_0025477
715 Ga0495600_0037075
716 Ga0495581_0026333
717 Ga0495604_0006308
718 Ga0495604_0029331
719 Ga0495636_0244805
720 Ga0495674_0020558
721 Ga0495676_0464774
722 Ga0495680_0029028
723 Ga0495675_0007600
724 Ga0495673_0062295
725 Ga0495673_0138644
726 Ga0495686_0147715
727 Ga0495602_0027475
728 Ga0495602_0248950
729 Ga0496100_0137305
730 Ga0496101_0404898
731 Ga0496102_0270213
732 Ga0496102_0992120
733 Ga0496104_0016935
734 Ga0496104_0145652
735 Ga0496104_0223385
736 Ga0496105_0046464
737 Ga0496105_0498472
738 Ga0496105_0876167
739 Ga0496106_0015567
740 Ga0496106_0139231
741 Ga0496107_0483795
742 Ga0496108_0031040
743 Ga0496108_0306770
744 Ga0496108_0679023
745 Ga0496109_0052552
746 Ga0496109_0092437
747 Ga0496110_0055563
748 Ga0496111_0126208
749 Ga0496111_0393876
750 Ga0496112_0011862
751 Ga0496112_0041980
752 Ga0496113_0009465
753 Ga0496113_0052266
754 Ga0496114_0367546
755 Ga0496114_1041376
756 Ga0496117_0112088
757 Ga0496118_0101540
758 Ga0496119_0017667
759 Ga0496120_0020396
760 Ga0496120_0073869
761 Ga0496121_0000495
762 Ga0496121_0097845
763 Ga0496121_0228109
764 Ga0496124_0031657
765 Ga0496125_0033470
766 Ga0496125_0056636
767 Ga0496126_0036229
768 Ga0496126_0120484
769 Ga0496126_0208001
770 Ga0496126_0359883
771 Ga0496126_0452219
772 Ga0495682_0011828
773 Ga0501033_0209926
774 Ga0501038_0423471
775 Ga0501046_0024946
776 Ga0501047_0039854
777 Ga0501070_0012856
778 Ga0501080_0013807
779 Ga0501044_0025310
780 nmdc:mga07m45_603254_c1
781 nmdc:mga08y16_39585_c1
782 nmdc:mga0n895_231155_c1
783 nmdc:mga0a205_501415_c1
784 nmdc:mga0sz30_33594_c1
785 Ga0495612_0039668
786 Ga0495655_0001297
787 Ga0495595_0072582
788 Ga0495619_0452852
789 Ga0495619_0618087
790 Ga0500578_0038441
791 Ga0500578_0344817
792 Ga0500643_000025
793 Ga0500647_0029656
794 Ga0500583_0082228
795 Ga0500651_0177511
796 Ga0500566_0000038
797 Ga0500566_0016608
798 Ga0500566_0086744
799 Ga0500641_0016335
800 Ga0500650_0189129
801 Ga0500554_103781
802 Ga0500555_000764
803 Ga0500562_001783
804 Ga0500569_052584
805 Ga0500572_000010
806 Ga0500572_000687
807 Ga0500591_072618
808 Ga0500592_006146
809 Ga0500595_000143
810 Ga0500595_016482
811 Ga0500608_017389
812 Ga0500614_001505
813 Ga0500621_053088
814 Ga0500642_0002233
815 Ga0500642_0052312
816 Ga0500652_251685
817 Ga0500655_010175
818 Ga0500658_0074977
819 Ga0500559_0001831
820 Ga0500559_0054013
821 Ga0500559_0067704
822 Ga0500559_0090362
823 Ga0500568_0005395
824 Ga0500589_265385
825 Ga0500590_162852
826 Ga0500603_003083
827 Ga0500616_0027098
828 Ga0500622_0026935
829 Ga0500627_0062766
830 Ga0500630_001647
831 Ga0500633_0041662
832 Ga0500634_0064985
833 Ga0500638_006620
834 Ga0500638_107277
835 Ga0500639_000034
836 Ga0500639_024226
837 Ga0500639_125744
838 Ga0500636_0118714
839 Ga0500637_0007438
840 Ga0500637_0111158
841 Ga0500645_024868
842 Ga0500645_058507
843 Ga0500645_088861
844 Ga0500596_000711
845 Ga0500596_000922
846 Ga0500599_001283
847 Ga0500601_000063
848 Ga0500661_001416
849 Ga0500661_002571
850 Ga0500661_007906
851 Ga0530510_0338905
852 2513638005
853 2513691757
854 2514010699
855 2524439790
856 2723845833
857 2745081767
858 2793064813
859 2793077175
860 2824708516
861 2824760224
862 2824767213
863 2838128600
864 2841947300
865 2841950746
866 2841967060
867 2841975807
868 2841991065
869 2844318291
870 2849080090
871 2874609521
872 2876770833
873 2888394680
874 2889040674
875 2903729238
876 2903777838
877 2904717070
878 2906605184
879 2906631513
880 2922367776
881 2922392321
882 2932796406
883 2932808969
884 2935774119
885 2935789511
886 2935801346
887 2935886682
888 2941534046
889 3005598365
890 3005721524
891 8006971956
892 8006981369
893 8006996409
894 8016592870
895 8016627663
896 8019554769
897 8019657422
898 8056674660
899 8056688544
900 8056972651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02620

YceD

Large ribosomal RNA subunit accumulation protein YceD

81

193

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8oh4-assembly1.cif.gz_I subtomogram averaging structure of cofilactin filament inside microtubule lumen of drosophila s2 cell protrusion. 0.6503 69 104
5wqv-assembly1.cif.gz_B crystal structure of prib mutant - s55a 0.6261 60 105
8fak-assembly1.cif.gz_A dna replication fork binding triggers structural changes in the pria dna helicase that regulate the pria-prib replication restart pathway in e. coli 0.6175 27 101
1txy-assembly1.cif.gz_A e. coli prib 0.594 27 101
4apv-assembly1.cif.gz_A-2 the klebsiella pneumoniae primosomal prib protein: identification, crystal structure, and ssdna binding mode 0.5843 27 105
ID Description Score Start End Superfamily
1txyA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.5867 27 101 2.40.50.140
3ub1A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5664 50 100 3.10.450.540
1v1qB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.5457 27 106 2.40.50.140
4g76A02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Colicin M, catalytic domain 0.5324 20 100 3.30.450.400
af_Q6ZLH2_200_403_2.50.20.10 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.5176 27 99 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A6N9BBA7-F1-model_v4 DUF177 domain-containing protein 0.9385 24 106
AF-A0A524HZC1-F1-model_v4 Uncharacterized protein 0.9198 9 100
AF-A0A440AQN0-F1-model_v4 DUF177 domain-containing protein 0.9105 18 98
AF-A0A7S3XQR3-F1-model_v4 Uncharacterized protein 0.9019 18 100 GO:0000166
GO:0005886
GO:0045332
GO:0046872
GO:0140326
AF-A0A440AQN0-F1-model_v4 DUF177 domain-containing protein 0.8806 18 98

Map