F446536

General Info

Members Datasets Scaffolds Average Seq Length
450 232 900 239

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100051426|Ga0070688_1000514262
Length 259
Sequence MRSETLDTDRGKVRAAMTETTNRVAIVTGASRGLGEVVARVLAGRGYHLVVGARNPEPLQDVADSLAGNGVTAVPVAGDITDAAVRTRLVGAARALGGLDVLVNNASELGGIGPLMEFEVQRFGRVFPVNTGAPIALIQLAVPLLAERRGLIVNVTSDAARAAYPGWGPYGASKAALELLTRTLATELRERGVAAVIVDPGDMRTRMHQEAFPGEDISDRPLPEVTAPFWHWLLDQRPADISGERFAAQQEDARWLQQV

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
149 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
211 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 6
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100051426 3300005365 Bacteria 2570
2 Ga0065712_10000768 3300005290 Bacteria 10591
3 Ga0065715_10000251 3300005293 Bacteria 29530
4 Ga0065715_10154857 3300005293 Bacteria 1676
5 Ga0065707_10004596 3300005295 Bacteria 3144
6 Ga0070676_10071313 3300005328 Bacteria 2086
7 Ga0070683_100022048 3300005329 Bacteria 5687
8 Ga0070690_100062169 3300005330 Bacteria 2407
9 Ga0070670_100017502 3300005331 Bacteria 6149
10 Ga0070670_100088374 3300005331 Bacteria 2664
11 Ga0070670_100301413 3300005331 Bacteria 1402
12 Ga0070677_10009090 3300005333 Bacteria 3364
13 Ga0070682_100108170 3300005337 Bacteria 1848
14 Ga0068868_100746826 3300005338 Unclassified 879
15 Ga0070660_100175471 3300005339 Bacteria 1733
16 Ga0070660_100256426 3300005339 Bacteria 1427
17 Ga0070660_100538997 3300005339 Bacteria 973
18 Ga0070689_100179082 3300005340 Bacteria 1721
19 Ga0070691_10011952 3300005341 Bacteria 3975
20 Ga0070691_10052183 3300005341 Bacteria 1955
21 Ga0070687_100119367 3300005343 Bacteria 1506
22 Ga0070687_100271035 3300005343 Unclassified 1064
23 Ga0070661_100037866 3300005344 Bacteria 3509
24 Ga0070669_100089031 3300005353 Bacteria 2311
25 Ga0070669_100145193 3300005353 Bacteria 1833
26 Ga0070669_100605471 3300005353 Bacteria 918
27 Ga0070669_100631053 3300005353 Bacteria 900
28 Ga0070675_100012975 3300005354 Bacteria 6542
29 Ga0070675_100024431 3300005354 Bacteria 4840
30 Ga0070675_100080280 3300005354 Bacteria 2719
31 Ga0070675_100160757 3300005354 Unclassified 1931
32 Ga0070675_100311790 3300005354 Bacteria 1388
33 Ga0070671_100044567 3300005355 Bacteria 3686
34 Ga0070671_100105050 3300005355 Bacteria 2370
35 Ga0070671_100348976 3300005355 Bacteria 1263
36 Ga0070671_100381920 3300005355 Bacteria 1204
37 Ga0070674_100066699 3300005356 Bacteria 2529
38 Ga0070674_100347964 3300005356 Bacteria 1196
39 Ga0070674_100683472 3300005356 Bacteria 876
40 Ga0070673_100004375 3300005364 Bacteria 8921
41 Ga0070673_100006542 3300005364 Bacteria 7579
42 Ga0070673_100065763 3300005364 Unclassified 2894
43 Ga0070673_100139215 3300005364 Bacteria 2046
44 Ga0070659_100016307 3300005366 Bacteria 5577
45 Ga0070659_100060412 3300005366 Bacteria 2994
46 Ga0070659_100310078 3300005366 Bacteria 1318
47 Ga0070667_100587581 3300005367 Bacteria 1025
48 Ga0070709_10111445 3300005434 Bacteria 1840
49 Ga0070701_10023340 3300005438 Bacteria 2978
50 Ga0070701_10043553 3300005438 Bacteria 2297
51 Ga0070705_100017665 3300005440 Bacteria 3726
52 Ga0070705_100045449 3300005440 Bacteria 2527
53 Ga0070700_100215156 3300005441 Bacteria 1358
54 Ga0070694_100003150 3300005444 Bacteria 9827
55 Ga0070694_100050096 3300005444 Unclassified 2814
56 Ga0070663_100005355 3300005455 Bacteria 7617
57 Ga0070678_100004528 3300005456 Bacteria 7891
58 Ga0070678_100414036 3300005456 Unclassified 1173
59 Ga0070662_100113421 3300005457 Bacteria 2068
60 Ga0070662_100377689 3300005457 Bacteria 1166
61 Ga0070681_10070674 3300005458 Bacteria 3455
62 Ga0068867_100049610 3300005459 Bacteria 3091
63 Ga0070706_100261791 3300005467 Bacteria 1614
64 Ga0070707_100033427 3300005468 Bacteria 4904
65 Ga0070707_100416508 3300005468 Unclassified 1304
66 Ga0070699_100033530 3300005518 Bacteria 4436
67 Ga0070699_100221675 3300005518 Unclassified 1685
68 Ga0070684_100001564 3300005535 Bacteria 16522
69 Ga0070697_100130562 3300005536 Bacteria 2106
70 Ga0070672_100068791 3300005543 Bacteria 2809
71 Ga0070686_100029282 3300005544 Bacteria 3348
72 Ga0070686_100213979 3300005544 Bacteria 1389
73 Ga0070695_100000407 3300005545 Bacteria 22225
74 Ga0070695_100009005 3300005545 Bacteria 5934
75 Ga0070695_100061337 3300005545 Bacteria 2440
76 Ga0070696_100000265 3300005546 Bacteria 31638
77 Ga0070693_100050767 3300005547 Bacteria 2372
78 Ga0070693_100137399 3300005547 Bacteria 1535
79 Ga0070693_100160325 3300005547 Bacteria 1432
80 Ga0070665_100084171 3300005548 Bacteria 3185
81 Ga0070665_100126451 3300005548 Plasmid 2559
82 Ga0070704_100023376 3300005549 Bacteria 4036
83 Ga0070704_100101547 3300005549 Bacteria 2168
84 Ga0070664_100008845 3300005564 Bacteria 8160
85 Ga0070664_100132300 3300005564 Bacteria 2191
86 Ga0070664_100392675 3300005564 Bacteria 1268
87 Ga0068854_100169529 3300005578 Bacteria 1697
88 Ga0070702_100027780 3300005615 Bacteria 3057
89 Ga0070702_100044490 3300005615 Bacteria 2507
90 Ga0068852_100156466 3300005616 Bacteria 2124
91 Ga0068852_100256709 3300005616 Bacteria 1677
92 Ga0068866_10072233 3300005718 Bacteria 1828
93 Ga0068866_10114080 3300005718 Bacteria 1512
94 Ga0068861_100186281 3300005719 Bacteria 1731
95 Ga0068861_100378630 3300005719 Bacteria 1250
96 Ga0068851_10265788 3300005834 Bacteria 977
97 Ga0068870_10017061 3300005840 Bacteria 3484
98 Ga0068863_100004374 3300005841 Bacteria 13927
99 Ga0068863_100630468 3300005841 Bacteria 1062
100 Ga0068858_100093085 3300005842 Bacteria 2806
101 Ga0068858_100259202 3300005842 Bacteria 1652
102 Ga0068860_100047278 3300005843 Bacteria 4102
103 Ga0068862_100123314 3300005844 Bacteria 2286
104 Ga0068862_100566017 3300005844 Bacteria 1087
105 Ga0081455_10199420 3300005937 Bacteria 1500
106 Ga0075368_10031702 3300006042 Bacteria 2051
107 Ga0070715_10250786 3300006163 Bacteria 925
108 Ga0075367_10235992 3300006178 Bacteria 1145
109 Ga0097621_100008717 3300006237 Bacteria 7325
110 Ga0097621_100503261 3300006237 Bacteria 1097
111 Ga0068871_100058145 3300006358 Bacteria 3147
112 Ga0068871_100283405 3300006358 Bacteria 1450
113 Ga0075428_100004447 3300006844 Bacteria 15472
114 Ga0075428_100057931 3300006844 Bacteria 4241
115 Ga0075430_100001620 3300006846 Bacteria 18392
116 Ga0075430_100015240 3300006846 Bacteria 6544
117 Ga0075430_100035549 3300006846 Bacteria 4227
118 Ga0075431_100049731 3300006847 Bacteria 4322
119 Ga0075431_100154960 3300006847 Bacteria 2357
120 Ga0075431_100157613 3300006847 Bacteria 2335
121 Ga0075433_10025563 3300006852 Bacteria 4992
122 Ga0075433_10103198 3300006852 Bacteria 2526
123 Ga0075433_10150235 3300006852 Bacteria 2072
124 Ga0075433_10243515 3300006852 Bacteria 1596
125 Ga0075433_10334761 3300006852 Bacteria 1338
126 Ga0075434_100000161 3300006871 Bacteria 42373
127 Ga0075434_100038948 3300006871 Bacteria 4710
128 Ga0075434_100039501 3300006871 Bacteria 4676
129 Ga0075429_100001052 3300006880 Bacteria 22026
130 Ga0075429_100030466 3300006880 Bacteria 4687
131 Ga0075429_100048482 3300006880 Bacteria 3694
132 Ga0068865_100011111 3300006881 Bacteria 5625
133 Ga0075436_100002054 3300006914 Bacteria 13882
134 Ga0075435_100000360 3300007076 Bacteria 27836
135 Ga0075435_100036245 3300007076 Bacteria 3918
136 Ga0075435_100062497 3300007076 Bacteria 3022
137 Ga0075435_100089761 3300007076 Bacteria 2534
138 Ga0111539_10000473 3300009094 Bacteria 50688
139 Ga0111539_10000640 3300009094 Bacteria 45232
140 Ga0111539_10021416 3300009094 Bacteria 7957
141 Ga0111539_10118214 3300009094 Bacteria 3107
142 Ga0111539_11085162 3300009094 Bacteria 930
143 Ga0105245_10045064 3300009098 Bacteria 3938
144 Ga0105245_10068552 3300009098 Bacteria 3215
145 Ga0105245_10659681 3300009098 Bacteria 1077
146 Ga0114129_10002519 3300009147 Bacteria 25430
147 Ga0114129_10006912 3300009147 Bacteria 16145
148 Ga0114129_10008549 3300009147 Bacteria 14593
149 Ga0114129_10035726 3300009147 Bacteria 7020
150 Ga0114129_10081039 3300009147 Bacteria 4512
151 Ga0114129_10092913 3300009147 Bacteria 4180
152 Ga0114129_10118485 3300009147 Bacteria 3647
153 Ga0114129_10179569 3300009147 Bacteria 2881
154 Ga0114129_10390452 3300009147 Bacteria 1836
155 Ga0114129_10477329 3300009147 Bacteria 1632
156 Ga0114129_10610926 3300009147 Bacteria 1412
157 Ga0114129_10615676 3300009147 Bacteria 1405
158 Ga0114129_10683530 3300009147 Bacteria 1321
159 Ga0105242_10018632 3300009176 Bacteria 5430
160 Ga0105242_10049880 3300009176 Bacteria 3407
161 Ga0105242_10053189 3300009176 Bacteria 3305
162 Ga0105242_10145146 3300009176 Bacteria 2064
163 Ga0105248_10007063 3300009177 Bacteria 12301
164 Ga0105248_10036539 3300009177 Bacteria 5495
165 Ga0105248_10047751 3300009177 Bacteria 4801
166 Ga0105238_10045009 3300009551 Bacteria 4459
167 Ga0105238_10569533 3300009551 Bacteria 1138
168 Ga0105249_10353311 3300009553 Bacteria 1489
169 Ga0105239_10154115 3300010375 Bacteria 2565
170 Ga0105246_10107429 3300011119 Unclassified 2044
171 Ga0105246_10406426 3300011119 Bacteria 1132
172 Ga0157374_10120961 3300013296 Bacteria 2527
173 Ga0157378_10517454 3300013297 Bacteria 1194
174 Ga0163162_10781756 3300013306 Bacteria 1073
175 Ga0163162_11152896 3300013306 Bacteria 879
176 Ga0157375_10107453 3300013308 Unclassified 2884
177 Ga0157375_10218959 3300013308 Unclassified 2062
178 Ga0157375_10892335 3300013308 Bacteria 1033
179 Ga0163163_10599369 3300014325 Bacteria 1165
180 Ga0157380_10118213 3300014326 Bacteria 2240
181 Ga0157376_10331820 3300014969 Bacteria 1449
182 Ga0157376_10394023 3300014969 Bacteria 1337
183 Ga0207682_10012443 3300025893 Bacteria 3321
184 Ga0207642_10102014 3300025899 Bacteria 1442
185 Ga0207699_10111288 3300025906 Bacteria 1755
186 Ga0207645_10053805 3300025907 Bacteria 2572
187 Ga0207643_10022355 3300025908 Bacteria 3480
188 Ga0207707_10132232 3300025912 Bacteria 2182
189 Ga0207660_10620048 3300025917 Bacteria 881
190 Ga0207662_10006289 3300025918 Bacteria 6396
191 Ga0207649_10065165 3300025920 Bacteria 2305
192 Ga0207681_10032209 3300025923 Bacteria 3431
193 Ga0207681_10055585 3300025923 Bacteria 2697
194 Ga0207681_10425454 3300025923 Bacteria 1077
195 Ga0207650_10120152 3300025925 Bacteria 2044
196 Ga0207650_10146403 3300025925 Bacteria 1861
197 Ga0207650_10494074 3300025925 Bacteria 1022
198 Ga0207659_10174353 3300025926 Bacteria 1698
199 Ga0207687_10214236 3300025927 Bacteria 1513
200 Ga0207644_10018454 3300025931 Bacteria 4720
201 Ga0207690_10168386 3300025932 Bacteria 1639
202 Ga0207690_10224504 3300025932 Bacteria 1439
203 Ga0207690_10255515 3300025932 Bacteria 1355
204 Ga0207706_10062095 3300025933 Bacteria 3291
205 Ga0207706_10473047 3300025933 Bacteria 1083
206 Ga0207686_10211874 3300025934 Bacteria 1393
207 Ga0207709_10040937 3300025935 Bacteria 2777
208 Ga0207670_10756913 3300025936 Bacteria 807
209 Ga0207704_10461941 3300025938 Bacteria 1015
210 Ga0207691_10002772 3300025940 Bacteria 17082
211 Ga0207691_10084196 3300025940 Bacteria 2855
212 Ga0207691_10203856 3300025940 Unclassified 1720
213 Ga0207711_10026455 3300025941 Bacteria 4868
214 Ga0207711_10030945 3300025941 Bacteria 4515
215 Ga0207711_10069824 3300025941 Bacteria 3046
216 Ga0207711_10074306 3300025941 Bacteria 2956
217 Ga0207711_10096763 3300025941 Bacteria 2606
218 Ga0207689_10173038 3300025942 Bacteria 1780
219 Ga0207689_10591132 3300025942 Unclassified 933
220 Ga0207661_10022824 3300025944 Bacteria 4718
221 Ga0207679_10018903 3300025945 Bacteria 4623
222 Ga0207679_10269524 3300025945 Bacteria 1455
223 Ga0207679_10636029 3300025945 Bacteria 964
224 Ga0207651_10015629 3300025960 Unclassified 4418
225 Ga0207651_10046553 3300025960 Bacteria 2918
226 Ga0207651_10050566 3300025960 Bacteria 2822
227 Ga0207651_10063402 3300025960 Bacteria 2581
228 Ga0207651_10277709 3300025960 Bacteria 1383
229 Ga0207640_10201631 3300025981 Bacteria 1508
230 Ga0207658_10738099 3300025986 Bacteria 891
231 Ga0207677_10040635 3300026023 Bacteria 3068
232 Ga0207677_10644113 3300026023 Unclassified 935
233 Ga0207678_10012359 3300026067 Bacteria 7495
234 Ga0207708_10008563 3300026075 Bacteria 7569
235 Ga0207708_10280777 3300026075 Bacteria 1349
236 Ga0207648_10003367 3300026089 Bacteria 16788
237 Ga0207648_10030057 3300026089 Bacteria 4816
238 Ga0207675_100029343 3300026118 Bacteria 5126
239 Ga0207675_100085316 3300026118 Bacteria 2963
240 Ga0207675_100208244 3300026118 Bacteria 1880
241 Ga0207683_10018771 3300026121 Bacteria 5899
242 Ga0207683_10208572 3300026121 Bacteria 1778
243 Ga0207683_10292642 3300026121 Bacteria 1489
244 Ga0207683_10307487 3300026121 Bacteria 1451
245 Ga0207683_10531119 3300026121 Unclassified 1087
246 Ga0207428_10014864 3300027907 Bacteria 6743
247 Ga0207428_10031650 3300027907 Bacteria 4362
248 Ga0207428_10311869 3300027907 Bacteria 1163
249 Ga0268266_10107394 3300028379 Bacteria 2468
250 Ga0268265_10240007 3300028380 Unclassified 1599
251 Ga0268264_10089720 3300028381 Bacteria 2647
252 Ga0307408_100045186 3300031548 Bacteria 3144
253 Ga0307408_100111394 3300031548 Bacteria 2103
254 Ga0307408_100300437 3300031548 Bacteria 1344
255 Ga0307410_10148007 3300031852 Bacteria 1745
256 Ga0307406_10121031 3300031901 Bacteria 1820
257 Ga0307412_10065749 3300031911 Bacteria 2455
258 Ga0307416_100003304 3300032002 Bacteria 9436
259 Ga0307416_100084276 3300032002 Bacteria 2700
260 Ga0307411_10100969 3300032005 Bacteria 2040
261 Ga0307411_10390940 3300032005 Bacteria 1147
262 Ga0307411_10547132 3300032005 Unclassified 987
263 Ga0307415_100326740 3300032126 Bacteria 1281
264 Ga0307415_100400980 3300032126 Bacteria 1171
265 Ga0373923_0028672 3300035111 Bacteria 2228
266 Ga0373936_0181180 3300035113 Unclassified 924
267 Ga0373939_0115086 3300035114 Bacteria 942
268 Ga0373945_0028627 3300035116 Unclassified 1953
269 Ga0373956_0114229 3300035119 Bacteria 1258
270 Ga0373957_0023995 3300035120 Bacteria 2187
271 Ga0373943_0007292 3300035170 Bacteria 4963
272 Ga0373955_0062414 3300035172 Bacteria 2061
273 Ga0373955_0072761 3300035172 Bacteria 1926
274 Ga0373955_0107364 3300035172 Bacteria 1611
275 Ga0373955_0151491 3300035172 Unclassified 1365
276 Ga0373962_0114996 3300035242 Bacteria 853
277 Ga0373924_0013943 3300035410 Bacteria 3028
278 Ga0373931_0077003 3300035691 Bacteria 1833
279 Ga0373947_0143040 3300035725 Bacteria 1536
280 Ga0373937_0018935 3300036401 Bacteria 6156
281 Ga0373925_0076357 3300037068 Bacteria 2540
282 Ga0439453_0064421 3300041408 Bacteria 765
283 Ga0439450_000473 3300042008 Bacteria 5239
284 Ga0439435_0001772 3300042436 Bacteria 4108
285 Ga0439435_0019251 3300042436 Bacteria 1747
286 Ga0439464_0086070 3300042439 Bacteria 943
287 Ga0451576_0312216 3300045051 Bacteria 1645
288 Ga0451576_0892657 3300045051 Bacteria 933
289 Ga0495592_0023617 3300046454 Bacteria 4677
290 Ga0495629_0025253 3300046459 Bacteria 4226
291 Ga0495582_0213924 3300046473 Bacteria 1102
292 Ga0495662_0136647 3300046476 Bacteria 1206
293 Ga0495608_0037776 3300046511 Bacteria 3246
294 Ga0495630_0152511 3300046517 Bacteria 1758
295 Ga0495652_0115831 3300046529 Bacteria 2147
296 Ga0495586_0026209 3300046535 Bacteria 3119
297 Ga0495587_0242907 3300046536 Bacteria 1013
298 Ga0495645_0014572 3300046543 Bacteria 5581
299 Ga0495645_0018450 3300046543 Bacteria 5010
300 Ga0495667_0104419 3300046559 Bacteria 1832
301 Ga0495667_0281137 3300046559 Bacteria 1056
302 Ga0495656_0099083 3300046615 Bacteria 1345
303 Ga0495634_0193990 3300046642 Bacteria 1265
304 Ga0495659_0011284 3300046664 Bacteria 2878
305 Ga0495659_0143806 3300046664 Bacteria 954
306 Ga0495599_0091225 3300046678 Bacteria 1901
307 Ga0495647_0048325 3300046681 Bacteria 1645
308 Ga0495658_0021701 3300046683 Bacteria 3389
309 Ga0495658_0058068 3300046683 Unclassified 2212
310 Ga0495658_0077919 3300046683 Bacteria 1939
311 Ga0495669_0071534 3300046684 Bacteria 1582
312 Ga0495613_0113766 3300046689 Bacteria 1948
313 Ga0495600_0095439 3300046809 Unclassified 1939
314 Ga0495636_0043572 3300047318 Bacteria 1867
315 Ga0495674_0004626 3300047319 Bacteria 13230
316 Ga0495676_0158625 3300047321 Unclassified 1602
317 Ga0495676_0354154 3300047321 Bacteria 981
318 Ga0495677_0039153 3300047445 Bacteria 1733
319 Ga0495685_051603 3300047447 Bacteria 1394
320 Ga0495684_0000682 3300047471 Bacteria 27327
321 Ga0496100_0036951 3300048903 Bacteria 3084
322 Ga0496101_0010025 3300048904 Bacteria 6242
323 Ga0496101_0029488 3300048904 Bacteria 3837
324 Ga0496104_0001298 3300048907 Bacteria 21543
325 Ga0496104_0034731 3300048907 Bacteria 4703
326 Ga0496104_0163186 3300048907 Bacteria 2137
327 Ga0496104_0345163 3300048907 Bacteria 1401
328 Ga0496105_0047441 3300048908 Bacteria 3545
329 Ga0496105_0078923 3300048908 Bacteria 2718
330 Ga0496105_0164449 3300048908 Bacteria 1821
331 Ga0496105_0340213 3300048908 Bacteria 1200
332 Ga0496106_0108231 3300048909 Bacteria 2162
333 Ga0496106_0151144 3300048909 Bacteria 1832
334 Ga0496108_0004501 3300048911 Bacteria 11226
335 Ga0496108_0044321 3300048911 Bacteria 3714
336 Ga0496109_0015221 3300048912 Bacteria 6697
337 Ga0496109_0325890 3300048912 Bacteria 1450
338 Ga0496110_0020331 3300048913 Bacteria 5605
339 Ga0496110_0153247 3300048913 Bacteria 2087
340 Ga0496112_0028434 3300048915 Bacteria 5396
341 Ga0496112_0031056 3300048915 Bacteria 5177
342 Ga0496112_0194734 3300048915 Bacteria 1988
343 Ga0496112_0446428 3300048915 Bacteria 1231
344 Ga0496113_0031779 3300048916 Bacteria 3834
345 Ga0496113_0194412 3300048916 Bacteria 1611
346 Ga0496114_0026037 3300048917 Bacteria 4785
347 Ga0496114_0094514 3300048917 Bacteria 2543
348 Ga0501033_0033828 3300049570 Bacteria 3837
349 Ga0501033_0076219 3300049570 Unclassified 2462
350 Ga0501034_0352204 3300049571 Bacteria 1400
351 Ga0501036_0016980 3300049572 Bacteria 6081
352 Ga0501036_0359456 3300049572 Unclassified 1216
353 Ga0501037_0113905 3300049573 Bacteria 1947
354 Ga0501038_0055550 3300049574 Unclassified 3401
355 Ga0501038_0160268 3300049574 Unclassified 1829
356 Ga0501039_0093572 3300049575 Unclassified 2343
357 Ga0501040_0005895 3300049576 Bacteria 7930
358 Ga0501040_0021886 3300049576 Bacteria 4275
359 Ga0501041_0007053 3300049577 Bacteria 6592
360 Ga0501041_0140421 3300049577 Unclassified 1506
361 Ga0501042_0009215 3300049578 Bacteria 6566
362 Ga0501043_0034722 3300049579 Unclassified 3966
363 Ga0501046_0004362 3300049580 Bacteria 12872
364 Ga0501046_0059416 3300049580 Bacteria 2995
365 Ga0501048_0103359 3300049582 Unclassified 2010
366 Ga0501048_0563559 3300049582 Bacteria 818
367 Ga0501067_0081521 3300049583 Bacteria 1794
368 Ga0501068_0141705 3300049584 Unclassified 1507
369 Ga0501071_0000529 3300049587 Bacteria 19538
370 Ga0501071_0003623 3300049587 Bacteria 9686
371 Ga0501071_0016630 3300049587 Bacteria 5061
372 Ga0501072_0010206 3300049588 Bacteria 7156
373 Ga0501072_0163761 3300049588 Unclassified 1774
374 Ga0501074_0046521 3300049590 Unclassified 3137
375 Ga0501075_0003519 3300049591 Bacteria 10477
376 Ga0501075_0008995 3300049591 Bacteria 6969
377 Ga0501075_0031877 3300049591 Bacteria 3915
378 Ga0501075_0105622 3300049591 Bacteria 2140
379 Ga0501075_0159634 3300049591 Unclassified 1720
380 Ga0501076_0003751 3300049592 Bacteria 10683
381 Ga0501076_0014346 3300049592 Bacteria 5967
382 Ga0501076_0044872 3300049592 Bacteria 3488
383 Ga0501077_0036372 3300049593 Unclassified 3136
384 Ga0501077_0046102 3300049593 Unclassified 2770
385 Ga0501217_006033 3300049661 Bacteria 2558
386 Ga0501225_0052983 3300049705 Bacteria 1132
387 Ga0501079_0015087 3300049741 Bacteria 5891
388 Ga0501079_0046809 3300049741 Unclassified 3337
389 Ga0501080_0178269 3300049742 Unclassified 1957
390 Ga0501080_0614167 3300049742 Unclassified 964
391 Ga0501081_0003079 3300049743 Bacteria 10587
392 Ga0501081_0013412 3300049743 Bacteria 5389
393 Ga0501083_0124929 3300049744 Unclassified 1687
394 Ga0501035_0310440 3300049822 Bacteria 1327
395 Ga0501045_0002090 3300049824 Bacteria 13492
396 Ga0501045_0053562 3300049824 Bacteria 2948
397 nmdc:mga05p37_112987_c1 3300050507 Bacteria 3340
398 nmdc:mga05p37_136498_c1 3300050507 Bacteria 3007
399 nmdc:mga05p37_14128_c1 3300050507 Bacteria 9583
400 nmdc:mga05p37_29307_c2 3300050507 Bacteria 5368
401 nmdc:mga05p37_335352_c1 3300050507 Bacteria 1785
402 nmdc:mga05p37_448880_c1 3300050507 Bacteria 1493
403 nmdc:mga05p37_49070_c1 3300050507 Bacteria 5192
404 nmdc:mga05p37_510288_c1 3300050507 Bacteria 1378
405 nmdc:mga05p37_52381_c1 3300050507 Bacteria 5019
406 nmdc:mga05p37_733560_c1 3300050507 Bacteria 1092
407 nmdc:mga05p37_84205_c1 3300050507 Bacteria 3918
408 nmdc:mga09592_14794_c1 3300050508 Bacteria 6369
409 nmdc:mga09592_22612_c2 3300050508 Bacteria 1333
410 nmdc:mga09592_233543_c1 3300050508 Bacteria 1593
411 nmdc:mga09592_250933_c1 3300050508 Bacteria 1534
412 nmdc:mga09592_28063_c1 3300050508 Bacteria 4674
413 nmdc:mga0qj67_29877_c1 3300050509 Bacteria 4236
414 nmdc:mga0qj67_299401_c1 3300050509 Bacteria 1303
415 nmdc:mga0qj67_44570_c1 3300050509 Bacteria 3497
416 nmdc:mga06r32_22239_c1 3300050510 Bacteria 5860
417 nmdc:mga06r32_241334_c1 3300050510 Bacteria 1795
418 nmdc:mga06r32_35299_c1 3300050510 Bacteria 4718
419 nmdc:mga06r32_42803_c1 3300050510 Bacteria 4308
420 nmdc:mga06r32_60952_c1 3300050510 Bacteria 3631
421 nmdc:mga06r32_90685_c1 3300050510 Bacteria 2986
422 nmdc:mga08y16_221396_c1 3300050511 Bacteria 1959
423 nmdc:mga08y16_25280_c1 3300050511 Bacteria 6261
424 nmdc:mga08y16_53871_c1 3300050511 Bacteria 4205
425 nmdc:mga08y16_577928_c1 3300050511 Bacteria 1135
426 nmdc:mga08y16_97583_c1 3300050511 Bacteria 3060
427 nmdc:mga0n895_1049243_c1 3300050512 Bacteria 794
428 nmdc:mga0n895_105256_c1 3300050512 Bacteria 2834
429 nmdc:mga0n895_105267_c1 3300050512 Bacteria 2834
430 nmdc:mga0n895_33_c1 3300050512 Bacteria 80749
431 nmdc:mga0rr50_120033_c1 3300050513 Bacteria 2091
432 nmdc:mga0rr50_182648_c1 3300050513 Bacteria 1716
433 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
434 nmdc:mga08x19_161783_c1 3300050514 Bacteria 1521
435 nmdc:mga08x19_182839_c1 3300050514 Bacteria 1432
436 nmdc:mga08x19_681_c1 3300050514 Bacteria 21779
437 nmdc:mga0a205_10203_c1 3300050515 Bacteria 8628
438 nmdc:mga0a205_28539_c1 3300050515 Bacteria 5336
439 nmdc:mga0a205_352087_c1 3300050515 Bacteria 1340
440 Ga0495601_0275757 3300053077 Bacteria 1096
441 Ga0495595_0029428 3300053084 Bacteria 2458
442 Ga0495619_0016593 3300053085 Bacteria 4662
443 Ga0495619_0159317 3300053085 Bacteria 1558
444 Ga0501084_0076298 3300054114 Unclassified 2809
445 Ga0501084_0092606 3300054114 Unclassified 2537
446 Ga0501082_0001693 3300060353 Bacteria 19455
447 Ga0501082_0262283 3300060353 Bacteria 1503
448 Ga0530510_0003492 3300061734 Bacteria 10802
449 Ga0530510_0106718 3300061734 Unclassified 2050
450 Ga0530510_0241009 3300061734 Bacteria 1346
451 Ga0070688_100051426
452 Ga0065712_10000768
453 Ga0065715_10000251
454 Ga0065715_10154857
455 Ga0065707_10004596
456 Ga0070676_10071313
457 Ga0070683_100022048
458 Ga0070690_100062169
459 Ga0070670_100017502
460 Ga0070670_100088374
461 Ga0070670_100301413
462 Ga0070677_10009090
463 Ga0070682_100108170
464 Ga0068868_100746826
465 Ga0070660_100175471
466 Ga0070660_100256426
467 Ga0070660_100538997
468 Ga0070689_100179082
469 Ga0070691_10011952
470 Ga0070691_10052183
471 Ga0070687_100119367
472 Ga0070687_100271035
473 Ga0070661_100037866
474 Ga0070669_100089031
475 Ga0070669_100145193
476 Ga0070669_100605471
477 Ga0070669_100631053
478 Ga0070675_100012975
479 Ga0070675_100024431
480 Ga0070675_100080280
481 Ga0070675_100160757
482 Ga0070675_100311790
483 Ga0070671_100044567
484 Ga0070671_100105050
485 Ga0070671_100348976
486 Ga0070671_100381920
487 Ga0070674_100066699
488 Ga0070674_100347964
489 Ga0070674_100683472
490 Ga0070673_100004375
491 Ga0070673_100006542
492 Ga0070673_100065763
493 Ga0070673_100139215
494 Ga0070659_100016307
495 Ga0070659_100060412
496 Ga0070659_100310078
497 Ga0070667_100587581
498 Ga0070709_10111445
499 Ga0070701_10023340
500 Ga0070701_10043553
501 Ga0070705_100017665
502 Ga0070705_100045449
503 Ga0070700_100215156
504 Ga0070694_100003150
505 Ga0070694_100050096
506 Ga0070663_100005355
507 Ga0070678_100004528
508 Ga0070678_100414036
509 Ga0070662_100113421
510 Ga0070662_100377689
511 Ga0070681_10070674
512 Ga0068867_100049610
513 Ga0070706_100261791
514 Ga0070707_100033427
515 Ga0070707_100416508
516 Ga0070699_100033530
517 Ga0070699_100221675
518 Ga0070684_100001564
519 Ga0070697_100130562
520 Ga0070672_100068791
521 Ga0070686_100029282
522 Ga0070686_100213979
523 Ga0070695_100000407
524 Ga0070695_100009005
525 Ga0070695_100061337
526 Ga0070696_100000265
527 Ga0070693_100050767
528 Ga0070693_100137399
529 Ga0070693_100160325
530 Ga0070665_100084171
531 Ga0070665_100126451
532 Ga0070704_100023376
533 Ga0070704_100101547
534 Ga0070664_100008845
535 Ga0070664_100132300
536 Ga0070664_100392675
537 Ga0068854_100169529
538 Ga0070702_100027780
539 Ga0070702_100044490
540 Ga0068852_100156466
541 Ga0068852_100256709
542 Ga0068866_10072233
543 Ga0068866_10114080
544 Ga0068861_100186281
545 Ga0068861_100378630
546 Ga0068851_10265788
547 Ga0068870_10017061
548 Ga0068863_100004374
549 Ga0068863_100630468
550 Ga0068858_100093085
551 Ga0068858_100259202
552 Ga0068860_100047278
553 Ga0068862_100123314
554 Ga0068862_100566017
555 Ga0081455_10199420
556 Ga0075368_10031702
557 Ga0070715_10250786
558 Ga0075367_10235992
559 Ga0097621_100008717
560 Ga0097621_100503261
561 Ga0068871_100058145
562 Ga0068871_100283405
563 Ga0075428_100004447
564 Ga0075428_100057931
565 Ga0075430_100001620
566 Ga0075430_100015240
567 Ga0075430_100035549
568 Ga0075431_100049731
569 Ga0075431_100154960
570 Ga0075431_100157613
571 Ga0075433_10025563
572 Ga0075433_10103198
573 Ga0075433_10150235
574 Ga0075433_10243515
575 Ga0075433_10334761
576 Ga0075434_100000161
577 Ga0075434_100038948
578 Ga0075434_100039501
579 Ga0075429_100001052
580 Ga0075429_100030466
581 Ga0075429_100048482
582 Ga0068865_100011111
583 Ga0075436_100002054
584 Ga0075435_100000360
585 Ga0075435_100036245
586 Ga0075435_100062497
587 Ga0075435_100089761
588 Ga0111539_10000473
589 Ga0111539_10000640
590 Ga0111539_10021416
591 Ga0111539_10118214
592 Ga0111539_11085162
593 Ga0105245_10045064
594 Ga0105245_10068552
595 Ga0105245_10659681
596 Ga0114129_10002519
597 Ga0114129_10006912
598 Ga0114129_10008549
599 Ga0114129_10035726
600 Ga0114129_10081039
601 Ga0114129_10092913
602 Ga0114129_10118485
603 Ga0114129_10179569
604 Ga0114129_10390452
605 Ga0114129_10477329
606 Ga0114129_10610926
607 Ga0114129_10615676
608 Ga0114129_10683530
609 Ga0105242_10018632
610 Ga0105242_10049880
611 Ga0105242_10053189
612 Ga0105242_10145146
613 Ga0105248_10007063
614 Ga0105248_10036539
615 Ga0105248_10047751
616 Ga0105238_10045009
617 Ga0105238_10569533
618 Ga0105249_10353311
619 Ga0105239_10154115
620 Ga0105246_10107429
621 Ga0105246_10406426
622 Ga0157374_10120961
623 Ga0157378_10517454
624 Ga0163162_10781756
625 Ga0163162_11152896
626 Ga0157375_10107453
627 Ga0157375_10218959
628 Ga0157375_10892335
629 Ga0163163_10599369
630 Ga0157380_10118213
631 Ga0157376_10331820
632 Ga0157376_10394023
633 Ga0207682_10012443
634 Ga0207642_10102014
635 Ga0207699_10111288
636 Ga0207645_10053805
637 Ga0207643_10022355
638 Ga0207707_10132232
639 Ga0207660_10620048
640 Ga0207662_10006289
641 Ga0207649_10065165
642 Ga0207681_10032209
643 Ga0207681_10055585
644 Ga0207681_10425454
645 Ga0207650_10120152
646 Ga0207650_10146403
647 Ga0207650_10494074
648 Ga0207659_10174353
649 Ga0207687_10214236
650 Ga0207644_10018454
651 Ga0207690_10168386
652 Ga0207690_10224504
653 Ga0207690_10255515
654 Ga0207706_10062095
655 Ga0207706_10473047
656 Ga0207686_10211874
657 Ga0207709_10040937
658 Ga0207670_10756913
659 Ga0207704_10461941
660 Ga0207691_10002772
661 Ga0207691_10084196
662 Ga0207691_10203856
663 Ga0207711_10026455
664 Ga0207711_10030945
665 Ga0207711_10069824
666 Ga0207711_10074306
667 Ga0207711_10096763
668 Ga0207689_10173038
669 Ga0207689_10591132
670 Ga0207661_10022824
671 Ga0207679_10018903
672 Ga0207679_10269524
673 Ga0207679_10636029
674 Ga0207651_10015629
675 Ga0207651_10046553
676 Ga0207651_10050566
677 Ga0207651_10063402
678 Ga0207651_10277709
679 Ga0207640_10201631
680 Ga0207658_10738099
681 Ga0207677_10040635
682 Ga0207677_10644113
683 Ga0207678_10012359
684 Ga0207708_10008563
685 Ga0207708_10280777
686 Ga0207648_10003367
687 Ga0207648_10030057
688 Ga0207675_100029343
689 Ga0207675_100085316
690 Ga0207675_100208244
691 Ga0207683_10018771
692 Ga0207683_10208572
693 Ga0207683_10292642
694 Ga0207683_10307487
695 Ga0207683_10531119
696 Ga0207428_10014864
697 Ga0207428_10031650
698 Ga0207428_10311869
699 Ga0268266_10107394
700 Ga0268265_10240007
701 Ga0268264_10089720
702 Ga0307408_100045186
703 Ga0307408_100111394
704 Ga0307408_100300437
705 Ga0307410_10148007
706 Ga0307406_10121031
707 Ga0307412_10065749
708 Ga0307416_100003304
709 Ga0307416_100084276
710 Ga0307411_10100969
711 Ga0307411_10390940
712 Ga0307411_10547132
713 Ga0307415_100326740
714 Ga0307415_100400980
715 Ga0373923_0028672
716 Ga0373936_0181180
717 Ga0373939_0115086
718 Ga0373945_0028627
719 Ga0373956_0114229
720 Ga0373957_0023995
721 Ga0373943_0007292
722 Ga0373955_0062414
723 Ga0373955_0072761
724 Ga0373955_0107364
725 Ga0373955_0151491
726 Ga0373962_0114996
727 Ga0373924_0013943
728 Ga0373931_0077003
729 Ga0373947_0143040
730 Ga0373937_0018935
731 Ga0373925_0076357
732 Ga0439453_0064421
733 Ga0439450_000473
734 Ga0439435_0001772
735 Ga0439435_0019251
736 Ga0439464_0086070
737 Ga0451576_0312216
738 Ga0451576_0892657
739 Ga0495592_0023617
740 Ga0495629_0025253
741 Ga0495582_0213924
742 Ga0495662_0136647
743 Ga0495608_0037776
744 Ga0495630_0152511
745 Ga0495652_0115831
746 Ga0495586_0026209
747 Ga0495587_0242907
748 Ga0495645_0014572
749 Ga0495645_0018450
750 Ga0495667_0104419
751 Ga0495667_0281137
752 Ga0495656_0099083
753 Ga0495634_0193990
754 Ga0495659_0011284
755 Ga0495659_0143806
756 Ga0495599_0091225
757 Ga0495647_0048325
758 Ga0495658_0021701
759 Ga0495658_0058068
760 Ga0495658_0077919
761 Ga0495669_0071534
762 Ga0495613_0113766
763 Ga0495600_0095439
764 Ga0495636_0043572
765 Ga0495674_0004626
766 Ga0495676_0158625
767 Ga0495676_0354154
768 Ga0495677_0039153
769 Ga0495685_051603
770 Ga0495684_0000682
771 Ga0496100_0036951
772 Ga0496101_0010025
773 Ga0496101_0029488
774 Ga0496104_0001298
775 Ga0496104_0034731
776 Ga0496104_0163186
777 Ga0496104_0345163
778 Ga0496105_0047441
779 Ga0496105_0078923
780 Ga0496105_0164449
781 Ga0496105_0340213
782 Ga0496106_0108231
783 Ga0496106_0151144
784 Ga0496108_0004501
785 Ga0496108_0044321
786 Ga0496109_0015221
787 Ga0496109_0325890
788 Ga0496110_0020331
789 Ga0496110_0153247
790 Ga0496112_0028434
791 Ga0496112_0031056
792 Ga0496112_0194734
793 Ga0496112_0446428
794 Ga0496113_0031779
795 Ga0496113_0194412
796 Ga0496114_0026037
797 Ga0496114_0094514
798 Ga0501033_0033828
799 Ga0501033_0076219
800 Ga0501034_0352204
801 Ga0501036_0016980
802 Ga0501036_0359456
803 Ga0501037_0113905
804 Ga0501038_0055550
805 Ga0501038_0160268
806 Ga0501039_0093572
807 Ga0501040_0005895
808 Ga0501040_0021886
809 Ga0501041_0007053
810 Ga0501041_0140421
811 Ga0501042_0009215
812 Ga0501043_0034722
813 Ga0501046_0004362
814 Ga0501046_0059416
815 Ga0501048_0103359
816 Ga0501048_0563559
817 Ga0501067_0081521
818 Ga0501068_0141705
819 Ga0501071_0000529
820 Ga0501071_0003623
821 Ga0501071_0016630
822 Ga0501072_0010206
823 Ga0501072_0163761
824 Ga0501074_0046521
825 Ga0501075_0003519
826 Ga0501075_0008995
827 Ga0501075_0031877
828 Ga0501075_0105622
829 Ga0501075_0159634
830 Ga0501076_0003751
831 Ga0501076_0014346
832 Ga0501076_0044872
833 Ga0501077_0036372
834 Ga0501077_0046102
835 Ga0501217_006033
836 Ga0501225_0052983
837 Ga0501079_0015087
838 Ga0501079_0046809
839 Ga0501080_0178269
840 Ga0501080_0614167
841 Ga0501081_0003079
842 Ga0501081_0013412
843 Ga0501083_0124929
844 Ga0501035_0310440
845 Ga0501045_0002090
846 Ga0501045_0053562
847 nmdc:mga05p37_112987_c1
848 nmdc:mga05p37_136498_c1
849 nmdc:mga05p37_14128_c1
850 nmdc:mga05p37_29307_c2
851 nmdc:mga05p37_335352_c1
852 nmdc:mga05p37_448880_c1
853 nmdc:mga05p37_49070_c1
854 nmdc:mga05p37_510288_c1
855 nmdc:mga05p37_52381_c1
856 nmdc:mga05p37_733560_c1
857 nmdc:mga05p37_84205_c1
858 nmdc:mga09592_14794_c1
859 nmdc:mga09592_22612_c2
860 nmdc:mga09592_233543_c1
861 nmdc:mga09592_250933_c1
862 nmdc:mga09592_28063_c1
863 nmdc:mga0qj67_29877_c1
864 nmdc:mga0qj67_299401_c1
865 nmdc:mga0qj67_44570_c1
866 nmdc:mga06r32_22239_c1
867 nmdc:mga06r32_241334_c1
868 nmdc:mga06r32_35299_c1
869 nmdc:mga06r32_42803_c1
870 nmdc:mga06r32_60952_c1
871 nmdc:mga06r32_90685_c1
872 nmdc:mga08y16_221396_c1
873 nmdc:mga08y16_25280_c1
874 nmdc:mga08y16_53871_c1
875 nmdc:mga08y16_577928_c1
876 nmdc:mga08y16_97583_c1
877 nmdc:mga0n895_1049243_c1
878 nmdc:mga0n895_105256_c1
879 nmdc:mga0n895_105267_c1
880 nmdc:mga0n895_33_c1
881 nmdc:mga0rr50_120033_c1
882 nmdc:mga0rr50_182648_c1
883 nmdc:mga0rr50_1_c1
884 nmdc:mga08x19_161783_c1
885 nmdc:mga08x19_182839_c1
886 nmdc:mga08x19_681_c1
887 nmdc:mga0a205_10203_c1
888 nmdc:mga0a205_28539_c1
889 nmdc:mga0a205_352087_c1
890 Ga0495601_0275757
891 Ga0495595_0029428
892 Ga0495619_0016593
893 Ga0495619_0159317
894 Ga0501084_0076298
895 Ga0501084_0092606
896 Ga0501082_0001693
897 Ga0501082_0262283
898 Ga0530510_0003492
899 Ga0530510_0106718
900 Ga0530510_0241009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

23

216

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

222

0.91

PF08659

KR

KR domain

24

205

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3edm-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.92 10 236
8g9v-assembly1.cif.gz_A crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9137 10 189
3edm-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9136 10 236
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9065 11 235
2bgl-assembly1.cif.gz_A x-ray structure of binary-secoisolariciresinol dehydrogenase 0.9044 9 190
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.956 13 60 3.40.50.720
af_Q0JDN0_53_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9457 9 190 3.40.50.720
af_A0A1D6KW69_37_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9311 24 190 3.40.50.720
af_Q4DKY8_26_208_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9277 9 173 3.40.50.720
af_A0A1D6LBF9_1_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.927 86 188 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V6X781-F1-model_v4 Short-chain dehydrogenase 0.9567 12 190 GO:0016491
AF-A0A537VHP9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9545 10 189
AF-A0A502HF21-F1-model_v4 SDR family oxidoreductase 0.9531 12 188 GO:0016020
GO:0016491
AF-A0A2N3BL88-F1-model_v4 Short chain dehydrogenase 0.9507 12 189 GO:0016020
GO:0016491
AF-A0A6G9AJF5-F1-model_v4 SDR family oxidoreductase 0.9503 12 188 GO:0016020
GO:0016491

Map