F446343

General Info

Members Datasets Scaffolds Average Seq Length
449 288 446 181

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10107613|Ga0081539_101076132
Length 187
Sequence MADINYKVPVKLTPLPERSANLRAAGVETADFQWEIIELLFFAYRDFVGDADAVLQEFGFGRAHHRVMHFVSRYPGLKVADLLEVLRITKQSLGRVLKQLIDEGYIVQRSGDNDKRQRLLFATAKGEALVTKLAGLQTKRIAHALKGVTEADNNAVRSFLRHMIDLNEPDKVLQAVMGSSGTARGSS

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
3 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
4 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
69 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
145 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
146 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
270 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
271 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
274 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
275 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
276 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
277 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
282 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
283 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
284 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0.67
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0.22
Rhizoplane 2.9
Rhizosphere 89.53
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214947991 2209111006 Bacteria 1288
2 JGI25404J52841_10000584 3300003659 Bacteria 5438
3 Ga0070658_10215674 3300005327 Bacteria 1622
4 Ga0070670_100079424 3300005331 Bacteria 2819
5 Ga0070666_10002410 3300005335 Bacteria 11315
6 Ga0070680_100071048 3300005336 Bacteria 2860
7 Ga0070680_100100083 3300005336 Bacteria 2406
8 Ga0070682_100073753 3300005337 Bacteria 2190
9 Ga0070682_100073868 3300005337 Bacteria 2189
10 Ga0070660_100154211 3300005339 Bacteria 1848
11 Ga0070687_100053108 3300005343 Bacteria 2106
12 Ga0070671_100038169 3300005355 Bacteria 3987
13 Ga0070674_100025988 3300005356 Bacteria 3819
14 Ga0070673_100006321 3300005364 Bacteria 7693
15 Ga0070659_100040357 3300005366 Bacteria 3647
16 Ga0070659_100123426 3300005366 Bacteria 2100
17 Ga0070667_100043894 3300005367 Bacteria 3752
18 Ga0070709_10001471 3300005434 Bacteria 12718
19 Ga0070709_10059120 3300005434 Bacteria 2433
20 Ga0070709_10066581 3300005434 Bacteria 2311
21 Ga0070714_100040278 3300005435 Bacteria 3938
22 Ga0070714_100679158 3300005435 Bacteria 993
23 Ga0070713_100002952 3300005436 Bacteria 11156
24 Ga0070713_100028421 3300005436 Bacteria 4415
25 Ga0070713_100546366 3300005436 Bacteria 1096
26 Ga0070710_10011524 3300005437 Bacteria 4370
27 Ga0070710_10044867 3300005437 Bacteria 2454
28 Ga0070711_100030176 3300005439 Bacteria 3587
29 Ga0070711_100049935 3300005439 Bacteria 2866
30 Ga0070711_100580049 3300005439 Bacteria 933
31 Ga0070700_100040752 3300005441 Bacteria 2845
32 Ga0070681_10090943 3300005458 Bacteria 3002
33 Ga0070685_10019043 3300005466 Bacteria 3700
34 Ga0070679_100052373 3300005530 Bacteria 4066
35 Ga0070679_100054373 3300005530 Bacteria 3985
36 Ga0070679_100179692 3300005530 Bacteria 2088
37 Ga0070679_100208310 3300005530 Bacteria 1919
38 Ga0070684_100181416 3300005535 Bacteria 1914
39 Ga0068853_100027296 3300005539 Bacteria 4796
40 Ga0068853_100500600 3300005539 Bacteria 1147
41 Ga0070672_100147749 3300005543 Bacteria 1943
42 Ga0070686_100022976 3300005544 Bacteria 3721
43 Ga0070696_100211207 3300005546 Bacteria 1453
44 Ga0070693_100015849 3300005547 Bacteria 3889
45 Ga0070693_100026930 3300005547 Bacteria 3108
46 Ga0070665_100010668 3300005548 Bacteria 9301
47 Ga0070704_100089474 3300005549 Bacteria 2290
48 Ga0068855_100019111 3300005563 Bacteria 8234
49 Ga0068855_100083173 3300005563 Bacteria 3708
50 Ga0068855_100300499 3300005563 Bacteria 1778
51 Ga0070664_100199114 3300005564 Bacteria 1787
52 Ga0068857_100306682 3300005577 Bacteria 1464
53 Ga0068854_100173590 3300005578 Bacteria 1679
54 Ga0068856_100170170 3300005614 Bacteria 2190
55 Ga0068856_100191413 3300005614 Bacteria 2059
56 Ga0070702_100048785 3300005615 Bacteria 2412
57 Ga0068864_100185416 3300005618 Bacteria 1904
58 Ga0068866_10013309 3300005718 Bacteria 3607
59 Ga0081540_1000300 3300005983 Bacteria 51023
60 Ga0081540_1003666 3300005983 Bacteria 12045
61 Ga0081540_1110692 3300005983 Bacteria 1161
62 Ga0081539_10107613 3300005985 Bacteria 1410
63 Ga0070717_10000817 3300006028 Bacteria 20525
64 Ga0070717_10446948 3300006028 Bacteria 1165
65 Ga0070717_10628179 3300006028 Bacteria 975
66 Ga0070716_100000940 3300006173 Bacteria 12603
67 Ga0070716_100302855 3300006173 Bacteria 1113
68 Ga0070712_100007317 3300006175 Bacteria 6890
69 Ga0070712_100108523 3300006175 Bacteria 2067
70 Ga0075369_10005687 3300006186 Bacteria 4675
71 Ga0097621_100015295 3300006237 Bacteria 5770
72 Ga0075428_100538933 3300006844 Bacteria 1248
73 Ga0075434_100155266 3300006871 Bacteria 2308
74 Ga0075434_100533961 3300006871 Bacteria 1193
75 Ga0068865_100072868 3300006881 Bacteria 2441
76 Ga0075436_100045218 3300006914 Bacteria 3036
77 Ga0075436_100050194 3300006914 Bacteria 2878
78 Ga0075435_100069589 3300007076 Bacteria 2870
79 Ga0105251_10040178 3300009011 Bacteria 2281
80 Ga0105250_10031700 3300009092 Bacteria 2122
81 Ga0105240_10080101 3300009093 Bacteria 4017
82 Ga0105240_10167703 3300009093 Bacteria 2603
83 Ga0105240_10512801 3300009093 Bacteria 1332
84 Ga0105245_10094228 3300009098 Bacteria 2760
85 Ga0114129_10014260 3300009147 Bacteria 11325
86 Ga0114129_10311945 3300009147 Bacteria 2093
87 Ga0105243_10021264 3300009148 Bacteria 4924
88 Ga0105241_10044626 3300009174 Bacteria 3359
89 Ga0105242_10013376 3300009176 Bacteria 6339
90 Ga0105248_10145238 3300009177 Bacteria 2677
91 Ga0105237_10042836 3300009545 Bacteria 4562
92 Ga0105238_10025592 3300009551 Bacteria 6016
93 Ga0105238_10062917 3300009551 Bacteria 3711
94 Ga0105238_11151427 3300009551 Bacteria 799
95 Ga0105249_10548336 3300009553 Bacteria 1206
96 Ga0105239_10081090 3300010375 Bacteria 3571
97 Ga0157335_1003505 3300012492 Bacteria 1012
98 Ga0157338_1000838 3300012515 Bacteria 2004
99 Ga0157373_10060338 3300013100 Bacteria 2688
100 Ga0157371_10049586 3300013102 Bacteria 2982
101 Ga0157370_10133748 3300013104 Bacteria 2313
102 Ga0157370_10319061 3300013104 Bacteria 1433
103 Ga0157369_10187647 3300013105 Bacteria 2173
104 Ga0157369_10467927 3300013105 Bacteria 1305
105 Ga0157378_10041712 3300013297 Bacteria 4071
106 Ga0163162_10784080 3300013306 Bacteria 1071
107 Ga0157372_10149209 3300013307 Bacteria 2697
108 Ga0157372_10248177 3300013307 Bacteria 2066
109 Ga0157372_10488699 3300013307 Bacteria 1435
110 Ga0157375_10130156 3300013308 Bacteria 2635
111 Ga0163163_10148844 3300014325 Bacteria 2385
112 Ga0157380_10062937 3300014326 Bacteria 2974
113 Ga0157377_10456143 3300014745 Unclassified 884
114 Ga0157379_10067139 3300014968 Bacteria 3206
115 Ga0157376_10059328 3300014969 Bacteria 3208
116 Ga0206356_10393450 3300020070 Bacteria 2281
117 Ga0206354_10592092 3300020081 Bacteria 1781
118 Ga0206353_11411820 3300020082 Bacteria 1936
119 Ga0207697_10110365 3300025315 Bacteria 1177
120 Ga0207713_1053699 3300025735 Bacteria 1585
121 Ga0207692_10160874 3300025898 Bacteria 1294
122 Ga0207692_10191016 3300025898 Bacteria 1198
123 Ga0207710_10001206 3300025900 Bacteria 13122
124 Ga0207688_10243486 3300025901 Bacteria 1088
125 Ga0207680_10002299 3300025903 Bacteria 8909
126 Ga0207685_10000115 3300025905 Bacteria 12186
127 Ga0207699_10004298 3300025906 Bacteria 6812
128 Ga0207699_10513197 3300025906 Bacteria 866
129 Ga0207645_10020372 3300025907 Bacteria 4341
130 Ga0207705_10012753 3300025909 Bacteria 6064
131 Ga0207705_10089639 3300025909 Bacteria 2251
132 Ga0207705_10103307 3300025909 Bacteria 2099
133 Ga0207654_10055084 3300025911 Bacteria 2301
134 Ga0207707_10061709 3300025912 Bacteria 3262
135 Ga0207707_10144776 3300025912 Bacteria 2077
136 Ga0207707_10381115 3300025912 Bacteria 1212
137 Ga0207707_10611907 3300025912 Bacteria 921
138 Ga0207695_10085049 3300025913 Bacteria 3192
139 Ga0207695_10085628 3300025913 Bacteria 3180
140 Ga0207695_10462596 3300025913 Bacteria 1151
141 Ga0207671_10052959 3300025914 Bacteria 3008
142 Ga0207693_10005987 3300025915 Bacteria 10083
143 Ga0207693_10061659 3300025915 Bacteria 2937
144 Ga0207693_10115635 3300025915 Bacteria 2106
145 Ga0207663_10137758 3300025916 Bacteria 1696
146 Ga0207660_10028935 3300025917 Bacteria 3796
147 Ga0207660_10032599 3300025917 Bacteria 3597
148 Ga0207660_10124655 3300025917 Bacteria 1955
149 Ga0207657_10016100 3300025919 Bacteria 7218
150 Ga0207657_10433044 3300025919 Bacteria 1033
151 Ga0207649_10034482 3300025920 Bacteria 3033
152 Ga0207652_10105522 3300025921 Bacteria 2493
153 Ga0207652_10148776 3300025921 Bacteria 2096
154 Ga0207652_10429951 3300025921 Bacteria 1191
155 Ga0207694_10040374 3300025924 Bacteria 3592
156 Ga0207650_10022817 3300025925 Bacteria 4434
157 Ga0207687_10003698 3300025927 Bacteria 10296
158 Ga0207700_10000623 3300025928 Bacteria 20712
159 Ga0207700_10300792 3300025928 Bacteria 1385
160 Ga0207664_10011407 3300025929 Bacteria 6315
161 Ga0207690_10024995 3300025932 Bacteria 3746
162 Ga0207690_10168826 3300025932 Bacteria 1637
163 Ga0207686_10026691 3300025934 Bacteria 3372
164 Ga0207686_10060525 3300025934 Bacteria 2397
165 Ga0207670_10063991 3300025936 Bacteria 2519
166 Ga0207704_10041140 3300025938 Bacteria 2707
167 Ga0207665_10001669 3300025939 Bacteria 14935
168 Ga0207665_10137703 3300025939 Bacteria 1738
169 Ga0207711_10005790 3300025941 Bacteria 10441
170 Ga0207661_10022549 3300025944 Bacteria 4745
171 Ga0207661_10169112 3300025944 Bacteria 1902
172 Ga0207679_10098699 3300025945 Bacteria 2278
173 Ga0207667_10011279 3300025949 Bacteria 10393
174 Ga0207667_10190351 3300025949 Bacteria 2105
175 Ga0207667_10571415 3300025949 Bacteria 1142
176 Ga0207651_10021074 3300025960 Bacteria 3951
177 Ga0207640_10043059 3300025981 Bacteria 2883
178 Ga0207658_10016873 3300025986 Bacteria 5025
179 Ga0207703_10007095 3300026035 Bacteria 8913
180 Ga0207639_10449083 3300026041 Bacteria 1170
181 Ga0207678_10030649 3300026067 Bacteria 4695
182 Ga0207708_10704154 3300026075 Bacteria 864
183 Ga0207702_10428829 3300026078 Bacteria 1280
184 Ga0207641_10076926 3300026088 Bacteria 2886
185 Ga0207676_10003269 3300026095 Bacteria 11531
186 Ga0207674_10304865 3300026116 Bacteria 1542
187 Ga0207675_100029099 3300026118 Bacteria 5148
188 Ga0207683_10003304 3300026121 Bacteria 14057
189 Ga0207698_10100835 3300026142 Bacteria 2393
190 Ga0207428_10074757 3300027907 Bacteria 2657
191 Ga0268266_10004404 3300028379 Bacteria 13495
192 Ga0265325_10003470 3300031241 Bacteria 10281
193 Ga0265329_10060464 3300031242 Bacteria 1200
194 Ga0265331_10161207 3300031250 Bacteria 1016
195 Ga0265313_10000339 3300031595 Bacteria 50809
196 Ga0265313_10021913 3300031595 Bacteria 3482
197 Ga0307413_10736260 3300031824 Bacteria 823
198 Ga0307416_102745062 3300032002 Bacteria 589
199 Ga0316583_10000116 3300032133 Bacteria 18613
200 Ga0373950_0002390 3300034818 Bacteria 2579
201 Ga0373950_0006370 3300034818 Bacteria 1797
202 Ga0373950_0043011 3300034818 Bacteria 870
203 Ga0373926_0094992 3300035083 Bacteria 1111
204 Ga0373928_0002249 3300035084 Bacteria 3762
205 Ga0373929_0004239 3300035085 Bacteria 2571
206 Ga0373951_0014794 3300035091 Bacteria 1755
207 Ga0373936_0017635 3300035113 Bacteria 2751
208 Ga0373939_0003623 3300035114 Bacteria 3630
209 Ga0373941_0000158 3300035115 Bacteria 12249
210 Ga0373941_0000578 3300035115 Bacteria 7374
211 Ga0373941_0002027 3300035115 Bacteria 4386
212 Ga0373945_0057819 3300035116 Bacteria 1441
213 Ga0373945_0072867 3300035116 Bacteria 1303
214 Ga0373954_0007693 3300035118 Bacteria 4716
215 Ga0373957_0006765 3300035120 Bacteria 3630
216 Ga0373957_0148171 3300035120 Bacteria 962
217 Ga0373960_0011114 3300035121 Bacteria 2211
218 Ga0373943_0006929 3300035170 Bacteria 5085
219 Ga0373943_0051051 3300035170 Bacteria 2035
220 Ga0373946_0044708 3300035171 Bacteria 1829
221 Ga0373946_0078451 3300035171 Bacteria 1441
222 Ga0373955_0001732 3300035172 Bacteria 9348
223 Ga0373942_0013172 3300035207 Bacteria 1984
224 Ga0373962_0003681 3300035242 Bacteria 3687
225 Ga0373924_0001989 3300035410 Bacteria 6797
226 Ga0373931_0012190 3300035691 Bacteria 4162
227 Ga0373935_0024245 3300035692 Bacteria 3733
228 Ga0373935_0273697 3300035692 Bacteria 1187
229 Ga0373927_0043102 3300035695 Bacteria 2922
230 Ga0373927_0055814 3300035695 Bacteria 2553
231 Ga0373933_0001526 3300035724 Bacteria 13510
232 Ga0373947_0021848 3300035725 Bacteria 3707
233 Ga0373947_0046913 3300035725 Bacteria 2588
234 Ga0373947_0148526 3300035725 Bacteria 1508
235 Ga0373937_0002031 3300036401 Bacteria 16910
236 Ga0373937_0002067 3300036401 Bacteria 16792
237 Ga0373937_0883871 3300036401 Bacteria 842
238 Ga0373925_0004333 3300037068 Bacteria 10734
239 Ga0373925_0012148 3300037068 Bacteria 6233
240 Ga0436365_1703855 3300039437 Bacteria 2415
241 Ga0451800_0199826 3300041459 Bacteria 880
242 Ga0451807_2758769 3300041486 Bacteria 1419
243 Ga0466964_0099894 3300044706 Bacteria 1278
244 Ga0451576_0350944 3300045051 Bacteria 1545
245 Ga0466967_0913982 3300045976 Bacteria 873
246 Ga0495592_0008608 3300046454 Bacteria 7657
247 Ga0495592_0127634 3300046454 Bacteria 1782
248 Ga0495603_0003171 3300046455 Bacteria 9777
249 Ga0495603_0087082 3300046455 Bacteria 1828
250 Ga0495603_0290175 3300046455 Bacteria 940
251 Ga0495603_0434810 3300046455 Bacteria 752
252 Ga0495603_0737542 3300046455 Bacteria 563
253 Ga0495629_0000026 3300046459 Bacteria 134719
254 Ga0495638_0199017 3300046460 Bacteria 1132
255 Ga0495651_0017806 3300046462 Bacteria 5501
256 Ga0495651_0019768 3300046462 Bacteria 5221
257 Ga0495653_0033340 3300046463 Bacteria 4081
258 Ga0495580_0094714 3300046472 Bacteria 2077
259 Ga0495582_0011256 3300046473 Bacteria 4929
260 Ga0495582_0012086 3300046473 Bacteria 4757
261 Ga0495662_0034280 3300046476 Bacteria 2451
262 Ga0495664_0090573 3300046477 Bacteria 1839
263 Ga0495594_0245739 3300046499 Bacteria 1020
264 Ga0495608_0006088 3300046511 Bacteria 8560
265 Ga0495610_0107244 3300046512 Bacteria 1242
266 Ga0495618_0038863 3300046514 Bacteria 2991
267 Ga0495628_0083278 3300046516 Bacteria 2483
268 Ga0495630_0113926 3300046517 Bacteria 2049
269 Ga0495666_0163198 3300046526 Bacteria 1032
270 Ga0495640_0009022 3300046533 Bacteria 7784
271 Ga0495587_0002925 3300046536 Bacteria 11432
272 Ga0495645_0003668 3300046543 Bacteria 10430
273 Ga0495622_0232462 3300046557 Unclassified 814
274 Ga0495667_0003478 3300046559 Bacteria 10553
275 Ga0495667_0024428 3300046559 Bacteria 4069
276 Ga0495634_0013379 3300046642 Bacteria 5929
277 Ga0495635_0017003 3300046663 Bacteria 5079
278 Ga0495659_0074144 3300046664 Bacteria 1280
279 Ga0495657_0528166 3300046675 Bacteria 686
280 Ga0495599_0027101 3300046678 Bacteria 3591
281 Ga0495623_0002450 3300046679 Bacteria 12303
282 Ga0495646_0077527 3300046680 Bacteria 1943
283 Ga0495647_0013379 3300046681 Bacteria 2842
284 Ga0495658_0001690 3300046683 Bacteria 11479
285 Ga0495658_0020110 3300046683 Bacteria 3497
286 Ga0495658_0065888 3300046683 Bacteria 2091
287 Ga0495613_0003849 3300046689 Bacteria 11230
288 Ga0495613_0373189 3300046689 Bacteria 977
289 Ga0495600_0046747 3300046809 Bacteria 2823
290 Ga0495581_0021568 3300047315 Bacteria 3732
291 Ga0495604_0009839 3300047317 Bacteria 7565
292 Ga0495674_0045526 3300047319 Bacteria 3896
293 Ga0495674_0193066 3300047319 Bacteria 1691
294 Ga0495676_0365062 3300047321 Bacteria 963
295 Ga0495680_0029843 3300047322 Bacteria 4461
296 Ga0495680_0037049 3300047322 Bacteria 3909
297 Ga0495675_0004145 3300047444 Bacteria 8773
298 Ga0495684_0177225 3300047471 Bacteria 1582
299 Ga0495686_0425400 3300047472 Bacteria 709
300 Ga0495593_0013909 3300047673 Bacteria 4584
301 Ga0495602_0001877 3300048088 Bacteria 21025
302 Ga0495602_0042715 3300048088 Bacteria 4128
303 Ga0496100_0005905 3300048903 Bacteria 6633
304 Ga0496101_0214951 3300048904 Bacteria 1490
305 Ga0496104_0089492 3300048907 Bacteria 2940
306 Ga0496105_0024612 3300048908 Bacteria 4892
307 Ga0496107_0095025 3300048910 Bacteria 2180
308 Ga0496108_0110460 3300048911 Bacteria 2350
309 Ga0496111_0016164 3300048914 Bacteria 5139
310 Ga0496112_0002087 3300048915 Bacteria 15846
311 Ga0496114_0099648 3300048917 Bacteria 2478
312 Ga0496115_0008142 3300048918 Bacteria 7744
313 Ga0496115_0241224 3300048918 Bacteria 1489
314 Ga0496121_0267820 3300048924 Bacteria 1176
315 Ga0496123_0196919 3300048926 Bacteria 1037
316 Ga0496126_0012254 3300048929 Bacteria 8796
317 Ga0501031_0058989 3300049568 Bacteria 2501
318 Ga0501032_0018667 3300049569 Bacteria 4856
319 Ga0501032_0121490 3300049569 Bacteria 1726
320 Ga0501032_0132036 3300049569 Bacteria 1647
321 Ga0501033_0065753 3300049570 Bacteria 2667
322 Ga0501033_0080757 3300049570 Bacteria 2385
323 Ga0501033_0125432 3300049570 Bacteria 1862
324 Ga0501034_0001584 3300049571 Bacteria 29619
325 Ga0501034_0014590 3300049571 Bacteria 8089
326 Ga0501034_0019501 3300049571 Bacteria 6936
327 Ga0501034_0043434 3300049571 Bacteria 4549
328 Ga0501034_0100176 3300049571 Bacteria 2891
329 Ga0501034_0149844 3300049571 Bacteria 2309
330 Ga0501034_0151408 3300049571 Bacteria 2295
331 Ga0501034_0307554 3300049571 Bacteria 1520
332 Ga0501034_0367771 3300049571 Bacteria 1364
333 Ga0501034_1067469 3300049571 Bacteria 689
334 Ga0501036_0001347 3300049572 Bacteria 18840
335 Ga0501036_0054125 3300049572 Bacteria 3398
336 Ga0501036_0294053 3300049572 Bacteria 1359
337 Ga0501037_0018261 3300049573 Bacteria 5167
338 Ga0501037_0034853 3300049573 Bacteria 3713
339 Ga0501037_0066373 3300049573 Bacteria 2628
340 Ga0501037_0288302 3300049573 Bacteria 1142
341 Ga0501038_0013678 3300049574 Bacteria 7396
342 Ga0501038_0044970 3300049574 Bacteria 3834
343 Ga0501039_0039053 3300049575 Bacteria 3666
344 Ga0501039_0043201 3300049575 Bacteria 3482
345 Ga0501039_0371548 3300049575 Bacteria 1123
346 Ga0501040_0065023 3300049576 Bacteria 2512
347 Ga0501042_0142203 3300049578 Bacteria 1730
348 Ga0501043_0010758 3300049579 Bacteria 7165
349 Ga0501043_0043265 3300049579 Bacteria 3540
350 Ga0501043_0086427 3300049579 Bacteria 2464
351 Ga0501043_0103059 3300049579 Bacteria 2242
352 Ga0501046_0057212 3300049580 Bacteria 3059
353 Ga0501047_0006650 3300049581 Bacteria 10866
354 Ga0501047_0036849 3300049581 Bacteria 4727
355 Ga0501047_0100515 3300049581 Bacteria 2771
356 Ga0501047_0329988 3300049581 Bacteria 1364
357 Ga0501047_0862225 3300049581 Bacteria 719
358 Ga0501048_0000039 3300049582 Bacteria 63521
359 Ga0501048_0230386 3300049582 Bacteria 1314
360 Ga0501048_0667583 3300049582 Bacteria 746
361 Ga0501067_0055594 3300049583 Bacteria 2193
362 Ga0501067_0077944 3300049583 Bacteria 1836
363 Ga0501067_0109906 3300049583 Bacteria 1532
364 Ga0501067_0363209 3300049583 Bacteria 807
365 Ga0501068_0256050 3300049584 Bacteria 1116
366 Ga0501069_0026184 3300049585 Bacteria 3193
367 Ga0501069_0242080 3300049585 Bacteria 1051
368 Ga0501069_0246816 3300049585 Bacteria 1041
369 Ga0501070_0013578 3300049586 Bacteria 6865
370 Ga0501070_0094910 3300049586 Bacteria 2468
371 Ga0501070_0210572 3300049586 Bacteria 1596
372 Ga0501070_0304266 3300049586 Bacteria 1298
373 Ga0501070_0407170 3300049586 Bacteria 1099
374 Ga0501071_0370248 3300049587 Bacteria 1092
375 Ga0501071_0423494 3300049587 Bacteria 1017
376 Ga0501072_0203041 3300049588 Bacteria 1580
377 Ga0501073_0010200 3300049589 Bacteria 6901
378 Ga0501073_0034068 3300049589 Bacteria 3625
379 Ga0501073_0153519 3300049589 Bacteria 1596
380 Ga0501073_0240420 3300049589 Bacteria 1250
381 Ga0501074_0021551 3300049590 Bacteria 4679
382 Ga0501074_0064758 3300049590 Bacteria 2631
383 Ga0501074_0120925 3300049590 Bacteria 1873
384 Ga0501074_0269853 3300049590 Bacteria 1209
385 Ga0501074_0384911 3300049590 Bacteria 995
386 Ga0501080_0000022 3300049742 Bacteria 90630
387 Ga0501080_0058013 3300049742 Bacteria 3604
388 Ga0501080_0086635 3300049742 Bacteria 2910
389 Ga0501080_0100872 3300049742 Bacteria 2678
390 Ga0501083_0001941 3300049744 Bacteria 14225
391 Ga0501083_0381802 3300049744 Bacteria 916
392 Ga0501035_0031789 3300049822 Bacteria 4807
393 Ga0501035_0677694 3300049822 Bacteria 833
394 Ga0501044_0005112 3300049823 Bacteria 14631
395 Ga0501044_0019008 3300049823 Bacteria 7357
396 Ga0501044_0109906 3300049823 Bacteria 2765
397 Ga0501044_0253694 3300049823 Bacteria 1699
398 Ga0501044_0926289 3300049823 Bacteria 745
399 Ga0501044_0999167 3300049823 Bacteria 708
400 nmdc:mga03n38_106582_c1 3300050490 Bacteria 1359
401 nmdc:mga00v17_158597_c1 3300050491 Bacteria 1456
402 nmdc:mga0yw44_88044_c1 3300050492 Bacteria 1958
403 nmdc:mga05p37_353538_c1 3300050507 Bacteria 1729
404 nmdc:mga08y16_182951_c1 3300050511 Bacteria 2175
405 nmdc:mga0n895_217761_c1 3300050512 Bacteria 1939
406 nmdc:mga08x19_22982_c1 3300050514 Bacteria 3866
407 nmdc:mga0a205_438984_c1 3300050515 Bacteria 1166
408 nmdc:mga0a205_689746_c1 3300050515 Bacteria 871
409 nmdc:mga0sz30_3800_c1 3300050516 Bacteria 5441
410 Ga0495601_0001233 3300053077 Bacteria 14029
411 Ga0495601_0002814 3300053077 Bacteria 9872
412 Ga0495601_0003553 3300053077 Bacteria 8962
413 Ga0495612_0005171 3300053078 Bacteria 5390
414 Ga0495595_0005027 3300053084 Bacteria 5340
415 Ga0495619_0000360 3300053085 Bacteria 31637
416 Ga0495619_0001277 3300053085 Bacteria 16520
417 Ga0495619_0064410 3300053085 Bacteria 2443
418 Ga0500578_0182914 3300053086 Bacteria 1291
419 Ga0500643_008577 3300053087 Bacteria 4005
420 Ga0500644_0006029 3300053088 Bacteria 3087
421 Ga0500651_0025973 3300053093 Bacteria 3677
422 Ga0500651_0144640 3300053093 Bacteria 1431
423 Ga0500572_000359 3300053111 Bacteria 16208
424 Ga0500594_0094914 3300053118 Bacteria 910
425 Ga0500608_061785 3300053122 Bacteria 1789
426 Ga0500652_000014 3300053131 Bacteria 147740
427 Ga0500652_031232 3300053131 Bacteria 2088
428 Ga0500655_078001 3300053133 Bacteria 680
429 Ga0500559_0000213 3300053136 Bacteria 46604
430 Ga0500577_0057738 3300053142 Bacteria 1482
431 Ga0500616_0000002 3300053153 Bacteria 1611257
432 Ga0500616_0049589 3300053153 Bacteria 2220
433 Ga0500622_0063525 3300053156 Bacteria 1879
434 Ga0500639_064371 3300053163 Bacteria 1884
435 Ga0500636_0010455 3300053177 Bacteria 5415
436 Ga0500636_0018309 3300053177 Bacteria 4141
437 Ga0500576_037173 3300053725 Bacteria 2201
438 Ga0500645_001709 3300053730 Bacteria 10681
439 Ga0500596_003672 3300053735 Bacteria 2888
440 Ga0501084_0034964 3300054114 Bacteria 4202
441 Ga0501084_0133775 3300054114 Bacteria 2087
442 Ga0501082_0062344 3300060353 Bacteria 3209
443 Ga0501082_0140587 3300060353 Bacteria 2095
444 Ga0501082_0651218 3300060353 Bacteria 922
445 Ga0501082_0756415 3300060353 Bacteria 850
446 Ga0501082_0828045 3300060353 Bacteria 810

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2885383462 2885391824 151
2 3300035692 Ga0373935_0273697 Ga0373935_0273697_87_554 155
3 3300035725 Ga0373947_0148526 Ga0373947_0148526_442_909 155
4 3300046455 Ga0495603_0434810 Ga0495603_0434810_230_697 155
5 3300047472 Ga0495686_0425400 Ga0495686_0425400_24_491 155
6 3300048924 Ga0496121_0267820 Ga0496121_0267820_288_755 155
7 3300048929 Ga0496126_0012254 Ga0496126_0012254_7068_7535 155
8 3300053111 Ga0500572_000359 Ga0500572_000359_2505_2972 155
9 3300053136 Ga0500559_0000213 Ga0500559_0000213_5678_6145 155
10 3300053725 Ga0500576_037173 Ga0500576_037173_569_1036 155
11 3300053735 Ga0500596_003672 Ga0500596_003672_1332_1799 155
12 3300045051 Ga0451576_0350944 Ga0451576_0350944_765_1292 161
13 3300005983 Ga0081540_1110692 Ga0081540_11106922 162
14 3300049570 Ga0501033_0125432 Ga0501033_0125432_924_1454 162
15 3300049571 Ga0501034_0151408 Ga0501034_0151408_1691_2221 162
16 3300049572 Ga0501036_0294053 Ga0501036_0294053_408_938 162
17 3300049573 Ga0501037_0034853 Ga0501037_0034853_3130_3660 162
18 3300046512 Ga0495610_0107244 Ga0495610_0107244_687_1205 164
19 3300048926 Ga0496123_0196919 Ga0496123_0196919_111_629 164
20 3300049590 Ga0501074_0384911 Ga0501074_0384911_315_857 164
21 3300053086 Ga0500578_0182914 Ga0500578_0182914_536_1054 164
22 3300053093 Ga0500651_0144640 Ga0500651_0144640_894_1412 164
23 3300053122 Ga0500608_061785 Ga0500608_061785_647_1165 164
24 3300053142 Ga0500577_0057738 Ga0500577_0057738_549_1067 164
25 3300053153 Ga0500616_0049589 Ga0500616_0049589_115_633 164
26 3300053156 Ga0500622_0063525 Ga0500622_0063525_1257_1775 164
27 3300053177 Ga0500636_0018309 Ga0500636_0018309_1609_2127 164
28 3300053133 Ga0500655_078001 Ga0500655_078001_160_657 165
29 3300041486 Ga0451807_2758769 Ga0451807_2758769_339_842 167
30 3300009147 Ga0114129_10014260 Ga0114129_100142605 168
31 3300039437 Ga0436365_1703855 Ga0436365_1703855_495_1004 168
32 3300044706 Ga0466964_0099894 Ga0466964_0099894_526_1032 168
33 3300035083 Ga0373926_0094992 Ga0373926_0094992_494_1003 169
34 3300035695 Ga0373927_0055814 Ga0373927_0055814_1838_2347 169
35 3300035725 Ga0373947_0046913 Ga0373947_0046913_231_740 169
36 3300037068 Ga0373925_0012148 Ga0373925_0012148_4104_4613 169
37 3300046473 Ga0495582_0011256 Ga0495582_0011256_2819_3328 169
38 3300046683 Ga0495658_0020110 Ga0495658_0020110_1462_1971 169
39 3300005435 Ga0070714_100679158 Ga0070714_1006791581 170
40 3300005437 Ga0070710_10011524 Ga0070710_100115248 170
41 3300025898 Ga0207692_10160874 Ga0207692_101608741 170
42 3300025912 Ga0207707_10381115 Ga0207707_103811152 170
43 3300046455 Ga0495603_0737542 Ga0495603_0737542_34_549 170
44 3300005436 Ga0070713_100546366 Ga0070713_1005463662 171
45 3300006028 Ga0070717_10628179 Ga0070717_106281792 171
46 3300009551 Ga0105238_11151427 Ga0105238_111514271 171
47 3300025939 Ga0207665_10137703 Ga0207665_101377032 171
48 3300049571 Ga0501034_0014590 Ga0501034_0014590_2464_2982 171
49 3300049583 Ga0501067_0077944 Ga0501067_0077944_435_950 171
50 3300049584 Ga0501068_0256050 Ga0501068_0256050_392_910 171
51 3300049585 Ga0501069_0242080 Ga0501069_0242080_218_733 171
52 3300049586 Ga0501070_0304266 Ga0501070_0304266_347_862 171
53 3300049588 Ga0501072_0203041 Ga0501072_0203041_965_1480 171
54 3300049589 Ga0501073_0034068 Ga0501073_0034068_2832_3347 171
55 3300049590 Ga0501074_0269853 Ga0501074_0269853_344_859 171
56 3300049742 Ga0501080_0086635 Ga0501080_0086635_1088_1603 171
57 3300049742 Ga0501080_0100872 Ga0501080_0100872_1291_1809 171
58 3300060353 Ga0501082_0651218 Ga0501082_0651218_395_910 171
59 3300034818 Ga0373950_0002390 Ga0373950_0002390_950_1507 172
60 3300005434 Ga0070709_10066581 Ga0070709_100665813 174
61 3300005439 Ga0070711_100030176 Ga0070711_1000301764 174
62 3300005564 Ga0070664_100199114 Ga0070664_1001991143 174
63 3300006173 Ga0070716_100302855 Ga0070716_1003028552 174
64 3300006175 Ga0070712_100108523 Ga0070712_1001085233 174
65 3300006844 Ga0075428_100538933 Ga0075428_1005389331 174
66 3300009551 Ga0105238_10025592 Ga0105238_100255928 174
67 3300025901 Ga0207688_10243486 Ga0207688_102434862 174
68 3300025915 Ga0207693_10115635 Ga0207693_101156353 174
69 3300026075 Ga0207708_10704154 Ga0207708_107041541 174
70 3300035116 Ga0373945_0072867 Ga0373945_0072867_696_1226 174
71 3300035170 Ga0373943_0051051 Ga0373943_0051051_869_1459 174
72 3300035171 Ga0373946_0044708 Ga0373946_0044708_1016_1606 174
73 3300036401 Ga0373937_0883871 Ga0373937_0883871_168_758 174
74 3300041459 Ga0451800_0199826 Ga0451800_0199826_98_631 174
75 3300046455 Ga0495603_0087082 Ga0495603_0087082_1113_1703 174
76 3300046472 Ga0495580_0094714 Ga0495580_0094714_893_1483 174
77 3300046476 Ga0495662_0034280 Ga0495662_0034280_1246_1854 174
78 3300046517 Ga0495630_0113926 Ga0495630_0113926_1334_1924 174
79 3300046526 Ga0495666_0163198 Ga0495666_0163198_372_962 174
80 3300046533 Ga0495640_0009022 Ga0495640_0009022_2219_2809 174
81 3300046642 Ga0495634_0013379 Ga0495634_0013379_824_1414 174
82 3300046689 Ga0495613_0373189 Ga0495613_0373189_301_891 174
83 3300047319 Ga0495674_0045526 Ga0495674_0045526_98_688 174
84 3300047321 Ga0495676_0365062 Ga0495676_0365062_93_623 174
85 3300053077 Ga0495601_0003553 Ga0495601_0003553_4502_5092 174
86 3300005539 Ga0068853_100500600 Ga0068853_1005006002 175
87 3300009093 Ga0105240_10080101 Ga0105240_100801012 175
88 3300013104 Ga0157370_10319061 Ga0157370_103190611 175
89 3300013105 Ga0157369_10187647 Ga0157369_101876473 175
90 3300025912 Ga0207707_10611907 Ga0207707_106119072 175
91 3300032133 Ga0316583_10000116 Ga0316583_100001161 175
92 3300049569 Ga0501032_0018667 Ga0501032_0018667_1666_2193 175
93 3300049571 Ga0501034_0001584 Ga0501034_0001584_21369_21896 175
94 3300049571 Ga0501034_0367771 Ga0501034_0367771_532_1059 175
95 3300049572 Ga0501036_0001347 Ga0501036_0001347_9643_10170 175
96 3300049574 Ga0501038_0044970 Ga0501038_0044970_791_1318 175
97 3300049579 Ga0501043_0010758 Ga0501043_0010758_4259_4786 175
98 3300049580 Ga0501046_0057212 Ga0501046_0057212_896_1423 175
99 3300049581 Ga0501047_0006650 Ga0501047_0006650_139_666 175
100 3300049582 Ga0501048_0000039 Ga0501048_0000039_41093_41620 175
101 3300049586 Ga0501070_0013578 Ga0501070_0013578_1726_2253 175
102 3300049589 Ga0501073_0240420 Ga0501073_0240420_87_614 175
103 3300049590 Ga0501074_0021551 Ga0501074_0021551_822_1349 175
104 3300049742 Ga0501080_0000022 Ga0501080_0000022_20112_20639 175
105 3300049744 Ga0501083_0001941 Ga0501083_0001941_3487_4014 175
106 3300049823 Ga0501044_0005112 Ga0501044_0005112_10187_10714 175
107 3300060353 Ga0501082_0756415 Ga0501082_0756415_309_836 175
108 3300031824 Ga0307413_10736260 Ga0307413_107362601 176
109 3300032002 Ga0307416_102745062 Ga0307416_1027450621 176
110 3300035115 Ga0373941_0002027 Ga0373941_0002027_3439_3969 176
111 3300049571 Ga0501034_0019501 Ga0501034_0019501_5599_6129 176
112 3300049573 Ga0501037_0066373 Ga0501037_0066373_1018_1548 176
113 3300049575 Ga0501039_0039053 Ga0501039_0039053_1381_1911 176
114 3300049579 Ga0501043_0086427 Ga0501043_0086427_246_776 176
115 3300049581 Ga0501047_0036849 Ga0501047_0036849_2721_3251 176
116 3300049582 Ga0501048_0667583 Ga0501048_0667583_10_540 176
117 3300049583 Ga0501067_0363209 Ga0501067_0363209_201_731 176
118 3300049587 Ga0501071_0370248 Ga0501071_0370248_29_559 176
119 3300049822 Ga0501035_0031789 Ga0501035_0031789_356_886 176
120 3300049823 Ga0501044_0109906 Ga0501044_0109906_1881_2411 176
121 3300034818 Ga0373950_0043011 Ga0373950_0043011_148_681 177
122 3300049569 Ga0501032_0121490 Ga0501032_0121490_37_570 177
123 3300049570 Ga0501033_0065753 Ga0501033_0065753_1451_1984 177
124 3300049571 Ga0501034_0307554 Ga0501034_0307554_509_1042 177
125 3300049571 Ga0501034_1067469 Ga0501034_1067469_114_647 177
126 3300049573 Ga0501037_0288302 Ga0501037_0288302_499_1032 177
127 3300049575 Ga0501039_0371548 Ga0501039_0371548_136_669 177
128 3300049576 Ga0501040_0065023 Ga0501040_0065023_368_901 177
129 3300049578 Ga0501042_0142203 Ga0501042_0142203_785_1318 177
130 3300049579 Ga0501043_0103059 Ga0501043_0103059_1448_1981 177
131 3300049582 Ga0501048_0230386 Ga0501048_0230386_276_809 177
132 3300049583 Ga0501067_0109906 Ga0501067_0109906_373_906 177
133 3300049585 Ga0501069_0026184 Ga0501069_0026184_2276_2809 177
134 3300049586 Ga0501070_0407170 Ga0501070_0407170_308_841 177
135 3300049587 Ga0501071_0423494 Ga0501071_0423494_92_625 177
136 3300049590 Ga0501074_0064758 Ga0501074_0064758_56_589 177
137 3300049822 Ga0501035_0677694 Ga0501035_0677694_71_604 177
138 3300049823 Ga0501044_0999167 Ga0501044_0999167_34_567 177
139 3300054114 Ga0501084_0133775 Ga0501084_0133775_141_674 177
140 3300060353 Ga0501082_0062344 Ga0501082_0062344_891_1424 177
141 3300009147 Ga0114129_10311945 Ga0114129_103119452 178
142 3300050507 nmdc:mga05p37_353538_c1 nmdc:mga05p37_353538_c1_1057_1605 178
143 3300050515 nmdc:mga0a205_689746_c1 nmdc:mga0a205_689746_c1_204_752 178
144 3300005336 Ga0070680_100071048 Ga0070680_1000710482 179
145 3300005337 Ga0070682_100073753 Ga0070682_1000737532 179
146 3300005366 Ga0070659_100040357 Ga0070659_1000403573 179
147 3300005458 Ga0070681_10090943 Ga0070681_100909433 179
148 3300005530 Ga0070679_100052373 Ga0070679_1000523735 179
149 3300005530 Ga0070679_100054373 Ga0070679_1000543733 179
150 3300005539 Ga0068853_100027296 Ga0068853_1000272963 179
151 3300005563 Ga0068855_100300499 Ga0068855_1003004992 179
152 3300005577 Ga0068857_100306682 Ga0068857_1003066822 179
153 3300005578 Ga0068854_100173590 Ga0068854_1001735902 179
154 3300005614 Ga0068856_100191413 Ga0068856_1001914132 179
155 3300013100 Ga0157373_10060338 Ga0157373_100603382 179
156 3300025912 Ga0207707_10061709 Ga0207707_100617093 179
157 3300025917 Ga0207660_10032599 Ga0207660_100325992 179
158 3300025921 Ga0207652_10105522 Ga0207652_101055222 179
159 3300025932 Ga0207690_10024995 Ga0207690_100249953 179
160 3300025949 Ga0207667_10571415 Ga0207667_105714152 179
161 3300025981 Ga0207640_10043059 Ga0207640_100430592 179
162 3300026116 Ga0207674_10304865 Ga0207674_103048652 179
163 3300046460 Ga0495638_0199017 Ga0495638_0199017_242_781 179
164 3300049568 Ga0501031_0058989 Ga0501031_0058989_765_1310 179
165 3300049569 Ga0501032_0132036 Ga0501032_0132036_187_732 179
166 3300049570 Ga0501033_0080757 Ga0501033_0080757_661_1206 179
167 3300049571 Ga0501034_0100176 Ga0501034_0100176_1786_2331 179
168 3300049572 Ga0501036_0054125 Ga0501036_0054125_1054_1599 179
169 3300049573 Ga0501037_0018261 Ga0501037_0018261_4154_4699 179
170 3300049574 Ga0501038_0013678 Ga0501038_0013678_1180_1725 179
171 3300049575 Ga0501039_0043201 Ga0501039_0043201_376_921 179
172 3300049579 Ga0501043_0043265 Ga0501043_0043265_1436_1981 179
173 3300049581 Ga0501047_0100515 Ga0501047_0100515_1437_1982 179
174 3300049583 Ga0501067_0055594 Ga0501067_0055594_126_671 179
175 3300049586 Ga0501070_0094910 Ga0501070_0094910_154_693 179
176 3300049589 Ga0501073_0010200 Ga0501073_0010200_1421_1966 179
177 3300049742 Ga0501080_0058013 Ga0501080_0058013_1908_2453 179
178 3300049744 Ga0501083_0381802 Ga0501083_0381802_231_776 179
179 3300049823 Ga0501044_0019008 Ga0501044_0019008_1250_1795 179
180 3300049823 Ga0501044_0253694 Ga0501044_0253694_1002_1544 179
181 3300053087 Ga0500643_008577 Ga0500643_008577_856_1395 179
182 3300053088 Ga0500644_0006029 Ga0500644_0006029_271_810 179
183 3300053093 Ga0500651_0025973 Ga0500651_0025973_930_1469 179
184 3300053118 Ga0500594_0094914 Ga0500594_0094914_294_833 179
185 3300053131 Ga0500652_031232 Ga0500652_031232_1370_1909 179
186 3300053153 Ga0500616_0000002 Ga0500616_0000002_1436728_1437267 179
187 3300053730 Ga0500645_001709 Ga0500645_001709_7518_8057 179
188 3300054114 Ga0501084_0034964 Ga0501084_0034964_3254_3799 179
189 3300060353 Ga0501082_0140587 Ga0501082_0140587_1390_1935 179
190 iso_pu_bacteria 2876808645 2876811583 179
191 iso_pu_bacteria 2879110137 2879114203 179
192 3300003659 JGI25404J52841_10000584 JGI25404J52841_100005843 180
193 3300005434 Ga0070709_10059120 Ga0070709_100591202 180
194 3300005437 Ga0070710_10044867 Ga0070710_100448673 180
195 3300005439 Ga0070711_100580049 Ga0070711_1005800492 180
196 3300005535 Ga0070684_100181416 Ga0070684_1001814162 180
197 3300005547 Ga0070693_100026930 Ga0070693_1000269302 180
198 3300005983 Ga0081540_1000300 Ga0081540_100030039 180
199 3300006028 Ga0070717_10446948 Ga0070717_104469482 180
200 3300006871 Ga0075434_100533961 Ga0075434_1005339612 180
201 3300006914 Ga0075436_100050194 Ga0075436_1000501942 180
202 3300013307 Ga0157372_10149209 Ga0157372_101492091 180
203 3300025906 Ga0207699_10513197 Ga0207699_105131971 180
204 3300025913 Ga0207695_10085049 Ga0207695_100850492 180
205 3300025915 Ga0207693_10005987 Ga0207693_100059872 180
206 3300025928 Ga0207700_10300792 Ga0207700_103007922 180
207 3300031241 Ga0265325_10003470 Ga0265325_1000347010 180
208 3300031595 Ga0265313_10000339 Ga0265313_1000033917 180
209 3300031595 Ga0265313_10021913 Ga0265313_100219133 180
210 3300035113 Ga0373936_0017635 Ga0373936_0017635_1699_2244 180
211 3300049823 Ga0501044_0926289 Ga0501044_0926289_14_559 180
212 3300053163 Ga0500639_064371 Ga0500639_064371_489_1034 180
213 3300005530 Ga0070679_100179692 Ga0070679_1001796923 181
214 3300005530 Ga0070679_100208310 Ga0070679_1002083102 181
215 3300005563 Ga0068855_100019111 Ga0068855_1000191113 181
216 3300005563 Ga0068855_100083173 Ga0068855_1000831732 181
217 3300005614 Ga0068856_100170170 Ga0068856_1001701702 181
218 3300005983 Ga0081540_1003666 Ga0081540_10036666 181
219 3300009093 Ga0105240_10167703 Ga0105240_101677032 181
220 3300009093 Ga0105240_10512801 Ga0105240_105128012 181
221 3300013102 Ga0157371_10049586 Ga0157371_100495863 181
222 3300013104 Ga0157370_10133748 Ga0157370_101337482 181
223 3300013105 Ga0157369_10467927 Ga0157369_104679272 181
224 3300013307 Ga0157372_10248177 Ga0157372_102481773 181
225 3300020070 Ga0206356_10393450 Ga0206356_103934503 181
226 3300020081 Ga0206354_10592092 Ga0206354_105920923 181
227 3300020082 Ga0206353_11411820 Ga0206353_114118201 181
228 3300025909 Ga0207705_10012753 Ga0207705_100127536 181
229 3300025909 Ga0207705_10089639 Ga0207705_100896392 181
230 3300025912 Ga0207707_10144776 Ga0207707_101447762 181
231 3300025913 Ga0207695_10085628 Ga0207695_100856283 181
232 3300025913 Ga0207695_10462596 Ga0207695_104625961 181
233 3300025917 Ga0207660_10028935 Ga0207660_100289353 181
234 3300025919 Ga0207657_10433044 Ga0207657_104330442 181
235 3300025921 Ga0207652_10148776 Ga0207652_101487762 181
236 3300025921 Ga0207652_10429951 Ga0207652_104299512 181
237 3300025924 Ga0207694_10040374 Ga0207694_100403742 181
238 3300025944 Ga0207661_10169112 Ga0207661_101691122 181
239 3300025949 Ga0207667_10011279 Ga0207667_1001127912 181
240 3300025949 Ga0207667_10190351 Ga0207667_101903512 181
241 3300026041 Ga0207639_10449083 Ga0207639_104490832 181
242 3300026078 Ga0207702_10428829 Ga0207702_104288292 181
243 3300026142 Ga0207698_10100835 Ga0207698_101008353 181
244 3300045976 Ga0466967_0913982 Ga0466967_0913982_84_638 181
245 3300046455 Ga0495603_0290175 Ga0495603_0290175_107_652 181
246 3300046499 Ga0495594_0245739 Ga0495594_0245739_260_805 181
247 3300046557 Ga0495622_0232462 Ga0495622_0232462_221_766 181
248 3300053131 Ga0500652_000014 Ga0500652_000014_55703_56248 181
249 3300053177 Ga0500636_0010455 Ga0500636_0010455_4121_4666 181
250 3300005336 Ga0070680_100100083 Ga0070680_1001000832 182
251 3300006186 Ga0075369_10005687 Ga0075369_100056874 182
252 3300025917 Ga0207660_10124655 Ga0207660_101246552 182
253 3300035115 Ga0373941_0000158 Ga0373941_0000158_11453_12001 182
254 3300049571 Ga0501034_0149844 Ga0501034_0149844_1680_2228 182
255 3300049581 Ga0501047_0329988 Ga0501047_0329988_413_961 182
256 3300049589 Ga0501073_0153519 Ga0501073_0153519_528_1076 182
257 3300050490 nmdc:mga03n38_106582_c1 nmdc:mga03n38_106582_c1_27_575 182
258 3300050491 nmdc:mga00v17_158597_c1 nmdc:mga00v17_158597_c1_320_868 182
259 3300050492 nmdc:mga0yw44_88044_c1 nmdc:mga0yw44_88044_c1_694_1242 182
260 3300050516 nmdc:mga0sz30_3800_c1 nmdc:mga0sz30_3800_c1_4544_5092 182
261 3300046683 Ga0495658_0065888 Ga0495658_0065888_1147_1701 183
262 3300005436 Ga0070713_100028421 Ga0070713_1000284213 184
263 3300005985 Ga0081539_10107613 Ga0081539_101076132 184
264 3300025898 Ga0207692_10191016 Ga0207692_101910162 184
265 3300025934 Ga0207686_10026691 Ga0207686_100266913 184
266 3300031242 Ga0265329_10060464 Ga0265329_100604642 184
267 3300031250 Ga0265331_10161207 Ga0265331_101612072 184
268 3300035118 Ga0373954_0007693 Ga0373954_0007693_1058_1618 184
269 3300035120 Ga0373957_0006765 Ga0373957_0006765_1621_2175 184
270 3300035120 Ga0373957_0148171 Ga0373957_0148171_367_927 184
271 3300035172 Ga0373955_0001732 Ga0373955_0001732_7982_8542 184
272 3300035410 Ga0373924_0001989 Ga0373924_0001989_2472_3032 184
273 3300035724 Ga0373933_0001526 Ga0373933_0001526_4615_5175 184
274 3300036401 Ga0373937_0002031 Ga0373937_0002031_5209_5769 184
275 3300036401 Ga0373937_0002067 Ga0373937_0002067_10204_10758 184
276 3300046454 Ga0495592_0008608 Ga0495592_0008608_643_1197 184
277 3300046454 Ga0495592_0127634 Ga0495592_0127634_190_750 184
278 3300046462 Ga0495651_0017806 Ga0495651_0017806_1669_2229 184
279 3300046462 Ga0495651_0019768 Ga0495651_0019768_1397_1951 184
280 3300046463 Ga0495653_0033340 Ga0495653_0033340_2286_2840 184
281 3300046477 Ga0495664_0090573 Ga0495664_0090573_665_1219 184
282 3300046511 Ga0495608_0006088 Ga0495608_0006088_1972_2526 184
283 3300046514 Ga0495618_0038863 Ga0495618_0038863_217_771 184
284 3300046516 Ga0495628_0083278 Ga0495628_0083278_1725_2279 184
285 3300046536 Ga0495587_0002925 Ga0495587_0002925_8684_9238 184
286 3300046543 Ga0495645_0003668 Ga0495645_0003668_7153_7707 184
287 3300046559 Ga0495667_0003478 Ga0495667_0003478_9023_9577 184
288 3300046559 Ga0495667_0024428 Ga0495667_0024428_1187_1747 184
289 3300046663 Ga0495635_0017003 Ga0495635_0017003_4243_4797 184
290 3300046675 Ga0495657_0528166 Ga0495657_0528166_59_613 184
291 3300046678 Ga0495599_0027101 Ga0495599_0027101_2400_2954 184
292 3300046679 Ga0495623_0002450 Ga0495623_0002450_6588_7142 184
293 3300046680 Ga0495646_0077527 Ga0495646_0077527_624_1178 184
294 3300046809 Ga0495600_0046747 Ga0495600_0046747_1459_2019 184
295 3300047317 Ga0495604_0009839 Ga0495604_0009839_6035_6589 184
296 3300047319 Ga0495674_0193066 Ga0495674_0193066_329_883 184
297 3300047322 Ga0495680_0037049 Ga0495680_0037049_2401_2955 184
298 3300047444 Ga0495675_0004145 Ga0495675_0004145_1341_1895 184
299 3300047471 Ga0495684_0177225 Ga0495684_0177225_306_860 184
300 3300048088 Ga0495602_0001877 Ga0495602_0001877_6080_6634 184
301 3300048088 Ga0495602_0042715 Ga0495602_0042715_1804_2364 184
302 3300053077 Ga0495601_0001233 Ga0495601_0001233_7124_7684 184
303 3300053077 Ga0495601_0002814 Ga0495601_0002814_8987_9541 184
304 3300053078 Ga0495612_0005171 Ga0495612_0005171_3147_3701 184
305 3300053084 Ga0495595_0005027 Ga0495595_0005027_2133_2693 184
306 3300053085 Ga0495619_0001277 Ga0495619_0001277_14173_14733 184
307 3300053085 Ga0495619_0064410 Ga0495619_0064410_1580_2134 184
308 2209111006 2214947991 2214010752 185
309 3300005327 Ga0070658_10215674 Ga0070658_102156742 185
310 3300005331 Ga0070670_100079424 Ga0070670_1000794242 185
311 3300005335 Ga0070666_10002410 Ga0070666_100024107 185
312 3300005337 Ga0070682_100073868 Ga0070682_1000738683 185
313 3300005339 Ga0070660_100154211 Ga0070660_1001542112 185
314 3300005343 Ga0070687_100053108 Ga0070687_1000531083 185
315 3300005355 Ga0070671_100038169 Ga0070671_1000381694 185
316 3300005356 Ga0070674_100025988 Ga0070674_1000259885 185
317 3300005364 Ga0070673_100006321 Ga0070673_1000063219 185
318 3300005366 Ga0070659_100123426 Ga0070659_1001234262 185
319 3300005367 Ga0070667_100043894 Ga0070667_1000438942 185
320 3300005434 Ga0070709_10001471 Ga0070709_1000147111 185
321 3300005435 Ga0070714_100040278 Ga0070714_1000402781 185
322 3300005436 Ga0070713_100002952 Ga0070713_1000029523 185
323 3300005439 Ga0070711_100049935 Ga0070711_1000499351 185
324 3300005441 Ga0070700_100040752 Ga0070700_1000407523 185
325 3300005466 Ga0070685_10019043 Ga0070685_100190431 185
326 3300005543 Ga0070672_100147749 Ga0070672_1001477493 185
327 3300005544 Ga0070686_100022976 Ga0070686_1000229765 185
328 3300005546 Ga0070696_100211207 Ga0070696_1002112072 185
329 3300005547 Ga0070693_100015849 Ga0070693_1000158495 185
330 3300005548 Ga0070665_100010668 Ga0070665_1000106683 185
331 3300005549 Ga0070704_100089474 Ga0070704_1000894742 185
332 3300005615 Ga0070702_100048785 Ga0070702_1000487853 185
333 3300005618 Ga0068864_100185416 Ga0068864_1001854162 185
334 3300005718 Ga0068866_10013309 Ga0068866_100133093 185
335 3300006028 Ga0070717_10000817 Ga0070717_1000081712 185
336 3300006173 Ga0070716_100000940 Ga0070716_1000009405 185
337 3300006175 Ga0070712_100007317 Ga0070712_1000073174 185
338 3300006237 Ga0097621_100015295 Ga0097621_1000152952 185
339 3300006871 Ga0075434_100155266 Ga0075434_1001552662 185
340 3300006881 Ga0068865_100072868 Ga0068865_1000728682 185
341 3300006914 Ga0075436_100045218 Ga0075436_1000452183 185
342 3300007076 Ga0075435_100069589 Ga0075435_1000695893 185
343 3300009011 Ga0105251_10040178 Ga0105251_100401783 185
344 3300009092 Ga0105250_10031700 Ga0105250_100317003 185
345 3300009098 Ga0105245_10094228 Ga0105245_100942282 185
346 3300009148 Ga0105243_10021264 Ga0105243_100212644 185
347 3300009174 Ga0105241_10044626 Ga0105241_100446263 185
348 3300009176 Ga0105242_10013376 Ga0105242_100133766 185
349 3300009177 Ga0105248_10145238 Ga0105248_101452383 185
350 3300009545 Ga0105237_10042836 Ga0105237_100428364 185
351 3300009551 Ga0105238_10062917 Ga0105238_100629172 185
352 3300009553 Ga0105249_10548336 Ga0105249_105483362 185
353 3300010375 Ga0105239_10081090 Ga0105239_100810904 185
354 3300012492 Ga0157335_1003505 Ga0157335_10035052 185
355 3300012515 Ga0157338_1000838 Ga0157338_10008382 185
356 3300013297 Ga0157378_10041712 Ga0157378_100417123 185
357 3300013306 Ga0163162_10784080 Ga0163162_107840801 185
358 3300013307 Ga0157372_10488699 Ga0157372_104886992 185
359 3300013308 Ga0157375_10130156 Ga0157375_101301563 185
360 3300014325 Ga0163163_10148844 Ga0163163_101488443 185
361 3300014326 Ga0157380_10062937 Ga0157380_100629373 185
362 3300014745 Ga0157377_10456143 Ga0157377_104561432 185
363 3300014968 Ga0157379_10067139 Ga0157379_100671394 185
364 3300014969 Ga0157376_10059328 Ga0157376_100593284 185
365 3300025315 Ga0207697_10110365 Ga0207697_101103652 185
366 3300025735 Ga0207713_1053699 Ga0207713_10536992 185
367 3300025900 Ga0207710_10001206 Ga0207710_1000120615 185
368 3300025903 Ga0207680_10002299 Ga0207680_100022995 185
369 3300025905 Ga0207685_10000115 Ga0207685_1000011511 185
370 3300025906 Ga0207699_10004298 Ga0207699_100042987 185
371 3300025907 Ga0207645_10020372 Ga0207645_100203723 185
372 3300025909 Ga0207705_10103307 Ga0207705_101033072 185
373 3300025911 Ga0207654_10055084 Ga0207654_100550842 185
374 3300025914 Ga0207671_10052959 Ga0207671_100529593 185
375 3300025915 Ga0207693_10061659 Ga0207693_100616592 185
376 3300025916 Ga0207663_10137758 Ga0207663_101377582 185
377 3300025919 Ga0207657_10016100 Ga0207657_100161007 185
378 3300025920 Ga0207649_10034482 Ga0207649_100344821 185
379 3300025925 Ga0207650_10022817 Ga0207650_100228174 185
380 3300025927 Ga0207687_10003698 Ga0207687_100036982 185
381 3300025928 Ga0207700_10000623 Ga0207700_1000062316 185
382 3300025929 Ga0207664_10011407 Ga0207664_100114072 185
383 3300025932 Ga0207690_10168826 Ga0207690_101688262 185
384 3300025934 Ga0207686_10060525 Ga0207686_100605252 185
385 3300025936 Ga0207670_10063991 Ga0207670_100639913 185
386 3300025938 Ga0207704_10041140 Ga0207704_100411403 185
387 3300025939 Ga0207665_10001669 Ga0207665_100016695 185
388 3300025941 Ga0207711_10005790 Ga0207711_100057904 185
389 3300025944 Ga0207661_10022549 Ga0207661_100225492 185
390 3300025945 Ga0207679_10098699 Ga0207679_100986993 185
391 3300025960 Ga0207651_10021074 Ga0207651_100210742 185
392 3300025986 Ga0207658_10016873 Ga0207658_100168733 185
393 3300026035 Ga0207703_10007095 Ga0207703_100070953 185
394 3300026067 Ga0207678_10030649 Ga0207678_100306495 185
395 3300026088 Ga0207641_10076926 Ga0207641_100769263 185
396 3300026095 Ga0207676_10003269 Ga0207676_1000326911 185
397 3300026118 Ga0207675_100029099 Ga0207675_1000290994 185
398 3300026121 Ga0207683_10003304 Ga0207683_1000330410 185
399 3300027907 Ga0207428_10074757 Ga0207428_100747573 185
400 3300028379 Ga0268266_10004404 Ga0268266_100044042 185
401 3300034818 Ga0373950_0006370 Ga0373950_0006370_936_1493 185
402 3300035084 Ga0373928_0002249 Ga0373928_0002249_273_830 185
403 3300035085 Ga0373929_0004239 Ga0373929_0004239_885_1442 185
404 3300035091 Ga0373951_0014794 Ga0373951_0014794_64_621 185
405 3300035114 Ga0373939_0003623 Ga0373939_0003623_1519_2076 185
406 3300035115 Ga0373941_0000578 Ga0373941_0000578_4406_4963 185
407 3300035116 Ga0373945_0057819 Ga0373945_0057819_305_862 185
408 3300035121 Ga0373960_0011114 Ga0373960_0011114_185_742 185
409 3300035170 Ga0373943_0006929 Ga0373943_0006929_4109_4666 185
410 3300035171 Ga0373946_0078451 Ga0373946_0078451_70_627 185
411 3300035207 Ga0373942_0013172 Ga0373942_0013172_1379_1936 185
412 3300035242 Ga0373962_0003681 Ga0373962_0003681_2034_2591 185
413 3300035691 Ga0373931_0012190 Ga0373931_0012190_1391_1948 185
414 3300035692 Ga0373935_0024245 Ga0373935_0024245_2892_3449 185
415 3300035695 Ga0373927_0043102 Ga0373927_0043102_1875_2432 185
416 3300035725 Ga0373947_0021848 Ga0373947_0021848_55_612 185
417 3300037068 Ga0373925_0004333 Ga0373925_0004333_6121_6678 185
418 3300046455 Ga0495603_0003171 Ga0495603_0003171_2910_3467 185
419 3300046459 Ga0495629_0000026 Ga0495629_0000026_108580_109137 185
420 3300046473 Ga0495582_0012086 Ga0495582_0012086_1440_1997 185
421 3300046664 Ga0495659_0074144 Ga0495659_0074144_296_856 185
422 3300046681 Ga0495647_0013379 Ga0495647_0013379_38_595 185
423 3300046683 Ga0495658_0001690 Ga0495658_0001690_10529_11086 185
424 3300046689 Ga0495613_0003849 Ga0495613_0003849_3929_4486 185
425 3300047315 Ga0495581_0021568 Ga0495581_0021568_1493_2050 185
426 3300047322 Ga0495680_0029843 Ga0495680_0029843_3544_4101 185
427 3300047673 Ga0495593_0013909 Ga0495593_0013909_3532_4089 185
428 3300048903 Ga0496100_0005905 Ga0496100_0005905_3251_3808 185
429 3300048904 Ga0496101_0214951 Ga0496101_0214951_267_824 185
430 3300048907 Ga0496104_0089492 Ga0496104_0089492_2351_2908 185
431 3300048908 Ga0496105_0024612 Ga0496105_0024612_2381_2938 185
432 3300048910 Ga0496107_0095025 Ga0496107_0095025_1379_1936 185
433 3300048911 Ga0496108_0110460 Ga0496108_0110460_1761_2318 185
434 3300048914 Ga0496111_0016164 Ga0496111_0016164_1271_1828 185
435 3300048915 Ga0496112_0002087 Ga0496112_0002087_9442_9999 185
436 3300048917 Ga0496114_0099648 Ga0496114_0099648_267_824 185
437 3300048918 Ga0496115_0008142 Ga0496115_0008142_3251_3808 185
438 3300048918 Ga0496115_0241224 Ga0496115_0241224_99_656 185
439 3300049571 Ga0501034_0043434 Ga0501034_0043434_2863_3423 185
440 3300049581 Ga0501047_0862225 Ga0501047_0862225_108_668 185
441 3300049585 Ga0501069_0246816 Ga0501069_0246816_334_894 185
442 3300049586 Ga0501070_0210572 Ga0501070_0210572_334_894 185
443 3300049590 Ga0501074_0120925 Ga0501074_0120925_468_1028 185
444 3300050511 nmdc:mga08y16_182951_c1 nmdc:mga08y16_182951_c1_806_1363 185
445 3300050512 nmdc:mga0n895_217761_c1 nmdc:mga0n895_217761_c1_139_696 185
446 3300050514 nmdc:mga08x19_22982_c1 nmdc:mga08x19_22982_c1_2096_2653 185
447 3300050515 nmdc:mga0a205_438984_c1 nmdc:mga0a205_438984_c1_16_573 185
448 3300053085 Ga0495619_0000360 Ga0495619_0000360_15446_16003 185
449 3300060353 Ga0501082_0828045 Ga0501082_0828045_225_785 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

58

117

0.97

PF01047

MarR

MarR family

61

117

0.95

PF13463

HTH_27

Winged helix DNA-binding domain

60

126

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9174 61 121
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9165 61 120
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.9012 61 120
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.888 61 121
3bp8-assembly2.cif.gz_B crystal structure of mlc/eiib complex 0.8788 62 121
ID Description Score Start End Superfamily
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9261 58 134 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9174 61 121 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.907 58 119 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9028 63 130 1.10.10.10
4ijaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9025 61 121 1.10.10.10
ID Description Score Start End GO Terms
AF-B7VP73-F1-model_v4 Transcriptional regulator 0.915 50 161 GO:0003677
GO:0003700
AF-B4RBE8-F1-model_v4 Transcriptional regulator, MarR family 0.9143 50 161 GO:0003677
GO:0003700
AF-W7C2K5-F1-model_v4 deleted 0.9102 50 169
AF-A0A1H5Z1A7-F1-model_v4 DNA-binding transcriptional regulator, MarR family 0.8989 51 160 GO:0003677
GO:0003700
GO:0006950
AF-A0A7C5N3D8-F1-model_v4 MarR family transcriptional regulator 0.8939 51 158 GO:0003700
GO:0006950

Feature Viewer

pLDDT pTM Quality
83.66 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map