F446380

General Info

Members Datasets Scaffolds Average Seq Length
449 203 448 212

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10278040|Ga0105248_102780403
Length 231
Sequence VVAAASAAPARLIATPTTMAEFNLYCFAQSGNAYKAALMLQLTGADWTPRFVDYFQGETRTPEYRAINAMGEAPVLEHQGRRYSQSGVILDYLAEVTGQFGAADGDERRDVLRWLLFDNHKLTSYTATYRFLRTLTKDPNPAVLEEFGKRARAAWGVLNGHLAGRAFVVADRPTIADISMCGYLFWPDELGVDGWREFPHVRDWLGRLRALPRWVAPYELMPGHPLPAANP

Samples

Sample ID Description Type Environment
1 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 1.78
Rhizosphere 97.77
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10474878 3300005293 Bacteria 802
2 Ga0070658_10102571 3300005327 Bacteria 2366
3 Ga0070658_10836187 3300005327 Bacteria 800
4 Ga0070676_10001300 3300005328 Bacteria 12562
5 Ga0070676_10043238 3300005328 Bacteria 2618
6 Ga0070670_100006211 3300005331 Bacteria 10103
7 Ga0070670_100024575 3300005331 Bacteria 5180
8 Ga0070670_100289949 3300005331 Bacteria 1430
9 Ga0070677_10088590 3300005333 Bacteria 1341
10 Ga0068869_100006393 3300005334 Bacteria 7471
11 Ga0070666_10001057 3300005335 Bacteria 16820
12 Ga0070666_10138573 3300005335 Bacteria 1694
13 Ga0070680_100066778 3300005336 Bacteria 2950
14 Ga0070680_100317328 3300005336 Bacteria 1323
15 Ga0068868_100013250 3300005338 Bacteria 6041
16 Ga0070660_100111201 3300005339 Bacteria 2180
17 Ga0070660_100415299 3300005339 Bacteria 1114
18 Ga0070661_100021537 3300005344 Bacteria 4607
19 Ga0070661_100052128 3300005344 Bacteria 2994
20 Ga0070668_100004548 3300005347 Bacteria 10284
21 Ga0070668_100049816 3300005347 Bacteria 3223
22 Ga0070668_100067978 3300005347 Bacteria 2769
23 Ga0070668_100185959 3300005347 Bacteria 1699
24 Ga0070668_100191052 3300005347 Bacteria 1677
25 Ga0070668_100195463 3300005347 Bacteria 1659
26 Ga0070668_100297776 3300005347 Bacteria 1352
27 Ga0070669_100009203 3300005353 Bacteria 7038
28 Ga0070675_100001972 3300005354 Bacteria 15193
29 Ga0070675_100016186 3300005354 Bacteria 5915
30 Ga0070675_100071533 3300005354 Bacteria 2878
31 Ga0070675_100521013 3300005354 Bacteria 1073
32 Ga0070671_100001035 3300005355 Bacteria 20462
33 Ga0070671_100234938 3300005355 Bacteria 1556
34 Ga0070671_100321917 3300005355 Bacteria 1318
35 Ga0070673_100001352 3300005364 Bacteria 14315
36 Ga0070673_100091091 3300005364 Bacteria 2492
37 Ga0070673_100103158 3300005364 Bacteria 2353
38 Ga0070673_100308526 3300005364 Bacteria 1395
39 Ga0070659_100352746 3300005366 Bacteria 1234
40 Ga0070667_100002525 3300005367 Bacteria 15955
41 Ga0070667_100002933 3300005367 Bacteria 14661
42 Ga0070667_100037877 3300005367 Bacteria 4043
43 Ga0070667_100086079 3300005367 Bacteria 2696
44 Ga0070714_100015382 3300005435 Bacteria 6157
45 Ga0070714_100035132 3300005435 Bacteria 4199
46 Ga0070714_100164329 3300005435 Bacteria 2011
47 Ga0070714_100541457 3300005435 Bacteria 1114
48 Ga0070713_100174237 3300005436 Bacteria 1929
49 Ga0070713_100368410 3300005436 Bacteria 1336
50 Ga0070711_100269407 3300005439 Bacteria 1343
51 Ga0070711_100445013 3300005439 Bacteria 1060
52 Ga0070663_100041678 3300005455 Bacteria 3223
53 Ga0070663_100192708 3300005455 Bacteria 1587
54 Ga0070663_100226504 3300005455 Bacteria 1470
55 Ga0070678_100001003 3300005456 Bacteria 14655
56 Ga0070678_100022120 3300005456 Bacteria 4205
57 Ga0070678_100247372 3300005456 Bacteria 1494
58 Ga0070662_100315248 3300005457 Bacteria 1274
59 Ga0070681_10010220 3300005458 Bacteria 9258
60 Ga0070681_10075162 3300005458 Bacteria 3338
61 Ga0068867_100010975 3300005459 Bacteria 6387
62 Ga0068867_100047219 3300005459 Bacteria 3165
63 Ga0068867_100053004 3300005459 Bacteria 2995
64 Ga0068867_100083112 3300005459 Bacteria 2417
65 Ga0068867_100175863 3300005459 Bacteria 1698
66 Ga0068867_100396337 3300005459 Bacteria 1163
67 Ga0070706_100201307 3300005467 Bacteria 1860
68 Ga0070698_100051637 3300005471 Bacteria 4187
69 Ga0070698_100646281 3300005471 Bacteria 999
70 Ga0070679_100010473 3300005530 Bacteria 8796
71 Ga0070679_100243506 3300005530 Bacteria 1755
72 Ga0070679_100250173 3300005530 Bacteria 1729
73 Ga0070679_101183017 3300005530 Bacteria 710
74 Ga0070684_100046847 3300005535 Bacteria 3746
75 Ga0070697_100043384 3300005536 Bacteria 3641
76 Ga0068853_100016152 3300005539 Bacteria 6139
77 Ga0068853_100115298 3300005539 Bacteria 2391
78 Ga0068853_100138268 3300005539 Bacteria 2185
79 Ga0070672_100004801 3300005543 Bacteria 8874
80 Ga0070672_100098091 3300005543 Bacteria 2373
81 Ga0070672_100226539 3300005543 Bacteria 1569
82 Ga0070693_100231335 3300005547 Bacteria 1216
83 Ga0070665_100026350 3300005548 Bacteria 5855
84 Ga0068855_100164008 3300005563 Bacteria 2520
85 Ga0068855_100300759 3300005563 Bacteria 1777
86 Ga0070664_100010720 3300005564 Bacteria 7433
87 Ga0068857_100002234 3300005577 Bacteria 15761
88 Ga0068856_100005726 3300005614 Bacteria 12242
89 Ga0068856_100028501 3300005614 Bacteria 5453
90 Ga0068856_100077613 3300005614 Bacteria 3291
91 Ga0068852_100000512 3300005616 Bacteria 25561
92 Ga0068852_100001098 3300005616 Bacteria 17860
93 Ga0068852_100133119 3300005616 Bacteria 2292
94 Ga0068852_100192441 3300005616 Bacteria 1925
95 Ga0068852_100338147 3300005616 Bacteria 1466
96 Ga0068859_100206037 3300005617 Bacteria 2052
97 Ga0068859_100468522 3300005617 Bacteria 1355
98 Ga0068864_100031446 3300005618 Bacteria 4503
99 Ga0068864_100151373 3300005618 Bacteria 2102
100 Ga0068864_101010989 3300005618 Bacteria 825
101 Ga0068861_100363622 3300005719 Bacteria 1273
102 Ga0068851_10000852 3300005834 Bacteria 13138
103 Ga0068863_100066111 3300005841 Bacteria 3420
104 Ga0068863_100089428 3300005841 Bacteria 2920
105 Ga0068863_100206748 3300005841 Bacteria 1889
106 Ga0068858_100159043 3300005842 Bacteria 2127
107 Ga0068860_100006265 3300005843 Bacteria 11943
108 Ga0068860_100014984 3300005843 Bacteria 7578
109 Ga0068860_100032254 3300005843 Bacteria 5034
110 Ga0068860_100136049 3300005843 Bacteria 2360
111 Ga0068860_100476169 3300005843 Bacteria 1244
112 Ga0068860_100487520 3300005843 Bacteria 1229
113 Ga0068862_100008738 3300005844 Bacteria 8386
114 Ga0068862_100431378 3300005844 Bacteria 1239
115 Ga0081538_10066156 3300005981 Bacteria 2029
116 Ga0097621_100072169 3300006237 Bacteria 2855
117 Ga0068871_100017539 3300006358 Bacteria 5420
118 Ga0068871_100034329 3300006358 Bacteria 4025
119 Ga0068871_100268548 3300006358 Bacteria 1490
120 Ga0068871_100440196 3300006358 Bacteria 1167
121 Ga0075428_100051259 3300006844 Bacteria 4526
122 Ga0075433_10018840 3300006852 Bacteria 5744
123 Ga0068865_100085242 3300006881 Bacteria 2278
124 Ga0068865_100306338 3300006881 Bacteria 1273
125 Ga0075436_100019755 3300006914 Bacteria 4620
126 Ga0075436_100215146 3300006914 Unclassified 1363
127 Ga0097620_100206018 3300006931 Bacteria 2052
128 Ga0097620_100468526 3300006931 Bacteria 1355
129 Ga0075435_100017786 3300007076 Bacteria 5387
130 Ga0075435_100391013 3300007076 Bacteria 1195
131 Ga0105240_10001155 3300009093 Bacteria 46229
132 Ga0105240_10290424 3300009093 Bacteria 1875
133 Ga0111539_10814601 3300009094 Bacteria 1086
134 Ga0105247_10325170 3300009101 Bacteria 1074
135 Ga0114129_10094059 3300009147 Bacteria 4151
136 Ga0105243_10094238 3300009148 Bacteria 2472
137 Ga0105243_10705576 3300009148 Bacteria 984
138 Ga0105241_11120063 3300009174 Unclassified 742
139 Ga0105248_10151896 3300009177 Bacteria 2613
140 Ga0105248_10278040 3300009177 Bacteria 1885
141 Ga0105248_10322708 3300009177 Bacteria 1739
142 Ga0105248_10490136 3300009177 Bacteria 1385
143 Ga0105248_10552384 3300009177 Bacteria 1299
144 Ga0105237_10096966 3300009545 Bacteria 2939
145 Ga0105238_10050622 3300009551 Bacteria 4181
146 Ga0157373_10068121 3300013100 Bacteria 2516
147 Ga0157373_10088392 3300013100 Bacteria 2183
148 Ga0157370_10028227 3300013104 Bacteria 5523
149 Ga0157370_10029312 3300013104 Bacteria 5404
150 Ga0157370_10045813 3300013104 Bacteria 4196
151 Ga0157370_10448445 3300013104 Bacteria 1186
152 Ga0157374_10074206 3300013296 Bacteria 3211
153 Ga0157378_10646873 3300013297 Bacteria 1072
154 Ga0163162_10206640 3300013306 Bacteria 2093
155 Ga0157372_10007346 3300013307 Bacteria 11723
156 Ga0157372_10016875 3300013307 Bacteria 7839
157 Ga0157372_10385584 3300013307 Bacteria 1633
158 Ga0157375_10003835 3300013308 Bacteria 13039
159 Ga0157375_10075949 3300013308 Bacteria 3385
160 Ga0157375_10124869 3300013308 Bacteria 2687
161 Ga0157375_10169019 3300013308 Bacteria 2333
162 Ga0157375_10194208 3300013308 Bacteria 2185
163 Ga0157375_10242492 3300013308 Bacteria 1962
164 Ga0157375_10294596 3300013308 Bacteria 1786
165 Ga0157380_10351607 3300014326 Bacteria 1379
166 Ga0157380_11443236 3300014326 Bacteria 740
167 Ga0182008_10109286 3300014497 Bacteria 1370
168 Ga0157379_10044834 3300014968 Bacteria 3947
169 Ga0157379_10243650 3300014968 Bacteria 1631
170 Ga0157376_10038264 3300014969 Bacteria 3901
171 Ga0157376_10126887 3300014969 Bacteria 2271
172 Ga0157376_10273230 3300014969 Bacteria 1588
173 Ga0207697_10168495 3300025315 Bacteria 957
174 Ga0207682_10000243 3300025893 Bacteria 24690
175 Ga0207682_10146386 3300025893 Bacteria 1063
176 Ga0207642_10077726 3300025899 Bacteria 1602
177 Ga0207710_10172799 3300025900 Bacteria 1057
178 Ga0207680_10107892 3300025903 Bacteria 1800
179 Ga0207699_10177971 3300025906 Bacteria 1428
180 Ga0207645_10000045 3300025907 Bacteria 85310
181 Ga0207645_10324008 3300025907 Bacteria 1028
182 Ga0207643_10644826 3300025908 Unclassified 683
183 Ga0207705_10078039 3300025909 Bacteria 2410
184 Ga0207705_10678737 3300025909 Bacteria 801
185 Ga0207707_10022969 3300025912 Bacteria 5455
186 Ga0207707_10270992 3300025912 Bacteria 1471
187 Ga0207707_10287390 3300025912 Bacteria 1423
188 Ga0207695_10059884 3300025913 Bacteria 3946
189 Ga0207695_10342105 3300025913 Bacteria 1383
190 Ga0207663_10200471 3300025916 Bacteria 1439
191 Ga0207660_10024247 3300025917 Bacteria 4105
192 Ga0207657_10175236 3300025919 Bacteria 1736
193 Ga0207649_10221371 3300025920 Bacteria 1348
194 Ga0207649_10225871 3300025920 Bacteria 1336
195 Ga0207652_10007510 3300025921 Bacteria 8777
196 Ga0207652_10361524 3300025921 Bacteria 1310
197 Ga0207652_10415573 3300025921 Bacteria 1213
198 Ga0207652_10636960 3300025921 Unclassified 954
199 Ga0207646_10007624 3300025922 Bacteria 10956
200 Ga0207681_10023123 3300025923 Bacteria 3972
201 Ga0207694_10050640 3300025924 Bacteria 3217
202 Ga0207650_10020843 3300025925 Bacteria 4629
203 Ga0207650_10245564 3300025925 Bacteria 1448
204 Ga0207650_10564615 3300025925 Bacteria 955
205 Ga0207659_10018585 3300025926 Bacteria 4560
206 Ga0207659_10029878 3300025926 Bacteria 3718
207 Ga0207659_10035807 3300025926 Bacteria 3434
208 Ga0207700_10237933 3300025928 Bacteria 1551
209 Ga0207664_10002792 3300025929 Bacteria 11597
210 Ga0207664_10068373 3300025929 Bacteria 2853
211 Ga0207664_10201159 3300025929 Bacteria 1719
212 Ga0207664_10373081 3300025929 Bacteria 1266
213 Ga0207706_10144647 3300025933 Bacteria 2092
214 Ga0207709_10129686 3300025935 Bacteria 1716
215 Ga0207669_10016576 3300025937 Bacteria 3748
216 Ga0207691_10000452 3300025940 Bacteria 40569
217 Ga0207691_10031337 3300025940 Bacteria 4963
218 Ga0207691_10076770 3300025940 Bacteria 3010
219 Ga0207691_10131624 3300025940 Bacteria 2209
220 Ga0207661_10032320 3300025944 Bacteria 4053
221 Ga0207679_10069046 3300025945 Bacteria 2657
222 Ga0207679_10316837 3300025945 Bacteria 1349
223 Ga0207667_10020371 3300025949 Bacteria 7378
224 Ga0207667_10024603 3300025949 Bacteria 6607
225 Ga0207651_10012096 3300025960 Bacteria 4864
226 Ga0207651_10266145 3300025960 Bacteria 1410
227 Ga0207651_10442992 3300025960 Bacteria 1113
228 Ga0207712_10956955 3300025961 Unclassified 758
229 Ga0207668_10034997 3300025972 Bacteria 3340
230 Ga0207668_10036661 3300025972 Bacteria 3274
231 Ga0207668_10198320 3300025972 Bacteria 1596
232 Ga0207668_10325283 3300025972 Bacteria 1277
233 Ga0207658_10010640 3300025986 Bacteria 6253
234 Ga0207658_10011646 3300025986 Bacteria 5989
235 Ga0207658_10027575 3300025986 Bacteria 3992
236 Ga0207658_10245419 3300025986 Bacteria 1519
237 Ga0207677_10310471 3300026023 Bacteria 1306
238 Ga0207677_10316576 3300026023 Bacteria 1295
239 Ga0207703_10263878 3300026035 Bacteria 1557
240 Ga0207703_10496177 3300026035 Bacteria 1145
241 Ga0207639_10047484 3300026041 Bacteria 3245
242 Ga0207639_10650427 3300026041 Bacteria 975
243 Ga0207678_10011560 3300026067 Bacteria 7753
244 Ga0207678_10029135 3300026067 Bacteria 4818
245 Ga0207641_10037139 3300026088 Bacteria 4068
246 Ga0207641_10052200 3300026088 Bacteria 3462
247 Ga0207648_10009278 3300026089 Bacteria 9446
248 Ga0207648_10025419 3300026089 Bacteria 5275
249 Ga0207648_10040825 3300026089 Bacteria 4076
250 Ga0207648_10080674 3300026089 Bacteria 2838
251 Ga0207648_10103763 3300026089 Bacteria 2493
252 Ga0207648_10214157 3300026089 Bacteria 1711
253 Ga0207648_10246294 3300026089 Bacteria 1593
254 Ga0207676_10178724 3300026095 Bacteria 1856
255 Ga0207674_10000140 3300026116 Bacteria 84173
256 Ga0207675_100033816 3300026118 Bacteria 4763
257 Ga0207675_100042656 3300026118 Bacteria 4236
258 Ga0207675_100183530 3300026118 Bacteria 2004
259 Ga0207675_100335108 3300026118 Bacteria 1480
260 Ga0207683_10000003 3300026121 Bacteria 191866
261 Ga0207683_10173154 3300026121 Bacteria 1955
262 Ga0207698_10399622 3300026142 Bacteria 1313
263 Ga0207698_10433066 3300026142 Bacteria 1265
264 Ga0207698_10891841 3300026142 Bacteria 896
265 Ga0209974_10188170 3300027876 Bacteria 759
266 Ga0268266_10009316 3300028379 Bacteria 8657
267 Ga0268266_10038300 3300028379 Bacteria 4082
268 Ga0268265_10039375 3300028380 Bacteria 3485
269 Ga0268264_10010639 3300028381 Bacteria 7601
270 Ga0268264_10025888 3300028381 Bacteria 4790
271 Ga0268264_10184045 3300028381 Bacteria 1899
272 Ga0268264_10238524 3300028381 Bacteria 1683
273 Ga0268264_10400385 3300028381 Bacteria 1319
274 Ga0265330_10017339 3300031235 Bacteria 3317
275 Ga0265332_10000175 3300031238 Bacteria 52725
276 Ga0265329_10003123 3300031242 Bacteria 7304
277 Ga0265331_10002352 3300031250 Bacteria 12851
278 Ga0265327_10005549 3300031251 Bacteria 10477
279 Ga0307408_100002235 3300031548 Bacteria 13806
280 Ga0307408_100218372 3300031548 Bacteria 1554
281 Ga0265314_10029086 3300031711 Bacteria 4111
282 Ga0265342_10067168 3300031712 Bacteria 2099
283 Ga0307405_10014534 3300031731 Bacteria 4236
284 Ga0307405_10458063 3300031731 Bacteria 1013
285 Ga0307413_10005415 3300031824 Bacteria 5695
286 Ga0307410_10004389 3300031852 Bacteria 7285
287 Ga0307410_10018075 3300031852 Bacteria 4252
288 Ga0307410_10075422 3300031852 Bacteria 2351
289 Ga0307406_10019997 3300031901 Bacteria 3935
290 Ga0307412_10056453 3300031911 Bacteria 2617
291 Ga0307409_100012071 3300031995 Bacteria 5487
292 Ga0307409_100022559 3300031995 Bacteria 4343
293 Ga0307409_100122101 3300031995 Bacteria 2208
294 Ga0307409_100152345 3300031995 Bacteria 2009
295 Ga0307416_100155521 3300032002 Bacteria 2104
296 Ga0307415_100097140 3300032126 Bacteria 2149
297 Ga0307415_100560991 3300032126 Bacteria 1009
298 Ga0373946_0005719 3300035171 Bacteria 4496
299 Ga0373931_0303095 3300035691 Bacteria 987
300 Ga0373935_0156759 3300035692 Bacteria 1549
301 Ga0373927_0350204 3300035695 Bacteria 973
302 Ga0316582_0323138 3300036647 Bacteria 1061
303 Ga0400483_196374 3300039062 Bacteria 1543
304 Ga0453683_0232418 3300044673 Bacteria 1174
305 Ga0495580_0107252 3300046472 Bacteria 1940
306 Ga0495580_0142923 3300046472 Bacteria 1659
307 Ga0495583_0040851 3300046506 Bacteria 2176
308 Ga0495588_0067893 3300046674 Bacteria 1851
309 Ga0495636_0009174 3300047318 Bacteria 3891
310 Ga0495636_0016407 3300047318 Bacteria 2957
311 Ga0495674_0643305 3300047319 Bacteria 837
312 Ga0496102_0049261 3300048905 Bacteria 3832
313 Ga0496108_0155042 3300048911 Bacteria 1978
314 Ga0496110_0457165 3300048913 Bacteria 1163
315 Ga0496112_0019768 3300048915 Bacteria 6367
316 Ga0496112_0856882 3300048915 Bacteria 832
317 Ga0496113_0422667 3300048916 Bacteria 1070
318 Ga0496113_0782085 3300048916 Bacteria 759
319 Ga0496114_0500322 3300048917 Bacteria 1075
320 Ga0501031_0020557 3300049568 Bacteria 4304
321 Ga0501032_0092851 3300049569 Bacteria 2002
322 Ga0501032_0163147 3300049569 Bacteria 1463
323 Ga0501033_0000786 3300049570 Bacteria 29077
324 Ga0501033_0064551 3300049570 Bacteria 2694
325 Ga0501034_0125506 3300049571 Bacteria 2552
326 Ga0501034_0153442 3300049571 Bacteria 2278
327 Ga0501034_0303681 3300049571 Bacteria 1532
328 Ga0501034_0543589 3300049571 Bacteria 1071
329 Ga0501034_0558959 3300049571 Bacteria 1053
330 Ga0501034_0704978 3300049571 Bacteria 907
331 Ga0501036_0007296 3300049572 Bacteria 9005
332 Ga0501036_0060195 3300049572 Bacteria 3217
333 Ga0501036_0111655 3300049572 Bacteria 2310
334 Ga0501036_0236494 3300049572 Bacteria 1532
335 Ga0501036_0297183 3300049572 Bacteria 1351
336 Ga0501036_0306050 3300049572 Bacteria 1329
337 Ga0501037_0000283 3300049573 Bacteria 43184
338 Ga0501037_0157987 3300049573 Bacteria 1617
339 Ga0501037_0218793 3300049573 Bacteria 1341
340 Ga0501037_0402958 3300049573 Bacteria 938
341 Ga0501038_0060876 3300049574 Bacteria 3230
342 Ga0501038_0252952 3300049574 Bacteria 1395
343 Ga0501038_0551886 3300049574 Bacteria 876
344 Ga0501039_0013691 3300049575 Bacteria 6203
345 Ga0501040_0003950 3300049576 Bacteria 9625
346 Ga0501040_0008986 3300049576 Bacteria 6498
347 Ga0501040_0299401 3300049576 Bacteria 1150
348 Ga0501041_0034255 3300049577 Bacteria 3074
349 Ga0501041_0189994 3300049577 Bacteria 1286
350 Ga0501041_0229134 3300049577 Bacteria 1166
351 Ga0501042_0008447 3300049578 Bacteria 6799
352 Ga0501042_0043989 3300049578 Bacteria 3181
353 Ga0501043_0000005 3300049579 Bacteria 254466
354 Ga0501043_0104180 3300049579 Bacteria 2229
355 Ga0501043_0104753 3300049579 Bacteria 2223
356 Ga0501043_0134261 3300049579 Bacteria 1939
357 Ga0501043_0172925 3300049579 Bacteria 1685
358 Ga0501043_0185280 3300049579 Bacteria 1621
359 Ga0501043_0364754 3300049579 Bacteria 1096
360 Ga0501043_0485769 3300049579 Bacteria 924
361 Ga0501046_0021744 3300049580 Bacteria 5290
362 Ga0501046_0137699 3300049580 Bacteria 1849
363 Ga0501047_0072012 3300049581 Bacteria 3326
364 Ga0501047_0092948 3300049581 Bacteria 2895
365 Ga0501047_0108820 3300049581 Bacteria 2654
366 Ga0501047_0118049 3300049581 Bacteria 2534
367 Ga0501047_0202711 3300049581 Bacteria 1844
368 Ga0501047_0212794 3300049581 Bacteria 1791
369 Ga0501047_0249351 3300049581 Bacteria 1624
370 Ga0501047_0639612 3300049581 Bacteria 883
371 Ga0501048_0021835 3300049582 Bacteria 4685
372 Ga0501048_0024472 3300049582 Bacteria 4407
373 Ga0501048_0054577 3300049582 Bacteria 2839
374 Ga0501048_0231676 3300049582 Bacteria 1311
375 Ga0501067_0010995 3300049583 Bacteria 5012
376 Ga0501067_0013761 3300049583 Bacteria 4480
377 Ga0501068_0010671 3300049584 Bacteria 5166
378 Ga0501068_0013294 3300049584 Bacteria 4681
379 Ga0501069_0000033 3300049585 Bacteria 92477
380 Ga0501069_0032522 3300049585 Bacteria 2871
381 Ga0501070_0008542 3300049586 Bacteria 8659
382 Ga0501070_0011778 3300049586 Bacteria 7386
383 Ga0501070_0149138 3300049586 Bacteria 1930
384 Ga0501070_0198540 3300049586 Bacteria 1647
385 Ga0501070_0453948 3300049586 Bacteria 1033
386 Ga0501071_0015741 3300049587 Bacteria 5194
387 Ga0501071_0016899 3300049587 Bacteria 5021
388 Ga0501072_0019232 3300049588 Bacteria 5276
389 Ga0501072_0097317 3300049588 Bacteria 2339
390 Ga0501073_0007988 3300049589 Bacteria 7855
391 Ga0501073_0235232 3300049589 Bacteria 1265
392 Ga0501074_0000053 3300049590 Bacteria 56031
393 Ga0501074_0049249 3300049590 Bacteria 3042
394 Ga0501074_0079882 3300049590 Bacteria 2347
395 Ga0501074_0118101 3300049590 Bacteria 1897
396 Ga0501074_0135335 3300049590 Bacteria 1763
397 Ga0501074_0142563 3300049590 Bacteria 1714
398 Ga0501075_0007015 3300049591 Bacteria 7781
399 Ga0501075_0022540 3300049591 Bacteria 4601
400 Ga0501075_0048890 3300049591 Bacteria 3178
401 Ga0501076_0000481 3300049592 Bacteria 25172
402 Ga0501076_0052405 3300049592 Bacteria 3232
403 Ga0501076_0221915 3300049592 Bacteria 1545
404 Ga0501076_0471183 3300049592 Bacteria 1034
405 Ga0501077_0114480 3300049593 Bacteria 1710
406 Ga0501079_0688991 3300049741 Bacteria 804
407 Ga0501080_0000476 3300049742 Bacteria 31184
408 Ga0501080_0004864 3300049742 Bacteria 11974
409 Ga0501080_0012561 3300049742 Bacteria 7766
410 Ga0501080_0413485 3300049742 Bacteria 1212
411 Ga0501080_0498787 3300049742 Bacteria 1088
412 Ga0501081_0012732 3300049743 Bacteria 5533
413 Ga0501081_0153327 3300049743 Bacteria 1656
414 Ga0501083_0000063 3300049744 Bacteria 74976
415 Ga0501083_0019865 3300049744 Bacteria 4676
416 Ga0501083_0043552 3300049744 Bacteria 3041
417 Ga0501083_0049161 3300049744 Bacteria 2844
418 Ga0501035_0000086 3300049822 Bacteria 115822
419 Ga0501035_0000288 3300049822 Bacteria 59750
420 Ga0501035_0008014 3300049822 Bacteria 9845
421 Ga0501035_0070894 3300049822 Bacteria 3086
422 Ga0501035_0093863 3300049822 Bacteria 2639
423 Ga0501035_0158344 3300049822 Bacteria 1961
424 Ga0501044_0000223 3300049823 Bacteria 71752
425 Ga0501044_0028969 3300049823 Bacteria 5841
426 Ga0501044_0090695 3300049823 Bacteria 3083
427 Ga0501044_0095035 3300049823 Bacteria 3004
428 Ga0501044_0099207 3300049823 Bacteria 2931
429 Ga0501044_0106534 3300049823 Bacteria 2815
430 Ga0501044_0181027 3300049823 Bacteria 2074
431 Ga0501045_0017008 3300049824 Bacteria 5165
432 Ga0501045_0242554 3300049824 Bacteria 1341
433 nmdc:mga05p37_337507_c1 3300050507 Bacteria 1778
434 nmdc:mga08y16_1169191_c1 3300050511 Bacteria 741
435 nmdc:mga0n895_8293_c1 3300050512 Bacteria 8987
436 nmdc:mga0rr50_243103_c1 3300050513 Bacteria 1492
437 nmdc:mga0rr50_41271_c1 3300050513 Bacteria 3361
438 nmdc:mga0a205_2966_c1 3300050515 Bacteria 15049
439 Ga0500552_000687 3300053733 Bacteria 3168
440 Ga0501084_0007368 3300054114 Bacteria 9066
441 Ga0501084_0019287 3300054114 Bacteria 5681
442 Ga0501084_0151476 3300054114 Bacteria 1955
443 Ga0501082_0054565 3300060353 Bacteria 3444
444 Ga0501082_0068505 3300060353 Bacteria 3055
445 Ga0501082_0155165 3300060353 Bacteria 1989
446 Ga0530510_0008535 3300061734 Bacteria 7151
447 Ga0530510_0075081 3300061734 Bacteria 2455
448 Ga0530510_0476756 3300061734 Bacteria 945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0104753 Ga0501043_0104753_15_569 168
2 3300047319 Ga0495674_0643305 Ga0495674_0643305_118_687 173
3 3300049571 Ga0501034_0704978 Ga0501034_0704978_19_594 181
4 3300025961 Ga0207712_10956955 Ga0207712_109569552 186
5 3300013308 Ga0157375_10242492 Ga0157375_102424922 192
6 3300053733 Ga0500552_000687 Ga0500552_000687_564_1211 193
7 3300039062 Ga0400483_196374 Ga0400483_196374_423_1067 194
8 3300005333 Ga0070677_10088590 Ga0070677_100885902 197
9 3300005347 Ga0070668_100049816 Ga0070668_1000498163 197
10 3300005354 Ga0070675_100071533 Ga0070675_1000715332 197
11 3300005364 Ga0070673_100091091 Ga0070673_1000910914 197
12 3300025893 Ga0207682_10146386 Ga0207682_101463861 197
13 3300025926 Ga0207659_10018585 Ga0207659_100185856 197
14 3300025960 Ga0207651_10266145 Ga0207651_102661452 197
15 3300025972 Ga0207668_10034997 Ga0207668_100349973 197
16 iso_pu_bacteria 2937843397 2937844789 197
17 3300006844 Ga0075428_100051259 Ga0075428_1000512595 199
18 3300005327 Ga0070658_10102571 Ga0070658_101025712 201
19 3300005328 Ga0070676_10001300 Ga0070676_100013003 201
20 3300005328 Ga0070676_10043238 Ga0070676_100432382 201
21 3300005331 Ga0070670_100006211 Ga0070670_1000062112 201
22 3300005331 Ga0070670_100024575 Ga0070670_1000245752 201
23 3300005331 Ga0070670_100289949 Ga0070670_1002899492 201
24 3300005334 Ga0068869_100006393 Ga0068869_1000063939 201
25 3300005335 Ga0070666_10001057 Ga0070666_1000105715 201
26 3300005336 Ga0070680_100317328 Ga0070680_1003173282 201
27 3300005338 Ga0068868_100013250 Ga0068868_1000132503 201
28 3300005339 Ga0070660_100111201 Ga0070660_1001112013 201
29 3300005344 Ga0070661_100052128 Ga0070661_1000521284 201
30 3300005347 Ga0070668_100004548 Ga0070668_1000045481 201
31 3300005347 Ga0070668_100185959 Ga0070668_1001859593 201
32 3300005347 Ga0070668_100191052 Ga0070668_1001910522 201
33 3300005347 Ga0070668_100195463 Ga0070668_1001954632 201
34 3300005347 Ga0070668_100297776 Ga0070668_1002977762 201
35 3300005353 Ga0070669_100009203 Ga0070669_1000092037 201
36 3300005354 Ga0070675_100001972 Ga0070675_10000197213 201
37 3300005354 Ga0070675_100016186 Ga0070675_1000161863 201
38 3300005354 Ga0070675_100521013 Ga0070675_1005210132 201
39 3300005355 Ga0070671_100001035 Ga0070671_10000103518 201
40 3300005355 Ga0070671_100321917 Ga0070671_1003219171 201
41 3300005364 Ga0070673_100001352 Ga0070673_10000135215 201
42 3300005364 Ga0070673_100103158 Ga0070673_1001031581 201
43 3300005364 Ga0070673_100308526 Ga0070673_1003085262 201
44 3300005366 Ga0070659_100352746 Ga0070659_1003527462 201
45 3300005367 Ga0070667_100002933 Ga0070667_10000293312 201
46 3300005367 Ga0070667_100037877 Ga0070667_1000378773 201
47 3300005367 Ga0070667_100086079 Ga0070667_1000860793 201
48 3300005435 Ga0070714_100015382 Ga0070714_1000153827 201
49 3300005436 Ga0070713_100368410 Ga0070713_1003684101 201
50 3300005455 Ga0070663_100041678 Ga0070663_1000416783 201
51 3300005455 Ga0070663_100192708 Ga0070663_1001927082 201
52 3300005455 Ga0070663_100226504 Ga0070663_1002265042 201
53 3300005456 Ga0070678_100001003 Ga0070678_1000010036 201
54 3300005456 Ga0070678_100247372 Ga0070678_1002473722 201
55 3300005457 Ga0070662_100315248 Ga0070662_1003152482 201
56 3300005458 Ga0070681_10075162 Ga0070681_100751623 201
57 3300005459 Ga0068867_100010975 Ga0068867_1000109753 201
58 3300005459 Ga0068867_100053004 Ga0068867_1000530043 201
59 3300005459 Ga0068867_100083112 Ga0068867_1000831122 201
60 3300005459 Ga0068867_100175863 Ga0068867_1001758633 201
61 3300005459 Ga0068867_100396337 Ga0068867_1003963371 201
62 3300005471 Ga0070698_100646281 Ga0070698_1006462812 201
63 3300005530 Ga0070679_100250173 Ga0070679_1002501732 201
64 3300005530 Ga0070679_101183017 Ga0070679_1011830171 201
65 3300005535 Ga0070684_100046847 Ga0070684_1000468472 201
66 3300005539 Ga0068853_100016152 Ga0068853_1000161523 201
67 3300005539 Ga0068853_100115298 Ga0068853_1001152982 201
68 3300005539 Ga0068853_100138268 Ga0068853_1001382682 201
69 3300005543 Ga0070672_100004801 Ga0070672_1000048016 201
70 3300005543 Ga0070672_100098091 Ga0070672_1000980913 201
71 3300005543 Ga0070672_100226539 Ga0070672_1002265392 201
72 3300005547 Ga0070693_100231335 Ga0070693_1002313352 201
73 3300005548 Ga0070665_100026350 Ga0070665_1000263505 201
74 3300005563 Ga0068855_100164008 Ga0068855_1001640083 201
75 3300005564 Ga0070664_100010720 Ga0070664_1000107207 201
76 3300005577 Ga0068857_100002234 Ga0068857_1000022347 201
77 3300005614 Ga0068856_100077613 Ga0068856_1000776132 201
78 3300005616 Ga0068852_100000512 Ga0068852_10000051212 201
79 3300005616 Ga0068852_100001098 Ga0068852_1000010987 201
80 3300005616 Ga0068852_100133119 Ga0068852_1001331192 201
81 3300005616 Ga0068852_100192441 Ga0068852_1001924412 201
82 3300005616 Ga0068852_100338147 Ga0068852_1003381472 201
83 3300005617 Ga0068859_100206037 Ga0068859_1002060373 201
84 3300005617 Ga0068859_100468522 Ga0068859_1004685222 201
85 3300005618 Ga0068864_100031446 Ga0068864_1000314464 201
86 3300005618 Ga0068864_100151373 Ga0068864_1001513732 201
87 3300005618 Ga0068864_101010989 Ga0068864_1010109891 201
88 3300005719 Ga0068861_100363622 Ga0068861_1003636222 201
89 3300005834 Ga0068851_10000852 Ga0068851_100008523 201
90 3300005841 Ga0068863_100066111 Ga0068863_1000661113 201
91 3300005841 Ga0068863_100089428 Ga0068863_1000894283 201
92 3300005841 Ga0068863_100206748 Ga0068863_1002067482 201
93 3300005842 Ga0068858_100159043 Ga0068858_1001590434 201
94 3300005843 Ga0068860_100006265 Ga0068860_1000062659 201
95 3300005843 Ga0068860_100014984 Ga0068860_1000149844 201
96 3300005843 Ga0068860_100032254 Ga0068860_1000322545 201
97 3300005843 Ga0068860_100136049 Ga0068860_1001360493 201
98 3300005843 Ga0068860_100487520 Ga0068860_1004875202 201
99 3300005844 Ga0068862_100008738 Ga0068862_1000087386 201
100 3300005844 Ga0068862_100431378 Ga0068862_1004313781 201
101 3300005981 Ga0081538_10066156 Ga0081538_100661562 201
102 3300006237 Ga0097621_100072169 Ga0097621_1000721694 201
103 3300006358 Ga0068871_100017539 Ga0068871_1000175393 201
104 3300006358 Ga0068871_100268548 Ga0068871_1002685482 201
105 3300006358 Ga0068871_100440196 Ga0068871_1004401962 201
106 3300006881 Ga0068865_100306338 Ga0068865_1003063382 201
107 3300006914 Ga0075436_100215146 Ga0075436_1002151462 201
108 3300006931 Ga0097620_100206018 Ga0097620_1002060182 201
109 3300006931 Ga0097620_100468526 Ga0097620_1004685262 201
110 3300007076 Ga0075435_100391013 Ga0075435_1003910132 201
111 3300009093 Ga0105240_10001155 Ga0105240_1000115523 201
112 3300009094 Ga0111539_10814601 Ga0111539_108146012 201
113 3300009101 Ga0105247_10325170 Ga0105247_103251701 201
114 3300009148 Ga0105243_10094238 Ga0105243_100942382 201
115 3300009148 Ga0105243_10705576 Ga0105243_107055762 201
116 3300009174 Ga0105241_11120063 Ga0105241_111200632 201
117 3300009177 Ga0105248_10151896 Ga0105248_101518963 201
118 3300009177 Ga0105248_10278040 Ga0105248_102780403 201
119 3300009177 Ga0105248_10490136 Ga0105248_104901362 201
120 3300009177 Ga0105248_10552384 Ga0105248_105523841 201
121 3300009545 Ga0105237_10096966 Ga0105237_100969663 201
122 3300009551 Ga0105238_10050622 Ga0105238_100506222 201
123 3300013100 Ga0157373_10068121 Ga0157373_100681213 201
124 3300013100 Ga0157373_10088392 Ga0157373_100883922 201
125 3300013104 Ga0157370_10028227 Ga0157370_100282274 201
126 3300013104 Ga0157370_10045813 Ga0157370_100458132 201
127 3300013104 Ga0157370_10448445 Ga0157370_104484452 201
128 3300013296 Ga0157374_10074206 Ga0157374_100742063 201
129 3300013297 Ga0157378_10646873 Ga0157378_106468732 201
130 3300013306 Ga0163162_10206640 Ga0163162_102066403 201
131 3300013307 Ga0157372_10385584 Ga0157372_103855842 201
132 3300013308 Ga0157375_10003835 Ga0157375_100038357 201
133 3300013308 Ga0157375_10075949 Ga0157375_100759492 201
134 3300013308 Ga0157375_10124869 Ga0157375_101248693 201
135 3300013308 Ga0157375_10169019 Ga0157375_101690193 201
136 3300013308 Ga0157375_10194208 Ga0157375_101942081 201
137 3300014326 Ga0157380_10351607 Ga0157380_103516072 201
138 3300014326 Ga0157380_11443236 Ga0157380_114432362 201
139 3300014968 Ga0157379_10044834 Ga0157379_100448345 201
140 3300014968 Ga0157379_10243650 Ga0157379_102436502 201
141 3300014969 Ga0157376_10038264 Ga0157376_100382643 201
142 3300014969 Ga0157376_10273230 Ga0157376_102732303 201
143 3300025315 Ga0207697_10168495 Ga0207697_101684952 201
144 3300025893 Ga0207682_10000243 Ga0207682_100002433 201
145 3300025899 Ga0207642_10077726 Ga0207642_100777262 201
146 3300025900 Ga0207710_10172799 Ga0207710_101727991 201
147 3300025907 Ga0207645_10000045 Ga0207645_1000004518 201
148 3300025907 Ga0207645_10324008 Ga0207645_103240081 201
149 3300025908 Ga0207643_10644826 Ga0207643_106448261 201
150 3300025909 Ga0207705_10078039 Ga0207705_100780393 201
151 3300025912 Ga0207707_10270992 Ga0207707_102709922 201
152 3300025912 Ga0207707_10287390 Ga0207707_102873903 201
153 3300025913 Ga0207695_10059884 Ga0207695_100598842 201
154 3300025919 Ga0207657_10175236 Ga0207657_101752362 201
155 3300025920 Ga0207649_10221371 Ga0207649_102213712 201
156 3300025920 Ga0207649_10225871 Ga0207649_102258712 201
157 3300025921 Ga0207652_10415573 Ga0207652_104155732 201
158 3300025923 Ga0207681_10023123 Ga0207681_100231232 201
159 3300025924 Ga0207694_10050640 Ga0207694_100506402 201
160 3300025925 Ga0207650_10020843 Ga0207650_100208436 201
161 3300025925 Ga0207650_10245564 Ga0207650_102455642 201
162 3300025925 Ga0207650_10564615 Ga0207650_105646152 201
163 3300025926 Ga0207659_10029878 Ga0207659_100298784 201
164 3300025926 Ga0207659_10035807 Ga0207659_100358074 201
165 3300025929 Ga0207664_10068373 Ga0207664_100683733 201
166 3300025933 Ga0207706_10144647 Ga0207706_101446473 201
167 3300025935 Ga0207709_10129686 Ga0207709_101296862 201
168 3300025937 Ga0207669_10016576 Ga0207669_100165762 201
169 3300025940 Ga0207691_10000452 Ga0207691_1000045226 201
170 3300025940 Ga0207691_10076770 Ga0207691_100767702 201
171 3300025940 Ga0207691_10131624 Ga0207691_101316242 201
172 3300025944 Ga0207661_10032320 Ga0207661_100323202 201
173 3300025945 Ga0207679_10316837 Ga0207679_103168371 201
174 3300025949 Ga0207667_10024603 Ga0207667_100246032 201
175 3300025960 Ga0207651_10012096 Ga0207651_100120966 201
176 3300025960 Ga0207651_10442992 Ga0207651_104429922 201
177 3300025972 Ga0207668_10036661 Ga0207668_100366614 201
178 3300025972 Ga0207668_10198320 Ga0207668_101983203 201
179 3300025972 Ga0207668_10325283 Ga0207668_103252832 201
180 3300025986 Ga0207658_10010640 Ga0207658_100106403 201
181 3300025986 Ga0207658_10027575 Ga0207658_100275754 201
182 3300025986 Ga0207658_10245419 Ga0207658_102454192 201
183 3300026023 Ga0207677_10310471 Ga0207677_103104712 201
184 3300026023 Ga0207677_10316576 Ga0207677_103165761 201
185 3300026035 Ga0207703_10263878 Ga0207703_102638782 201
186 3300026035 Ga0207703_10496177 Ga0207703_104961771 201
187 3300026041 Ga0207639_10047484 Ga0207639_100474843 201
188 3300026041 Ga0207639_10650427 Ga0207639_106504272 201
189 3300026067 Ga0207678_10011560 Ga0207678_100115603 201
190 3300026067 Ga0207678_10029135 Ga0207678_100291354 201
191 3300026088 Ga0207641_10037139 Ga0207641_100371392 201
192 3300026088 Ga0207641_10052200 Ga0207641_100522003 201
193 3300026089 Ga0207648_10009278 Ga0207648_100092787 201
194 3300026089 Ga0207648_10025419 Ga0207648_100254193 201
195 3300026089 Ga0207648_10040825 Ga0207648_100408255 201
196 3300026089 Ga0207648_10080674 Ga0207648_100806743 201
197 3300026089 Ga0207648_10214157 Ga0207648_102141572 201
198 3300026089 Ga0207648_10246294 Ga0207648_102462942 201
199 3300026095 Ga0207676_10178724 Ga0207676_101787242 201
200 3300026116 Ga0207674_10000140 Ga0207674_1000014010 201
201 3300026118 Ga0207675_100033816 Ga0207675_1000338163 201
202 3300026118 Ga0207675_100042656 Ga0207675_1000426565 201
203 3300026118 Ga0207675_100183530 Ga0207675_1001835303 201
204 3300026118 Ga0207675_100335108 Ga0207675_1003351082 201
205 3300026121 Ga0207683_10000003 Ga0207683_1000000381 201
206 3300026121 Ga0207683_10173154 Ga0207683_101731543 201
207 3300026142 Ga0207698_10399622 Ga0207698_103996222 201
208 3300026142 Ga0207698_10433066 Ga0207698_104330662 201
209 3300026142 Ga0207698_10891841 Ga0207698_108918411 201
210 3300027876 Ga0209974_10188170 Ga0209974_101881702 201
211 3300028379 Ga0268266_10009316 Ga0268266_100093164 201
212 3300028379 Ga0268266_10038300 Ga0268266_100383002 201
213 3300028380 Ga0268265_10039375 Ga0268265_100393756 201
214 3300028381 Ga0268264_10010639 Ga0268264_100106392 201
215 3300028381 Ga0268264_10025888 Ga0268264_100258883 201
216 3300028381 Ga0268264_10184045 Ga0268264_101840451 201
217 3300028381 Ga0268264_10238524 Ga0268264_102385242 201
218 3300028381 Ga0268264_10400385 Ga0268264_104003851 201
219 3300031235 Ga0265330_10017339 Ga0265330_100173393 201
220 3300031238 Ga0265332_10000175 Ga0265332_1000017519 201
221 3300031242 Ga0265329_10003123 Ga0265329_100031236 201
222 3300031250 Ga0265331_10002352 Ga0265331_100023523 201
223 3300031251 Ga0265327_10005549 Ga0265327_1000554911 201
224 3300031548 Ga0307408_100002235 Ga0307408_10000223511 201
225 3300031548 Ga0307408_100218372 Ga0307408_1002183722 201
226 3300031711 Ga0265314_10029086 Ga0265314_100290863 201
227 3300031712 Ga0265342_10067168 Ga0265342_100671683 201
228 3300031731 Ga0307405_10014534 Ga0307405_100145345 201
229 3300031731 Ga0307405_10458063 Ga0307405_104580632 201
230 3300031824 Ga0307413_10005415 Ga0307413_100054156 201
231 3300031852 Ga0307410_10004389 Ga0307410_100043899 201
232 3300031852 Ga0307410_10018075 Ga0307410_100180752 201
233 3300031852 Ga0307410_10075422 Ga0307410_100754222 201
234 3300031901 Ga0307406_10019997 Ga0307406_100199975 201
235 3300031911 Ga0307412_10056453 Ga0307412_100564533 201
236 3300031995 Ga0307409_100012071 Ga0307409_1000120712 201
237 3300031995 Ga0307409_100022559 Ga0307409_1000225592 201
238 3300031995 Ga0307409_100122101 Ga0307409_1001221012 201
239 3300031995 Ga0307409_100152345 Ga0307409_1001523453 201
240 3300032002 Ga0307416_100155521 Ga0307416_1001555212 201
241 3300032126 Ga0307415_100097140 Ga0307415_1000971403 201
242 3300032126 Ga0307415_100560991 Ga0307415_1005609912 201
243 3300035691 Ga0373931_0303095 Ga0373931_0303095_230_868 201
244 3300036647 Ga0316582_0323138 Ga0316582_0323138_312_965 201
245 3300048911 Ga0496108_0155042 Ga0496108_0155042_903_1538 201
246 3300048913 Ga0496110_0457165 Ga0496110_0457165_319_954 201
247 3300048915 Ga0496112_0019768 Ga0496112_0019768_1252_1887 201
248 3300048915 Ga0496112_0856882 Ga0496112_0856882_145_783 201
249 3300048916 Ga0496113_0422667 Ga0496113_0422667_35_670 201
250 3300048916 Ga0496113_0782085 Ga0496113_0782085_60_698 201
251 3300048917 Ga0496114_0500322 Ga0496114_0500322_65_700 201
252 3300049568 Ga0501031_0020557 Ga0501031_0020557_526_1161 201
253 3300049569 Ga0501032_0092851 Ga0501032_0092851_729_1382 201
254 3300049569 Ga0501032_0163147 Ga0501032_0163147_41_724 201
255 3300049570 Ga0501033_0000786 Ga0501033_0000786_19308_19961 201
256 3300049570 Ga0501033_0064551 Ga0501033_0064551_1290_1943 201
257 3300049571 Ga0501034_0125506 Ga0501034_0125506_737_1420 201
258 3300049571 Ga0501034_0153442 Ga0501034_0153442_374_1006 201
259 3300049571 Ga0501034_0303681 Ga0501034_0303681_282_935 201
260 3300049571 Ga0501034_0543589 Ga0501034_0543589_372_1004 201
261 3300049571 Ga0501034_0558959 Ga0501034_0558959_353_1006 201
262 3300049572 Ga0501036_0007296 Ga0501036_0007296_3323_3961 201
263 3300049572 Ga0501036_0060195 Ga0501036_0060195_2176_2811 201
264 3300049572 Ga0501036_0111655 Ga0501036_0111655_1386_2021 201
265 3300049572 Ga0501036_0236494 Ga0501036_0236494_820_1503 201
266 3300049572 Ga0501036_0297183 Ga0501036_0297183_220_873 201
267 3300049572 Ga0501036_0306050 Ga0501036_0306050_267_920 201
268 3300049573 Ga0501037_0000283 Ga0501037_0000283_33523_34176 201
269 3300049573 Ga0501037_0157987 Ga0501037_0157987_460_1113 201
270 3300049573 Ga0501037_0218793 Ga0501037_0218793_638_1291 201
271 3300049573 Ga0501037_0402958 Ga0501037_0402958_12_644 201
272 3300049574 Ga0501038_0060876 Ga0501038_0060876_1091_1774 201
273 3300049574 Ga0501038_0252952 Ga0501038_0252952_265_918 201
274 3300049574 Ga0501038_0551886 Ga0501038_0551886_115_768 201
275 3300049575 Ga0501039_0013691 Ga0501039_0013691_1511_2149 201
276 3300049576 Ga0501040_0003950 Ga0501040_0003950_3932_4570 201
277 3300049576 Ga0501040_0008986 Ga0501040_0008986_5399_6034 201
278 3300049576 Ga0501040_0299401 Ga0501040_0299401_71_706 201
279 3300049577 Ga0501041_0034255 Ga0501041_0034255_668_1303 201
280 3300049577 Ga0501041_0189994 Ga0501041_0189994_437_1075 201
281 3300049577 Ga0501041_0229134 Ga0501041_0229134_264_902 201
282 3300049578 Ga0501042_0008447 Ga0501042_0008447_3749_4384 201
283 3300049578 Ga0501042_0043989 Ga0501042_0043989_1504_2142 201
284 3300049579 Ga0501043_0000005 Ga0501043_0000005_212086_212739 201
285 3300049579 Ga0501043_0104180 Ga0501043_0104180_382_1035 201
286 3300049579 Ga0501043_0134261 Ga0501043_0134261_812_1444 201
287 3300049579 Ga0501043_0172925 Ga0501043_0172925_17_670 201
288 3300049579 Ga0501043_0185280 Ga0501043_0185280_765_1400 201
289 3300049579 Ga0501043_0364754 Ga0501043_0364754_121_774 201
290 3300049579 Ga0501043_0485769 Ga0501043_0485769_14_697 201
291 3300049580 Ga0501046_0021744 Ga0501046_0021744_2508_3143 201
292 3300049580 Ga0501046_0137699 Ga0501046_0137699_318_971 201
293 3300049581 Ga0501047_0072012 Ga0501047_0072012_1155_1838 201
294 3300049581 Ga0501047_0092948 Ga0501047_0092948_2178_2810 201
295 3300049581 Ga0501047_0108820 Ga0501047_0108820_675_1307 201
296 3300049581 Ga0501047_0118049 Ga0501047_0118049_644_1297 201
297 3300049581 Ga0501047_0202711 Ga0501047_0202711_594_1247 201
298 3300049581 Ga0501047_0212794 Ga0501047_0212794_832_1485 201
299 3300049581 Ga0501047_0249351 Ga0501047_0249351_574_1209 201
300 3300049581 Ga0501047_0639612 Ga0501047_0639612_75_728 201
301 3300049582 Ga0501048_0021835 Ga0501048_0021835_1531_2169 201
302 3300049582 Ga0501048_0024472 Ga0501048_0024472_1908_2543 201
303 3300049582 Ga0501048_0054577 Ga0501048_0054577_396_1049 201
304 3300049582 Ga0501048_0231676 Ga0501048_0231676_295_930 201
305 3300049583 Ga0501067_0010995 Ga0501067_0010995_3260_3892 201
306 3300049583 Ga0501067_0013761 Ga0501067_0013761_1068_1721 201
307 3300049584 Ga0501068_0010671 Ga0501068_0010671_647_1300 201
308 3300049584 Ga0501068_0013294 Ga0501068_0013294_2176_2811 201
309 3300049585 Ga0501069_0000033 Ga0501069_0000033_50052_50705 201
310 3300049585 Ga0501069_0032522 Ga0501069_0032522_1244_1897 201
311 3300049586 Ga0501070_0008542 Ga0501070_0008542_708_1361 201
312 3300049586 Ga0501070_0011778 Ga0501070_0011778_347_979 201
313 3300049586 Ga0501070_0149138 Ga0501070_0149138_892_1524 201
314 3300049586 Ga0501070_0198540 Ga0501070_0198540_732_1385 201
315 3300049586 Ga0501070_0453948 Ga0501070_0453948_86_721 201
316 3300049587 Ga0501071_0015741 Ga0501071_0015741_2273_2908 201
317 3300049587 Ga0501071_0016899 Ga0501071_0016899_2127_2765 201
318 3300049588 Ga0501072_0019232 Ga0501072_0019232_1998_2633 201
319 3300049588 Ga0501072_0097317 Ga0501072_0097317_852_1484 201
320 3300049589 Ga0501073_0007988 Ga0501073_0007988_4304_4936 201
321 3300049589 Ga0501073_0235232 Ga0501073_0235232_364_1017 201
322 3300049590 Ga0501074_0000053 Ga0501074_0000053_17482_18135 201
323 3300049590 Ga0501074_0049249 Ga0501074_0049249_1812_2465 201
324 3300049590 Ga0501074_0079882 Ga0501074_0079882_1438_2076 201
325 3300049590 Ga0501074_0118101 Ga0501074_0118101_526_1179 201
326 3300049590 Ga0501074_0135335 Ga0501074_0135335_1071_1724 201
327 3300049590 Ga0501074_0142563 Ga0501074_0142563_891_1523 201
328 3300049591 Ga0501075_0007015 Ga0501075_0007015_26_664 201
329 3300049591 Ga0501075_0022540 Ga0501075_0022540_484_1119 201
330 3300049591 Ga0501075_0048890 Ga0501075_0048890_20_655 201
331 3300049592 Ga0501076_0000481 Ga0501076_0000481_16910_17548 201
332 3300049592 Ga0501076_0052405 Ga0501076_0052405_1284_1922 201
333 3300049592 Ga0501076_0221915 Ga0501076_0221915_786_1439 201
334 3300049592 Ga0501076_0471183 Ga0501076_0471183_373_1011 201
335 3300049593 Ga0501077_0114480 Ga0501077_0114480_339_977 201
336 3300049741 Ga0501079_0688991 Ga0501079_0688991_115_768 201
337 3300049742 Ga0501080_0000476 Ga0501080_0000476_24965_25597 201
338 3300049742 Ga0501080_0004864 Ga0501080_0004864_3947_4600 201
339 3300049742 Ga0501080_0012561 Ga0501080_0012561_2513_3148 201
340 3300049742 Ga0501080_0413485 Ga0501080_0413485_396_1049 201
341 3300049742 Ga0501080_0498787 Ga0501080_0498787_83_718 201
342 3300049743 Ga0501081_0012732 Ga0501081_0012732_3243_3881 201
343 3300049743 Ga0501081_0153327 Ga0501081_0153327_764_1402 201
344 3300049744 Ga0501083_0000063 Ga0501083_0000063_65858_66511 201
345 3300049744 Ga0501083_0019865 Ga0501083_0019865_1156_1788 201
346 3300049744 Ga0501083_0043552 Ga0501083_0043552_1624_2262 201
347 3300049744 Ga0501083_0049161 Ga0501083_0049161_1791_2423 201
348 3300049822 Ga0501035_0000086 Ga0501035_0000086_73397_74050 201
349 3300049822 Ga0501035_0000288 Ga0501035_0000288_33416_34069 201
350 3300049822 Ga0501035_0008014 Ga0501035_0008014_668_1321 201
351 3300049822 Ga0501035_0070894 Ga0501035_0070894_270_923 201
352 3300049822 Ga0501035_0093863 Ga0501035_0093863_979_1662 201
353 3300049822 Ga0501035_0158344 Ga0501035_0158344_284_937 201
354 3300049823 Ga0501044_0000223 Ga0501044_0000223_4354_5007 201
355 3300049823 Ga0501044_0028969 Ga0501044_0028969_1453_2106 201
356 3300049823 Ga0501044_0090695 Ga0501044_0090695_277_930 201
357 3300049823 Ga0501044_0095035 Ga0501044_0095035_1979_2632 201
358 3300049823 Ga0501044_0099207 Ga0501044_0099207_1558_2241 201
359 3300049823 Ga0501044_0106534 Ga0501044_0106534_1846_2499 201
360 3300049823 Ga0501044_0181027 Ga0501044_0181027_724_1377 201
361 3300049824 Ga0501045_0017008 Ga0501045_0017008_2402_3040 201
362 3300049824 Ga0501045_0242554 Ga0501045_0242554_350_988 201
363 3300050511 nmdc:mga08y16_1169191_c1 nmdc:mga08y16_1169191_c1_77_715 201
364 3300050513 nmdc:mga0rr50_243103_c1 nmdc:mga0rr50_243103_c1_550_1188 201
365 3300054114 Ga0501084_0007368 Ga0501084_0007368_4660_5298 201
366 3300054114 Ga0501084_0019287 Ga0501084_0019287_2276_2911 201
367 3300054114 Ga0501084_0151476 Ga0501084_0151476_1106_1744 201
368 3300060353 Ga0501082_0054565 Ga0501082_0054565_2703_3341 201
369 3300060353 Ga0501082_0068505 Ga0501082_0068505_935_1588 201
370 3300060353 Ga0501082_0155165 Ga0501082_0155165_905_1543 201
371 3300061734 Ga0530510_0008535 Ga0530510_0008535_4723_5361 201
372 3300061734 Ga0530510_0075081 Ga0530510_0075081_422_1060 201
373 3300061734 Ga0530510_0476756 Ga0530510_0476756_265_900 201
374 3300005339 Ga0070660_100415299 Ga0070660_1004152992 202
375 3300005530 Ga0070679_100243506 Ga0070679_1002435061 202
376 3300005563 Ga0068855_100300759 Ga0068855_1003007592 202
377 3300025921 Ga0207652_10361524 Ga0207652_103615241 202
378 3300025949 Ga0207667_10020371 Ga0207667_100203719 202
379 3300025922 Ga0207646_10007624 Ga0207646_100076246 203
380 3300005335 Ga0070666_10138573 Ga0070666_101385731 204
381 3300005347 Ga0070668_100067978 Ga0070668_1000679784 204
382 3300005355 Ga0070671_100234938 Ga0070671_1002349382 204
383 3300005367 Ga0070667_100002525 Ga0070667_10000252514 204
384 3300005439 Ga0070711_100269407 Ga0070711_1002694072 204
385 3300005456 Ga0070678_100022120 Ga0070678_1000221203 204
386 3300005459 Ga0068867_100047219 Ga0068867_1000472193 204
387 3300005467 Ga0070706_100201307 Ga0070706_1002013072 204
388 3300005471 Ga0070698_100051637 Ga0070698_1000516372 204
389 3300005536 Ga0070697_100043384 Ga0070697_1000433843 204
390 3300005843 Ga0068860_100476169 Ga0068860_1004761692 204
391 3300006358 Ga0068871_100034329 Ga0068871_1000343295 204
392 3300006852 Ga0075433_10018840 Ga0075433_100188407 204
393 3300006881 Ga0068865_100085242 Ga0068865_1000852423 204
394 3300006914 Ga0075436_100019755 Ga0075436_1000197555 204
395 3300007076 Ga0075435_100017786 Ga0075435_1000177863 204
396 3300009147 Ga0114129_10094059 Ga0114129_100940593 204
397 3300009177 Ga0105248_10322708 Ga0105248_103227082 204
398 3300013308 Ga0157375_10294596 Ga0157375_102945963 204
399 3300014969 Ga0157376_10126887 Ga0157376_101268872 204
400 3300025903 Ga0207680_10107892 Ga0207680_101078922 204
401 3300025916 Ga0207663_10200471 Ga0207663_102004713 204
402 3300025940 Ga0207691_10031337 Ga0207691_100313376 204
403 3300025986 Ga0207658_10011646 Ga0207658_100116468 204
404 3300026089 Ga0207648_10103763 Ga0207648_101037633 204
405 3300035695 Ga0373927_0350204 Ga0373927_0350204_266_931 204
406 3300044673 Ga0453683_0232418 Ga0453683_0232418_505_1149 204
407 3300046472 Ga0495580_0107252 Ga0495580_0107252_167_832 204
408 3300050507 nmdc:mga05p37_337507_c1 nmdc:mga05p37_337507_c1_886_1530 204
409 3300050512 nmdc:mga0n895_8293_c1 nmdc:mga0n895_8293_c1_3402_4046 204
410 3300050513 nmdc:mga0rr50_41271_c1 nmdc:mga0rr50_41271_c1_516_1160 204
411 3300050515 nmdc:mga0a205_2966_c1 nmdc:mga0a205_2966_c1_13896_14540 204
412 3300005327 Ga0070658_10836187 Ga0070658_108361871 205
413 3300005336 Ga0070680_100066778 Ga0070680_1000667783 205
414 3300005344 Ga0070661_100021537 Ga0070661_1000215371 205
415 3300005435 Ga0070714_100035132 Ga0070714_1000351321 205
416 3300005435 Ga0070714_100164329 Ga0070714_1001643292 205
417 3300005435 Ga0070714_100541457 Ga0070714_1005414571 205
418 3300005436 Ga0070713_100174237 Ga0070713_1001742373 205
419 3300005439 Ga0070711_100445013 Ga0070711_1004450131 205
420 3300005458 Ga0070681_10010220 Ga0070681_100102205 205
421 3300005530 Ga0070679_100010473 Ga0070679_1000104737 205
422 3300005614 Ga0068856_100005726 Ga0068856_10000572612 205
423 3300005614 Ga0068856_100028501 Ga0068856_1000285014 205
424 3300009093 Ga0105240_10290424 Ga0105240_102904242 205
425 3300013104 Ga0157370_10029312 Ga0157370_100293122 205
426 3300013307 Ga0157372_10007346 Ga0157372_100073463 205
427 3300013307 Ga0157372_10016875 Ga0157372_100168758 205
428 3300014497 Ga0182008_10109286 Ga0182008_101092862 205
429 3300025906 Ga0207699_10177971 Ga0207699_101779712 205
430 3300025909 Ga0207705_10678737 Ga0207705_106787372 205
431 3300025912 Ga0207707_10022969 Ga0207707_100229692 205
432 3300025913 Ga0207695_10342105 Ga0207695_103421052 205
433 3300025917 Ga0207660_10024247 Ga0207660_100242475 205
434 3300025921 Ga0207652_10007510 Ga0207652_100075107 205
435 3300025921 Ga0207652_10636960 Ga0207652_106369602 205
436 3300025928 Ga0207700_10237933 Ga0207700_102379331 205
437 3300025929 Ga0207664_10002792 Ga0207664_100027925 205
438 3300025929 Ga0207664_10201159 Ga0207664_102011592 205
439 3300025929 Ga0207664_10373081 Ga0207664_103730812 205
440 3300025945 Ga0207679_10069046 Ga0207679_100690463 205
441 3300035171 Ga0373946_0005719 Ga0373946_0005719_239_886 205
442 3300035692 Ga0373935_0156759 Ga0373935_0156759_71_718 205
443 3300046472 Ga0495580_0142923 Ga0495580_0142923_279_923 205
444 3300046674 Ga0495588_0067893 Ga0495588_0067893_1198_1815 205
445 3300047318 Ga0495636_0016407 Ga0495636_0016407_1503_2120 205
446 3300005293 Ga0065715_10474878 Ga0065715_104748781 211
447 3300046506 Ga0495583_0040851 Ga0495583_0040851_103_738 211
448 3300047318 Ga0495636_0009174 Ga0495636_0009174_2127_2762 211
449 3300048905 Ga0496102_0049261 Ga0496102_0049261_1416_2051 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

20

95

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

29

96

0.93

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

141

207

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

24

99

0.89

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

120

212

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.8926 8 205
4mpg-assembly1.cif.gz_A crystal structure of human glutathione transferase theta-2, complex with glutathione and unknown ligand, target efi-507257 0.8821 8 197
4qq7-assembly1.cif.gz_B crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione 0.8813 8 199
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.8806 8 204
4hz2-assembly1.cif.gz_A crystal structure of glutathione s-transferase xaut_3756 (target efi-507152) from xanthobacter autotrophicus py2 0.8791 8 201
ID Description Score Start End Superfamily
af_P0ACA3_4_88_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9335 8 86 3.40.30.10
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9148 8 85 3.40.30.10
4isdD01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9064 7 84 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9055 8 84 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9025 8 86 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1H8LSB1-F1-model_v4 Glutathione S-transferase 0.964 6 204 GO:0016740
AF-A0A1I7IV59-F1-model_v4 Glutathione S-transferase 0.9555 6 211 GO:0016740
AF-A0A4V1CHC0-F1-model_v4 Glutathione S-transferase family protein 0.9488 9 208 GO:0016740
AF-A0A1C6MAW9-F1-model_v4 Glutathione S-transferase 0.9427 6 203 GO:0016740
AF-A0A1I7IV59-F1-model_v4 Glutathione S-transferase 0.9421 6 211 GO:0016740

Feature Viewer

pLDDT pTM Quality
89.91 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map