F446343
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 449 | 288 | 446 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10107613|Ga0081539_101076132 |
| Length | 187 |
| Sequence | MADINYKVPVKLTPLPERSANLRAAGVETADFQWEIIELLFFAYRDFVGDADAVLQEFGFGRAHHRVMHFVSRYPGLKVADLLEVLRITKQSLGRVLKQLIDEGYIVQRSGDNDKRQRLLFATAKGEALVTKLAGLQTKRIAHALKGVTEADNNAVRSFLRHMIDLNEPDKVLQAVMGSSGTARGSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 3 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 4 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 69 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 137 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 143 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 145 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 146 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 147 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 150 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 154 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 160 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 164 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 171 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 172 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 173 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 174 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 226 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 227 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 228 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 229 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 230 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 257 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 258 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 270 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 271 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 273 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 274 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 275 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 276 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 277 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 278 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 279 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 280 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 281 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 282 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 283 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 285 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 286 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 287 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.66 |
| Metatranscriptomes | 0.67 |
| Isolates | 0.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.01 |
| Nodule | 0.22 |
| Rhizoplane | 2.9 |
| Rhizosphere | 89.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214947991 | 2209111006 | Bacteria | 1288 |
| 2 | JGI25404J52841_10000584 | 3300003659 | Bacteria | 5438 |
| 3 | Ga0070658_10215674 | 3300005327 | Bacteria | 1622 |
| 4 | Ga0070670_100079424 | 3300005331 | Bacteria | 2819 |
| 5 | Ga0070666_10002410 | 3300005335 | Bacteria | 11315 |
| 6 | Ga0070680_100071048 | 3300005336 | Bacteria | 2860 |
| 7 | Ga0070680_100100083 | 3300005336 | Bacteria | 2406 |
| 8 | Ga0070682_100073753 | 3300005337 | Bacteria | 2190 |
| 9 | Ga0070682_100073868 | 3300005337 | Bacteria | 2189 |
| 10 | Ga0070660_100154211 | 3300005339 | Bacteria | 1848 |
| 11 | Ga0070687_100053108 | 3300005343 | Bacteria | 2106 |
| 12 | Ga0070671_100038169 | 3300005355 | Bacteria | 3987 |
| 13 | Ga0070674_100025988 | 3300005356 | Bacteria | 3819 |
| 14 | Ga0070673_100006321 | 3300005364 | Bacteria | 7693 |
| 15 | Ga0070659_100040357 | 3300005366 | Bacteria | 3647 |
| 16 | Ga0070659_100123426 | 3300005366 | Bacteria | 2100 |
| 17 | Ga0070667_100043894 | 3300005367 | Bacteria | 3752 |
| 18 | Ga0070709_10001471 | 3300005434 | Bacteria | 12718 |
| 19 | Ga0070709_10059120 | 3300005434 | Bacteria | 2433 |
| 20 | Ga0070709_10066581 | 3300005434 | Bacteria | 2311 |
| 21 | Ga0070714_100040278 | 3300005435 | Bacteria | 3938 |
| 22 | Ga0070714_100679158 | 3300005435 | Bacteria | 993 |
| 23 | Ga0070713_100002952 | 3300005436 | Bacteria | 11156 |
| 24 | Ga0070713_100028421 | 3300005436 | Bacteria | 4415 |
| 25 | Ga0070713_100546366 | 3300005436 | Bacteria | 1096 |
| 26 | Ga0070710_10011524 | 3300005437 | Bacteria | 4370 |
| 27 | Ga0070710_10044867 | 3300005437 | Bacteria | 2454 |
| 28 | Ga0070711_100030176 | 3300005439 | Bacteria | 3587 |
| 29 | Ga0070711_100049935 | 3300005439 | Bacteria | 2866 |
| 30 | Ga0070711_100580049 | 3300005439 | Bacteria | 933 |
| 31 | Ga0070700_100040752 | 3300005441 | Bacteria | 2845 |
| 32 | Ga0070681_10090943 | 3300005458 | Bacteria | 3002 |
| 33 | Ga0070685_10019043 | 3300005466 | Bacteria | 3700 |
| 34 | Ga0070679_100052373 | 3300005530 | Bacteria | 4066 |
| 35 | Ga0070679_100054373 | 3300005530 | Bacteria | 3985 |
| 36 | Ga0070679_100179692 | 3300005530 | Bacteria | 2088 |
| 37 | Ga0070679_100208310 | 3300005530 | Bacteria | 1919 |
| 38 | Ga0070684_100181416 | 3300005535 | Bacteria | 1914 |
| 39 | Ga0068853_100027296 | 3300005539 | Bacteria | 4796 |
| 40 | Ga0068853_100500600 | 3300005539 | Bacteria | 1147 |
| 41 | Ga0070672_100147749 | 3300005543 | Bacteria | 1943 |
| 42 | Ga0070686_100022976 | 3300005544 | Bacteria | 3721 |
| 43 | Ga0070696_100211207 | 3300005546 | Bacteria | 1453 |
| 44 | Ga0070693_100015849 | 3300005547 | Bacteria | 3889 |
| 45 | Ga0070693_100026930 | 3300005547 | Bacteria | 3108 |
| 46 | Ga0070665_100010668 | 3300005548 | Bacteria | 9301 |
| 47 | Ga0070704_100089474 | 3300005549 | Bacteria | 2290 |
| 48 | Ga0068855_100019111 | 3300005563 | Bacteria | 8234 |
| 49 | Ga0068855_100083173 | 3300005563 | Bacteria | 3708 |
| 50 | Ga0068855_100300499 | 3300005563 | Bacteria | 1778 |
| 51 | Ga0070664_100199114 | 3300005564 | Bacteria | 1787 |
| 52 | Ga0068857_100306682 | 3300005577 | Bacteria | 1464 |
| 53 | Ga0068854_100173590 | 3300005578 | Bacteria | 1679 |
| 54 | Ga0068856_100170170 | 3300005614 | Bacteria | 2190 |
| 55 | Ga0068856_100191413 | 3300005614 | Bacteria | 2059 |
| 56 | Ga0070702_100048785 | 3300005615 | Bacteria | 2412 |
| 57 | Ga0068864_100185416 | 3300005618 | Bacteria | 1904 |
| 58 | Ga0068866_10013309 | 3300005718 | Bacteria | 3607 |
| 59 | Ga0081540_1000300 | 3300005983 | Bacteria | 51023 |
| 60 | Ga0081540_1003666 | 3300005983 | Bacteria | 12045 |
| 61 | Ga0081540_1110692 | 3300005983 | Bacteria | 1161 |
| 62 | Ga0081539_10107613 | 3300005985 | Bacteria | 1410 |
| 63 | Ga0070717_10000817 | 3300006028 | Bacteria | 20525 |
| 64 | Ga0070717_10446948 | 3300006028 | Bacteria | 1165 |
| 65 | Ga0070717_10628179 | 3300006028 | Bacteria | 975 |
| 66 | Ga0070716_100000940 | 3300006173 | Bacteria | 12603 |
| 67 | Ga0070716_100302855 | 3300006173 | Bacteria | 1113 |
| 68 | Ga0070712_100007317 | 3300006175 | Bacteria | 6890 |
| 69 | Ga0070712_100108523 | 3300006175 | Bacteria | 2067 |
| 70 | Ga0075369_10005687 | 3300006186 | Bacteria | 4675 |
| 71 | Ga0097621_100015295 | 3300006237 | Bacteria | 5770 |
| 72 | Ga0075428_100538933 | 3300006844 | Bacteria | 1248 |
| 73 | Ga0075434_100155266 | 3300006871 | Bacteria | 2308 |
| 74 | Ga0075434_100533961 | 3300006871 | Bacteria | 1193 |
| 75 | Ga0068865_100072868 | 3300006881 | Bacteria | 2441 |
| 76 | Ga0075436_100045218 | 3300006914 | Bacteria | 3036 |
| 77 | Ga0075436_100050194 | 3300006914 | Bacteria | 2878 |
| 78 | Ga0075435_100069589 | 3300007076 | Bacteria | 2870 |
| 79 | Ga0105251_10040178 | 3300009011 | Bacteria | 2281 |
| 80 | Ga0105250_10031700 | 3300009092 | Bacteria | 2122 |
| 81 | Ga0105240_10080101 | 3300009093 | Bacteria | 4017 |
| 82 | Ga0105240_10167703 | 3300009093 | Bacteria | 2603 |
| 83 | Ga0105240_10512801 | 3300009093 | Bacteria | 1332 |
| 84 | Ga0105245_10094228 | 3300009098 | Bacteria | 2760 |
| 85 | Ga0114129_10014260 | 3300009147 | Bacteria | 11325 |
| 86 | Ga0114129_10311945 | 3300009147 | Bacteria | 2093 |
| 87 | Ga0105243_10021264 | 3300009148 | Bacteria | 4924 |
| 88 | Ga0105241_10044626 | 3300009174 | Bacteria | 3359 |
| 89 | Ga0105242_10013376 | 3300009176 | Bacteria | 6339 |
| 90 | Ga0105248_10145238 | 3300009177 | Bacteria | 2677 |
| 91 | Ga0105237_10042836 | 3300009545 | Bacteria | 4562 |
| 92 | Ga0105238_10025592 | 3300009551 | Bacteria | 6016 |
| 93 | Ga0105238_10062917 | 3300009551 | Bacteria | 3711 |
| 94 | Ga0105238_11151427 | 3300009551 | Bacteria | 799 |
| 95 | Ga0105249_10548336 | 3300009553 | Bacteria | 1206 |
| 96 | Ga0105239_10081090 | 3300010375 | Bacteria | 3571 |
| 97 | Ga0157335_1003505 | 3300012492 | Bacteria | 1012 |
| 98 | Ga0157338_1000838 | 3300012515 | Bacteria | 2004 |
| 99 | Ga0157373_10060338 | 3300013100 | Bacteria | 2688 |
| 100 | Ga0157371_10049586 | 3300013102 | Bacteria | 2982 |
| 101 | Ga0157370_10133748 | 3300013104 | Bacteria | 2313 |
| 102 | Ga0157370_10319061 | 3300013104 | Bacteria | 1433 |
| 103 | Ga0157369_10187647 | 3300013105 | Bacteria | 2173 |
| 104 | Ga0157369_10467927 | 3300013105 | Bacteria | 1305 |
| 105 | Ga0157378_10041712 | 3300013297 | Bacteria | 4071 |
| 106 | Ga0163162_10784080 | 3300013306 | Bacteria | 1071 |
| 107 | Ga0157372_10149209 | 3300013307 | Bacteria | 2697 |
| 108 | Ga0157372_10248177 | 3300013307 | Bacteria | 2066 |
| 109 | Ga0157372_10488699 | 3300013307 | Bacteria | 1435 |
| 110 | Ga0157375_10130156 | 3300013308 | Bacteria | 2635 |
| 111 | Ga0163163_10148844 | 3300014325 | Bacteria | 2385 |
| 112 | Ga0157380_10062937 | 3300014326 | Bacteria | 2974 |
| 113 | Ga0157377_10456143 | 3300014745 | Unclassified | 884 |
| 114 | Ga0157379_10067139 | 3300014968 | Bacteria | 3206 |
| 115 | Ga0157376_10059328 | 3300014969 | Bacteria | 3208 |
| 116 | Ga0206356_10393450 | 3300020070 | Bacteria | 2281 |
| 117 | Ga0206354_10592092 | 3300020081 | Bacteria | 1781 |
| 118 | Ga0206353_11411820 | 3300020082 | Bacteria | 1936 |
| 119 | Ga0207697_10110365 | 3300025315 | Bacteria | 1177 |
| 120 | Ga0207713_1053699 | 3300025735 | Bacteria | 1585 |
| 121 | Ga0207692_10160874 | 3300025898 | Bacteria | 1294 |
| 122 | Ga0207692_10191016 | 3300025898 | Bacteria | 1198 |
| 123 | Ga0207710_10001206 | 3300025900 | Bacteria | 13122 |
| 124 | Ga0207688_10243486 | 3300025901 | Bacteria | 1088 |
| 125 | Ga0207680_10002299 | 3300025903 | Bacteria | 8909 |
| 126 | Ga0207685_10000115 | 3300025905 | Bacteria | 12186 |
| 127 | Ga0207699_10004298 | 3300025906 | Bacteria | 6812 |
| 128 | Ga0207699_10513197 | 3300025906 | Bacteria | 866 |
| 129 | Ga0207645_10020372 | 3300025907 | Bacteria | 4341 |
| 130 | Ga0207705_10012753 | 3300025909 | Bacteria | 6064 |
| 131 | Ga0207705_10089639 | 3300025909 | Bacteria | 2251 |
| 132 | Ga0207705_10103307 | 3300025909 | Bacteria | 2099 |
| 133 | Ga0207654_10055084 | 3300025911 | Bacteria | 2301 |
| 134 | Ga0207707_10061709 | 3300025912 | Bacteria | 3262 |
| 135 | Ga0207707_10144776 | 3300025912 | Bacteria | 2077 |
| 136 | Ga0207707_10381115 | 3300025912 | Bacteria | 1212 |
| 137 | Ga0207707_10611907 | 3300025912 | Bacteria | 921 |
| 138 | Ga0207695_10085049 | 3300025913 | Bacteria | 3192 |
| 139 | Ga0207695_10085628 | 3300025913 | Bacteria | 3180 |
| 140 | Ga0207695_10462596 | 3300025913 | Bacteria | 1151 |
| 141 | Ga0207671_10052959 | 3300025914 | Bacteria | 3008 |
| 142 | Ga0207693_10005987 | 3300025915 | Bacteria | 10083 |
| 143 | Ga0207693_10061659 | 3300025915 | Bacteria | 2937 |
| 144 | Ga0207693_10115635 | 3300025915 | Bacteria | 2106 |
| 145 | Ga0207663_10137758 | 3300025916 | Bacteria | 1696 |
| 146 | Ga0207660_10028935 | 3300025917 | Bacteria | 3796 |
| 147 | Ga0207660_10032599 | 3300025917 | Bacteria | 3597 |
| 148 | Ga0207660_10124655 | 3300025917 | Bacteria | 1955 |
| 149 | Ga0207657_10016100 | 3300025919 | Bacteria | 7218 |
| 150 | Ga0207657_10433044 | 3300025919 | Bacteria | 1033 |
| 151 | Ga0207649_10034482 | 3300025920 | Bacteria | 3033 |
| 152 | Ga0207652_10105522 | 3300025921 | Bacteria | 2493 |
| 153 | Ga0207652_10148776 | 3300025921 | Bacteria | 2096 |
| 154 | Ga0207652_10429951 | 3300025921 | Bacteria | 1191 |
| 155 | Ga0207694_10040374 | 3300025924 | Bacteria | 3592 |
| 156 | Ga0207650_10022817 | 3300025925 | Bacteria | 4434 |
| 157 | Ga0207687_10003698 | 3300025927 | Bacteria | 10296 |
| 158 | Ga0207700_10000623 | 3300025928 | Bacteria | 20712 |
| 159 | Ga0207700_10300792 | 3300025928 | Bacteria | 1385 |
| 160 | Ga0207664_10011407 | 3300025929 | Bacteria | 6315 |
| 161 | Ga0207690_10024995 | 3300025932 | Bacteria | 3746 |
| 162 | Ga0207690_10168826 | 3300025932 | Bacteria | 1637 |
| 163 | Ga0207686_10026691 | 3300025934 | Bacteria | 3372 |
| 164 | Ga0207686_10060525 | 3300025934 | Bacteria | 2397 |
| 165 | Ga0207670_10063991 | 3300025936 | Bacteria | 2519 |
| 166 | Ga0207704_10041140 | 3300025938 | Bacteria | 2707 |
| 167 | Ga0207665_10001669 | 3300025939 | Bacteria | 14935 |
| 168 | Ga0207665_10137703 | 3300025939 | Bacteria | 1738 |
| 169 | Ga0207711_10005790 | 3300025941 | Bacteria | 10441 |
| 170 | Ga0207661_10022549 | 3300025944 | Bacteria | 4745 |
| 171 | Ga0207661_10169112 | 3300025944 | Bacteria | 1902 |
| 172 | Ga0207679_10098699 | 3300025945 | Bacteria | 2278 |
| 173 | Ga0207667_10011279 | 3300025949 | Bacteria | 10393 |
| 174 | Ga0207667_10190351 | 3300025949 | Bacteria | 2105 |
| 175 | Ga0207667_10571415 | 3300025949 | Bacteria | 1142 |
| 176 | Ga0207651_10021074 | 3300025960 | Bacteria | 3951 |
| 177 | Ga0207640_10043059 | 3300025981 | Bacteria | 2883 |
| 178 | Ga0207658_10016873 | 3300025986 | Bacteria | 5025 |
| 179 | Ga0207703_10007095 | 3300026035 | Bacteria | 8913 |
| 180 | Ga0207639_10449083 | 3300026041 | Bacteria | 1170 |
| 181 | Ga0207678_10030649 | 3300026067 | Bacteria | 4695 |
| 182 | Ga0207708_10704154 | 3300026075 | Bacteria | 864 |
| 183 | Ga0207702_10428829 | 3300026078 | Bacteria | 1280 |
| 184 | Ga0207641_10076926 | 3300026088 | Bacteria | 2886 |
| 185 | Ga0207676_10003269 | 3300026095 | Bacteria | 11531 |
| 186 | Ga0207674_10304865 | 3300026116 | Bacteria | 1542 |
| 187 | Ga0207675_100029099 | 3300026118 | Bacteria | 5148 |
| 188 | Ga0207683_10003304 | 3300026121 | Bacteria | 14057 |
| 189 | Ga0207698_10100835 | 3300026142 | Bacteria | 2393 |
| 190 | Ga0207428_10074757 | 3300027907 | Bacteria | 2657 |
| 191 | Ga0268266_10004404 | 3300028379 | Bacteria | 13495 |
| 192 | Ga0265325_10003470 | 3300031241 | Bacteria | 10281 |
| 193 | Ga0265329_10060464 | 3300031242 | Bacteria | 1200 |
| 194 | Ga0265331_10161207 | 3300031250 | Bacteria | 1016 |
| 195 | Ga0265313_10000339 | 3300031595 | Bacteria | 50809 |
| 196 | Ga0265313_10021913 | 3300031595 | Bacteria | 3482 |
| 197 | Ga0307413_10736260 | 3300031824 | Bacteria | 823 |
| 198 | Ga0307416_102745062 | 3300032002 | Bacteria | 589 |
| 199 | Ga0316583_10000116 | 3300032133 | Bacteria | 18613 |
| 200 | Ga0373950_0002390 | 3300034818 | Bacteria | 2579 |
| 201 | Ga0373950_0006370 | 3300034818 | Bacteria | 1797 |
| 202 | Ga0373950_0043011 | 3300034818 | Bacteria | 870 |
| 203 | Ga0373926_0094992 | 3300035083 | Bacteria | 1111 |
| 204 | Ga0373928_0002249 | 3300035084 | Bacteria | 3762 |
| 205 | Ga0373929_0004239 | 3300035085 | Bacteria | 2571 |
| 206 | Ga0373951_0014794 | 3300035091 | Bacteria | 1755 |
| 207 | Ga0373936_0017635 | 3300035113 | Bacteria | 2751 |
| 208 | Ga0373939_0003623 | 3300035114 | Bacteria | 3630 |
| 209 | Ga0373941_0000158 | 3300035115 | Bacteria | 12249 |
| 210 | Ga0373941_0000578 | 3300035115 | Bacteria | 7374 |
| 211 | Ga0373941_0002027 | 3300035115 | Bacteria | 4386 |
| 212 | Ga0373945_0057819 | 3300035116 | Bacteria | 1441 |
| 213 | Ga0373945_0072867 | 3300035116 | Bacteria | 1303 |
| 214 | Ga0373954_0007693 | 3300035118 | Bacteria | 4716 |
| 215 | Ga0373957_0006765 | 3300035120 | Bacteria | 3630 |
| 216 | Ga0373957_0148171 | 3300035120 | Bacteria | 962 |
| 217 | Ga0373960_0011114 | 3300035121 | Bacteria | 2211 |
| 218 | Ga0373943_0006929 | 3300035170 | Bacteria | 5085 |
| 219 | Ga0373943_0051051 | 3300035170 | Bacteria | 2035 |
| 220 | Ga0373946_0044708 | 3300035171 | Bacteria | 1829 |
| 221 | Ga0373946_0078451 | 3300035171 | Bacteria | 1441 |
| 222 | Ga0373955_0001732 | 3300035172 | Bacteria | 9348 |
| 223 | Ga0373942_0013172 | 3300035207 | Bacteria | 1984 |
| 224 | Ga0373962_0003681 | 3300035242 | Bacteria | 3687 |
| 225 | Ga0373924_0001989 | 3300035410 | Bacteria | 6797 |
| 226 | Ga0373931_0012190 | 3300035691 | Bacteria | 4162 |
| 227 | Ga0373935_0024245 | 3300035692 | Bacteria | 3733 |
| 228 | Ga0373935_0273697 | 3300035692 | Bacteria | 1187 |
| 229 | Ga0373927_0043102 | 3300035695 | Bacteria | 2922 |
| 230 | Ga0373927_0055814 | 3300035695 | Bacteria | 2553 |
| 231 | Ga0373933_0001526 | 3300035724 | Bacteria | 13510 |
| 232 | Ga0373947_0021848 | 3300035725 | Bacteria | 3707 |
| 233 | Ga0373947_0046913 | 3300035725 | Bacteria | 2588 |
| 234 | Ga0373947_0148526 | 3300035725 | Bacteria | 1508 |
| 235 | Ga0373937_0002031 | 3300036401 | Bacteria | 16910 |
| 236 | Ga0373937_0002067 | 3300036401 | Bacteria | 16792 |
| 237 | Ga0373937_0883871 | 3300036401 | Bacteria | 842 |
| 238 | Ga0373925_0004333 | 3300037068 | Bacteria | 10734 |
| 239 | Ga0373925_0012148 | 3300037068 | Bacteria | 6233 |
| 240 | Ga0436365_1703855 | 3300039437 | Bacteria | 2415 |
| 241 | Ga0451800_0199826 | 3300041459 | Bacteria | 880 |
| 242 | Ga0451807_2758769 | 3300041486 | Bacteria | 1419 |
| 243 | Ga0466964_0099894 | 3300044706 | Bacteria | 1278 |
| 244 | Ga0451576_0350944 | 3300045051 | Bacteria | 1545 |
| 245 | Ga0466967_0913982 | 3300045976 | Bacteria | 873 |
| 246 | Ga0495592_0008608 | 3300046454 | Bacteria | 7657 |
| 247 | Ga0495592_0127634 | 3300046454 | Bacteria | 1782 |
| 248 | Ga0495603_0003171 | 3300046455 | Bacteria | 9777 |
| 249 | Ga0495603_0087082 | 3300046455 | Bacteria | 1828 |
| 250 | Ga0495603_0290175 | 3300046455 | Bacteria | 940 |
| 251 | Ga0495603_0434810 | 3300046455 | Bacteria | 752 |
| 252 | Ga0495603_0737542 | 3300046455 | Bacteria | 563 |
| 253 | Ga0495629_0000026 | 3300046459 | Bacteria | 134719 |
| 254 | Ga0495638_0199017 | 3300046460 | Bacteria | 1132 |
| 255 | Ga0495651_0017806 | 3300046462 | Bacteria | 5501 |
| 256 | Ga0495651_0019768 | 3300046462 | Bacteria | 5221 |
| 257 | Ga0495653_0033340 | 3300046463 | Bacteria | 4081 |
| 258 | Ga0495580_0094714 | 3300046472 | Bacteria | 2077 |
| 259 | Ga0495582_0011256 | 3300046473 | Bacteria | 4929 |
| 260 | Ga0495582_0012086 | 3300046473 | Bacteria | 4757 |
| 261 | Ga0495662_0034280 | 3300046476 | Bacteria | 2451 |
| 262 | Ga0495664_0090573 | 3300046477 | Bacteria | 1839 |
| 263 | Ga0495594_0245739 | 3300046499 | Bacteria | 1020 |
| 264 | Ga0495608_0006088 | 3300046511 | Bacteria | 8560 |
| 265 | Ga0495610_0107244 | 3300046512 | Bacteria | 1242 |
| 266 | Ga0495618_0038863 | 3300046514 | Bacteria | 2991 |
| 267 | Ga0495628_0083278 | 3300046516 | Bacteria | 2483 |
| 268 | Ga0495630_0113926 | 3300046517 | Bacteria | 2049 |
| 269 | Ga0495666_0163198 | 3300046526 | Bacteria | 1032 |
| 270 | Ga0495640_0009022 | 3300046533 | Bacteria | 7784 |
| 271 | Ga0495587_0002925 | 3300046536 | Bacteria | 11432 |
| 272 | Ga0495645_0003668 | 3300046543 | Bacteria | 10430 |
| 273 | Ga0495622_0232462 | 3300046557 | Unclassified | 814 |
| 274 | Ga0495667_0003478 | 3300046559 | Bacteria | 10553 |
| 275 | Ga0495667_0024428 | 3300046559 | Bacteria | 4069 |
| 276 | Ga0495634_0013379 | 3300046642 | Bacteria | 5929 |
| 277 | Ga0495635_0017003 | 3300046663 | Bacteria | 5079 |
| 278 | Ga0495659_0074144 | 3300046664 | Bacteria | 1280 |
| 279 | Ga0495657_0528166 | 3300046675 | Bacteria | 686 |
| 280 | Ga0495599_0027101 | 3300046678 | Bacteria | 3591 |
| 281 | Ga0495623_0002450 | 3300046679 | Bacteria | 12303 |
| 282 | Ga0495646_0077527 | 3300046680 | Bacteria | 1943 |
| 283 | Ga0495647_0013379 | 3300046681 | Bacteria | 2842 |
| 284 | Ga0495658_0001690 | 3300046683 | Bacteria | 11479 |
| 285 | Ga0495658_0020110 | 3300046683 | Bacteria | 3497 |
| 286 | Ga0495658_0065888 | 3300046683 | Bacteria | 2091 |
| 287 | Ga0495613_0003849 | 3300046689 | Bacteria | 11230 |
| 288 | Ga0495613_0373189 | 3300046689 | Bacteria | 977 |
| 289 | Ga0495600_0046747 | 3300046809 | Bacteria | 2823 |
| 290 | Ga0495581_0021568 | 3300047315 | Bacteria | 3732 |
| 291 | Ga0495604_0009839 | 3300047317 | Bacteria | 7565 |
| 292 | Ga0495674_0045526 | 3300047319 | Bacteria | 3896 |
| 293 | Ga0495674_0193066 | 3300047319 | Bacteria | 1691 |
| 294 | Ga0495676_0365062 | 3300047321 | Bacteria | 963 |
| 295 | Ga0495680_0029843 | 3300047322 | Bacteria | 4461 |
| 296 | Ga0495680_0037049 | 3300047322 | Bacteria | 3909 |
| 297 | Ga0495675_0004145 | 3300047444 | Bacteria | 8773 |
| 298 | Ga0495684_0177225 | 3300047471 | Bacteria | 1582 |
| 299 | Ga0495686_0425400 | 3300047472 | Bacteria | 709 |
| 300 | Ga0495593_0013909 | 3300047673 | Bacteria | 4584 |
| 301 | Ga0495602_0001877 | 3300048088 | Bacteria | 21025 |
| 302 | Ga0495602_0042715 | 3300048088 | Bacteria | 4128 |
| 303 | Ga0496100_0005905 | 3300048903 | Bacteria | 6633 |
| 304 | Ga0496101_0214951 | 3300048904 | Bacteria | 1490 |
| 305 | Ga0496104_0089492 | 3300048907 | Bacteria | 2940 |
| 306 | Ga0496105_0024612 | 3300048908 | Bacteria | 4892 |
| 307 | Ga0496107_0095025 | 3300048910 | Bacteria | 2180 |
| 308 | Ga0496108_0110460 | 3300048911 | Bacteria | 2350 |
| 309 | Ga0496111_0016164 | 3300048914 | Bacteria | 5139 |
| 310 | Ga0496112_0002087 | 3300048915 | Bacteria | 15846 |
| 311 | Ga0496114_0099648 | 3300048917 | Bacteria | 2478 |
| 312 | Ga0496115_0008142 | 3300048918 | Bacteria | 7744 |
| 313 | Ga0496115_0241224 | 3300048918 | Bacteria | 1489 |
| 314 | Ga0496121_0267820 | 3300048924 | Bacteria | 1176 |
| 315 | Ga0496123_0196919 | 3300048926 | Bacteria | 1037 |
| 316 | Ga0496126_0012254 | 3300048929 | Bacteria | 8796 |
| 317 | Ga0501031_0058989 | 3300049568 | Bacteria | 2501 |
| 318 | Ga0501032_0018667 | 3300049569 | Bacteria | 4856 |
| 319 | Ga0501032_0121490 | 3300049569 | Bacteria | 1726 |
| 320 | Ga0501032_0132036 | 3300049569 | Bacteria | 1647 |
| 321 | Ga0501033_0065753 | 3300049570 | Bacteria | 2667 |
| 322 | Ga0501033_0080757 | 3300049570 | Bacteria | 2385 |
| 323 | Ga0501033_0125432 | 3300049570 | Bacteria | 1862 |
| 324 | Ga0501034_0001584 | 3300049571 | Bacteria | 29619 |
| 325 | Ga0501034_0014590 | 3300049571 | Bacteria | 8089 |
| 326 | Ga0501034_0019501 | 3300049571 | Bacteria | 6936 |
| 327 | Ga0501034_0043434 | 3300049571 | Bacteria | 4549 |
| 328 | Ga0501034_0100176 | 3300049571 | Bacteria | 2891 |
| 329 | Ga0501034_0149844 | 3300049571 | Bacteria | 2309 |
| 330 | Ga0501034_0151408 | 3300049571 | Bacteria | 2295 |
| 331 | Ga0501034_0307554 | 3300049571 | Bacteria | 1520 |
| 332 | Ga0501034_0367771 | 3300049571 | Bacteria | 1364 |
| 333 | Ga0501034_1067469 | 3300049571 | Bacteria | 689 |
| 334 | Ga0501036_0001347 | 3300049572 | Bacteria | 18840 |
| 335 | Ga0501036_0054125 | 3300049572 | Bacteria | 3398 |
| 336 | Ga0501036_0294053 | 3300049572 | Bacteria | 1359 |
| 337 | Ga0501037_0018261 | 3300049573 | Bacteria | 5167 |
| 338 | Ga0501037_0034853 | 3300049573 | Bacteria | 3713 |
| 339 | Ga0501037_0066373 | 3300049573 | Bacteria | 2628 |
| 340 | Ga0501037_0288302 | 3300049573 | Bacteria | 1142 |
| 341 | Ga0501038_0013678 | 3300049574 | Bacteria | 7396 |
| 342 | Ga0501038_0044970 | 3300049574 | Bacteria | 3834 |
| 343 | Ga0501039_0039053 | 3300049575 | Bacteria | 3666 |
| 344 | Ga0501039_0043201 | 3300049575 | Bacteria | 3482 |
| 345 | Ga0501039_0371548 | 3300049575 | Bacteria | 1123 |
| 346 | Ga0501040_0065023 | 3300049576 | Bacteria | 2512 |
| 347 | Ga0501042_0142203 | 3300049578 | Bacteria | 1730 |
| 348 | Ga0501043_0010758 | 3300049579 | Bacteria | 7165 |
| 349 | Ga0501043_0043265 | 3300049579 | Bacteria | 3540 |
| 350 | Ga0501043_0086427 | 3300049579 | Bacteria | 2464 |
| 351 | Ga0501043_0103059 | 3300049579 | Bacteria | 2242 |
| 352 | Ga0501046_0057212 | 3300049580 | Bacteria | 3059 |
| 353 | Ga0501047_0006650 | 3300049581 | Bacteria | 10866 |
| 354 | Ga0501047_0036849 | 3300049581 | Bacteria | 4727 |
| 355 | Ga0501047_0100515 | 3300049581 | Bacteria | 2771 |
| 356 | Ga0501047_0329988 | 3300049581 | Bacteria | 1364 |
| 357 | Ga0501047_0862225 | 3300049581 | Bacteria | 719 |
| 358 | Ga0501048_0000039 | 3300049582 | Bacteria | 63521 |
| 359 | Ga0501048_0230386 | 3300049582 | Bacteria | 1314 |
| 360 | Ga0501048_0667583 | 3300049582 | Bacteria | 746 |
| 361 | Ga0501067_0055594 | 3300049583 | Bacteria | 2193 |
| 362 | Ga0501067_0077944 | 3300049583 | Bacteria | 1836 |
| 363 | Ga0501067_0109906 | 3300049583 | Bacteria | 1532 |
| 364 | Ga0501067_0363209 | 3300049583 | Bacteria | 807 |
| 365 | Ga0501068_0256050 | 3300049584 | Bacteria | 1116 |
| 366 | Ga0501069_0026184 | 3300049585 | Bacteria | 3193 |
| 367 | Ga0501069_0242080 | 3300049585 | Bacteria | 1051 |
| 368 | Ga0501069_0246816 | 3300049585 | Bacteria | 1041 |
| 369 | Ga0501070_0013578 | 3300049586 | Bacteria | 6865 |
| 370 | Ga0501070_0094910 | 3300049586 | Bacteria | 2468 |
| 371 | Ga0501070_0210572 | 3300049586 | Bacteria | 1596 |
| 372 | Ga0501070_0304266 | 3300049586 | Bacteria | 1298 |
| 373 | Ga0501070_0407170 | 3300049586 | Bacteria | 1099 |
| 374 | Ga0501071_0370248 | 3300049587 | Bacteria | 1092 |
| 375 | Ga0501071_0423494 | 3300049587 | Bacteria | 1017 |
| 376 | Ga0501072_0203041 | 3300049588 | Bacteria | 1580 |
| 377 | Ga0501073_0010200 | 3300049589 | Bacteria | 6901 |
| 378 | Ga0501073_0034068 | 3300049589 | Bacteria | 3625 |
| 379 | Ga0501073_0153519 | 3300049589 | Bacteria | 1596 |
| 380 | Ga0501073_0240420 | 3300049589 | Bacteria | 1250 |
| 381 | Ga0501074_0021551 | 3300049590 | Bacteria | 4679 |
| 382 | Ga0501074_0064758 | 3300049590 | Bacteria | 2631 |
| 383 | Ga0501074_0120925 | 3300049590 | Bacteria | 1873 |
| 384 | Ga0501074_0269853 | 3300049590 | Bacteria | 1209 |
| 385 | Ga0501074_0384911 | 3300049590 | Bacteria | 995 |
| 386 | Ga0501080_0000022 | 3300049742 | Bacteria | 90630 |
| 387 | Ga0501080_0058013 | 3300049742 | Bacteria | 3604 |
| 388 | Ga0501080_0086635 | 3300049742 | Bacteria | 2910 |
| 389 | Ga0501080_0100872 | 3300049742 | Bacteria | 2678 |
| 390 | Ga0501083_0001941 | 3300049744 | Bacteria | 14225 |
| 391 | Ga0501083_0381802 | 3300049744 | Bacteria | 916 |
| 392 | Ga0501035_0031789 | 3300049822 | Bacteria | 4807 |
| 393 | Ga0501035_0677694 | 3300049822 | Bacteria | 833 |
| 394 | Ga0501044_0005112 | 3300049823 | Bacteria | 14631 |
| 395 | Ga0501044_0019008 | 3300049823 | Bacteria | 7357 |
| 396 | Ga0501044_0109906 | 3300049823 | Bacteria | 2765 |
| 397 | Ga0501044_0253694 | 3300049823 | Bacteria | 1699 |
| 398 | Ga0501044_0926289 | 3300049823 | Bacteria | 745 |
| 399 | Ga0501044_0999167 | 3300049823 | Bacteria | 708 |
| 400 | nmdc:mga03n38_106582_c1 | 3300050490 | Bacteria | 1359 |
| 401 | nmdc:mga00v17_158597_c1 | 3300050491 | Bacteria | 1456 |
| 402 | nmdc:mga0yw44_88044_c1 | 3300050492 | Bacteria | 1958 |
| 403 | nmdc:mga05p37_353538_c1 | 3300050507 | Bacteria | 1729 |
| 404 | nmdc:mga08y16_182951_c1 | 3300050511 | Bacteria | 2175 |
| 405 | nmdc:mga0n895_217761_c1 | 3300050512 | Bacteria | 1939 |
| 406 | nmdc:mga08x19_22982_c1 | 3300050514 | Bacteria | 3866 |
| 407 | nmdc:mga0a205_438984_c1 | 3300050515 | Bacteria | 1166 |
| 408 | nmdc:mga0a205_689746_c1 | 3300050515 | Bacteria | 871 |
| 409 | nmdc:mga0sz30_3800_c1 | 3300050516 | Bacteria | 5441 |
| 410 | Ga0495601_0001233 | 3300053077 | Bacteria | 14029 |
| 411 | Ga0495601_0002814 | 3300053077 | Bacteria | 9872 |
| 412 | Ga0495601_0003553 | 3300053077 | Bacteria | 8962 |
| 413 | Ga0495612_0005171 | 3300053078 | Bacteria | 5390 |
| 414 | Ga0495595_0005027 | 3300053084 | Bacteria | 5340 |
| 415 | Ga0495619_0000360 | 3300053085 | Bacteria | 31637 |
| 416 | Ga0495619_0001277 | 3300053085 | Bacteria | 16520 |
| 417 | Ga0495619_0064410 | 3300053085 | Bacteria | 2443 |
| 418 | Ga0500578_0182914 | 3300053086 | Bacteria | 1291 |
| 419 | Ga0500643_008577 | 3300053087 | Bacteria | 4005 |
| 420 | Ga0500644_0006029 | 3300053088 | Bacteria | 3087 |
| 421 | Ga0500651_0025973 | 3300053093 | Bacteria | 3677 |
| 422 | Ga0500651_0144640 | 3300053093 | Bacteria | 1431 |
| 423 | Ga0500572_000359 | 3300053111 | Bacteria | 16208 |
| 424 | Ga0500594_0094914 | 3300053118 | Bacteria | 910 |
| 425 | Ga0500608_061785 | 3300053122 | Bacteria | 1789 |
| 426 | Ga0500652_000014 | 3300053131 | Bacteria | 147740 |
| 427 | Ga0500652_031232 | 3300053131 | Bacteria | 2088 |
| 428 | Ga0500655_078001 | 3300053133 | Bacteria | 680 |
| 429 | Ga0500559_0000213 | 3300053136 | Bacteria | 46604 |
| 430 | Ga0500577_0057738 | 3300053142 | Bacteria | 1482 |
| 431 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 432 | Ga0500616_0049589 | 3300053153 | Bacteria | 2220 |
| 433 | Ga0500622_0063525 | 3300053156 | Bacteria | 1879 |
| 434 | Ga0500639_064371 | 3300053163 | Bacteria | 1884 |
| 435 | Ga0500636_0010455 | 3300053177 | Bacteria | 5415 |
| 436 | Ga0500636_0018309 | 3300053177 | Bacteria | 4141 |
| 437 | Ga0500576_037173 | 3300053725 | Bacteria | 2201 |
| 438 | Ga0500645_001709 | 3300053730 | Bacteria | 10681 |
| 439 | Ga0500596_003672 | 3300053735 | Bacteria | 2888 |
| 440 | Ga0501084_0034964 | 3300054114 | Bacteria | 4202 |
| 441 | Ga0501084_0133775 | 3300054114 | Bacteria | 2087 |
| 442 | Ga0501082_0062344 | 3300060353 | Bacteria | 3209 |
| 443 | Ga0501082_0140587 | 3300060353 | Bacteria | 2095 |
| 444 | Ga0501082_0651218 | 3300060353 | Bacteria | 922 |
| 445 | Ga0501082_0756415 | 3300060353 | Bacteria | 850 |
| 446 | Ga0501082_0828045 | 3300060353 | Bacteria | 810 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2885383462 | 2885391824 | 151 |
| 2 | 3300035692 | Ga0373935_0273697 | Ga0373935_0273697_87_554 | 155 |
| 3 | 3300035725 | Ga0373947_0148526 | Ga0373947_0148526_442_909 | 155 |
| 4 | 3300046455 | Ga0495603_0434810 | Ga0495603_0434810_230_697 | 155 |
| 5 | 3300047472 | Ga0495686_0425400 | Ga0495686_0425400_24_491 | 155 |
| 6 | 3300048924 | Ga0496121_0267820 | Ga0496121_0267820_288_755 | 155 |
| 7 | 3300048929 | Ga0496126_0012254 | Ga0496126_0012254_7068_7535 | 155 |
| 8 | 3300053111 | Ga0500572_000359 | Ga0500572_000359_2505_2972 | 155 |
| 9 | 3300053136 | Ga0500559_0000213 | Ga0500559_0000213_5678_6145 | 155 |
| 10 | 3300053725 | Ga0500576_037173 | Ga0500576_037173_569_1036 | 155 |
| 11 | 3300053735 | Ga0500596_003672 | Ga0500596_003672_1332_1799 | 155 |
| 12 | 3300045051 | Ga0451576_0350944 | Ga0451576_0350944_765_1292 | 161 |
| 13 | 3300005983 | Ga0081540_1110692 | Ga0081540_11106922 | 162 |
| 14 | 3300049570 | Ga0501033_0125432 | Ga0501033_0125432_924_1454 | 162 |
| 15 | 3300049571 | Ga0501034_0151408 | Ga0501034_0151408_1691_2221 | 162 |
| 16 | 3300049572 | Ga0501036_0294053 | Ga0501036_0294053_408_938 | 162 |
| 17 | 3300049573 | Ga0501037_0034853 | Ga0501037_0034853_3130_3660 | 162 |
| 18 | 3300046512 | Ga0495610_0107244 | Ga0495610_0107244_687_1205 | 164 |
| 19 | 3300048926 | Ga0496123_0196919 | Ga0496123_0196919_111_629 | 164 |
| 20 | 3300049590 | Ga0501074_0384911 | Ga0501074_0384911_315_857 | 164 |
| 21 | 3300053086 | Ga0500578_0182914 | Ga0500578_0182914_536_1054 | 164 |
| 22 | 3300053093 | Ga0500651_0144640 | Ga0500651_0144640_894_1412 | 164 |
| 23 | 3300053122 | Ga0500608_061785 | Ga0500608_061785_647_1165 | 164 |
| 24 | 3300053142 | Ga0500577_0057738 | Ga0500577_0057738_549_1067 | 164 |
| 25 | 3300053153 | Ga0500616_0049589 | Ga0500616_0049589_115_633 | 164 |
| 26 | 3300053156 | Ga0500622_0063525 | Ga0500622_0063525_1257_1775 | 164 |
| 27 | 3300053177 | Ga0500636_0018309 | Ga0500636_0018309_1609_2127 | 164 |
| 28 | 3300053133 | Ga0500655_078001 | Ga0500655_078001_160_657 | 165 |
| 29 | 3300041486 | Ga0451807_2758769 | Ga0451807_2758769_339_842 | 167 |
| 30 | 3300009147 | Ga0114129_10014260 | Ga0114129_100142605 | 168 |
| 31 | 3300039437 | Ga0436365_1703855 | Ga0436365_1703855_495_1004 | 168 |
| 32 | 3300044706 | Ga0466964_0099894 | Ga0466964_0099894_526_1032 | 168 |
| 33 | 3300035083 | Ga0373926_0094992 | Ga0373926_0094992_494_1003 | 169 |
| 34 | 3300035695 | Ga0373927_0055814 | Ga0373927_0055814_1838_2347 | 169 |
| 35 | 3300035725 | Ga0373947_0046913 | Ga0373947_0046913_231_740 | 169 |
| 36 | 3300037068 | Ga0373925_0012148 | Ga0373925_0012148_4104_4613 | 169 |
| 37 | 3300046473 | Ga0495582_0011256 | Ga0495582_0011256_2819_3328 | 169 |
| 38 | 3300046683 | Ga0495658_0020110 | Ga0495658_0020110_1462_1971 | 169 |
| 39 | 3300005435 | Ga0070714_100679158 | Ga0070714_1006791581 | 170 |
| 40 | 3300005437 | Ga0070710_10011524 | Ga0070710_100115248 | 170 |
| 41 | 3300025898 | Ga0207692_10160874 | Ga0207692_101608741 | 170 |
| 42 | 3300025912 | Ga0207707_10381115 | Ga0207707_103811152 | 170 |
| 43 | 3300046455 | Ga0495603_0737542 | Ga0495603_0737542_34_549 | 170 |
| 44 | 3300005436 | Ga0070713_100546366 | Ga0070713_1005463662 | 171 |
| 45 | 3300006028 | Ga0070717_10628179 | Ga0070717_106281792 | 171 |
| 46 | 3300009551 | Ga0105238_11151427 | Ga0105238_111514271 | 171 |
| 47 | 3300025939 | Ga0207665_10137703 | Ga0207665_101377032 | 171 |
| 48 | 3300049571 | Ga0501034_0014590 | Ga0501034_0014590_2464_2982 | 171 |
| 49 | 3300049583 | Ga0501067_0077944 | Ga0501067_0077944_435_950 | 171 |
| 50 | 3300049584 | Ga0501068_0256050 | Ga0501068_0256050_392_910 | 171 |
| 51 | 3300049585 | Ga0501069_0242080 | Ga0501069_0242080_218_733 | 171 |
| 52 | 3300049586 | Ga0501070_0304266 | Ga0501070_0304266_347_862 | 171 |
| 53 | 3300049588 | Ga0501072_0203041 | Ga0501072_0203041_965_1480 | 171 |
| 54 | 3300049589 | Ga0501073_0034068 | Ga0501073_0034068_2832_3347 | 171 |
| 55 | 3300049590 | Ga0501074_0269853 | Ga0501074_0269853_344_859 | 171 |
| 56 | 3300049742 | Ga0501080_0086635 | Ga0501080_0086635_1088_1603 | 171 |
| 57 | 3300049742 | Ga0501080_0100872 | Ga0501080_0100872_1291_1809 | 171 |
| 58 | 3300060353 | Ga0501082_0651218 | Ga0501082_0651218_395_910 | 171 |
| 59 | 3300034818 | Ga0373950_0002390 | Ga0373950_0002390_950_1507 | 172 |
| 60 | 3300005434 | Ga0070709_10066581 | Ga0070709_100665813 | 174 |
| 61 | 3300005439 | Ga0070711_100030176 | Ga0070711_1000301764 | 174 |
| 62 | 3300005564 | Ga0070664_100199114 | Ga0070664_1001991143 | 174 |
| 63 | 3300006173 | Ga0070716_100302855 | Ga0070716_1003028552 | 174 |
| 64 | 3300006175 | Ga0070712_100108523 | Ga0070712_1001085233 | 174 |
| 65 | 3300006844 | Ga0075428_100538933 | Ga0075428_1005389331 | 174 |
| 66 | 3300009551 | Ga0105238_10025592 | Ga0105238_100255928 | 174 |
| 67 | 3300025901 | Ga0207688_10243486 | Ga0207688_102434862 | 174 |
| 68 | 3300025915 | Ga0207693_10115635 | Ga0207693_101156353 | 174 |
| 69 | 3300026075 | Ga0207708_10704154 | Ga0207708_107041541 | 174 |
| 70 | 3300035116 | Ga0373945_0072867 | Ga0373945_0072867_696_1226 | 174 |
| 71 | 3300035170 | Ga0373943_0051051 | Ga0373943_0051051_869_1459 | 174 |
| 72 | 3300035171 | Ga0373946_0044708 | Ga0373946_0044708_1016_1606 | 174 |
| 73 | 3300036401 | Ga0373937_0883871 | Ga0373937_0883871_168_758 | 174 |
| 74 | 3300041459 | Ga0451800_0199826 | Ga0451800_0199826_98_631 | 174 |
| 75 | 3300046455 | Ga0495603_0087082 | Ga0495603_0087082_1113_1703 | 174 |
| 76 | 3300046472 | Ga0495580_0094714 | Ga0495580_0094714_893_1483 | 174 |
| 77 | 3300046476 | Ga0495662_0034280 | Ga0495662_0034280_1246_1854 | 174 |
| 78 | 3300046517 | Ga0495630_0113926 | Ga0495630_0113926_1334_1924 | 174 |
| 79 | 3300046526 | Ga0495666_0163198 | Ga0495666_0163198_372_962 | 174 |
| 80 | 3300046533 | Ga0495640_0009022 | Ga0495640_0009022_2219_2809 | 174 |
| 81 | 3300046642 | Ga0495634_0013379 | Ga0495634_0013379_824_1414 | 174 |
| 82 | 3300046689 | Ga0495613_0373189 | Ga0495613_0373189_301_891 | 174 |
| 83 | 3300047319 | Ga0495674_0045526 | Ga0495674_0045526_98_688 | 174 |
| 84 | 3300047321 | Ga0495676_0365062 | Ga0495676_0365062_93_623 | 174 |
| 85 | 3300053077 | Ga0495601_0003553 | Ga0495601_0003553_4502_5092 | 174 |
| 86 | 3300005539 | Ga0068853_100500600 | Ga0068853_1005006002 | 175 |
| 87 | 3300009093 | Ga0105240_10080101 | Ga0105240_100801012 | 175 |
| 88 | 3300013104 | Ga0157370_10319061 | Ga0157370_103190611 | 175 |
| 89 | 3300013105 | Ga0157369_10187647 | Ga0157369_101876473 | 175 |
| 90 | 3300025912 | Ga0207707_10611907 | Ga0207707_106119072 | 175 |
| 91 | 3300032133 | Ga0316583_10000116 | Ga0316583_100001161 | 175 |
| 92 | 3300049569 | Ga0501032_0018667 | Ga0501032_0018667_1666_2193 | 175 |
| 93 | 3300049571 | Ga0501034_0001584 | Ga0501034_0001584_21369_21896 | 175 |
| 94 | 3300049571 | Ga0501034_0367771 | Ga0501034_0367771_532_1059 | 175 |
| 95 | 3300049572 | Ga0501036_0001347 | Ga0501036_0001347_9643_10170 | 175 |
| 96 | 3300049574 | Ga0501038_0044970 | Ga0501038_0044970_791_1318 | 175 |
| 97 | 3300049579 | Ga0501043_0010758 | Ga0501043_0010758_4259_4786 | 175 |
| 98 | 3300049580 | Ga0501046_0057212 | Ga0501046_0057212_896_1423 | 175 |
| 99 | 3300049581 | Ga0501047_0006650 | Ga0501047_0006650_139_666 | 175 |
| 100 | 3300049582 | Ga0501048_0000039 | Ga0501048_0000039_41093_41620 | 175 |
| 101 | 3300049586 | Ga0501070_0013578 | Ga0501070_0013578_1726_2253 | 175 |
| 102 | 3300049589 | Ga0501073_0240420 | Ga0501073_0240420_87_614 | 175 |
| 103 | 3300049590 | Ga0501074_0021551 | Ga0501074_0021551_822_1349 | 175 |
| 104 | 3300049742 | Ga0501080_0000022 | Ga0501080_0000022_20112_20639 | 175 |
| 105 | 3300049744 | Ga0501083_0001941 | Ga0501083_0001941_3487_4014 | 175 |
| 106 | 3300049823 | Ga0501044_0005112 | Ga0501044_0005112_10187_10714 | 175 |
| 107 | 3300060353 | Ga0501082_0756415 | Ga0501082_0756415_309_836 | 175 |
| 108 | 3300031824 | Ga0307413_10736260 | Ga0307413_107362601 | 176 |
| 109 | 3300032002 | Ga0307416_102745062 | Ga0307416_1027450621 | 176 |
| 110 | 3300035115 | Ga0373941_0002027 | Ga0373941_0002027_3439_3969 | 176 |
| 111 | 3300049571 | Ga0501034_0019501 | Ga0501034_0019501_5599_6129 | 176 |
| 112 | 3300049573 | Ga0501037_0066373 | Ga0501037_0066373_1018_1548 | 176 |
| 113 | 3300049575 | Ga0501039_0039053 | Ga0501039_0039053_1381_1911 | 176 |
| 114 | 3300049579 | Ga0501043_0086427 | Ga0501043_0086427_246_776 | 176 |
| 115 | 3300049581 | Ga0501047_0036849 | Ga0501047_0036849_2721_3251 | 176 |
| 116 | 3300049582 | Ga0501048_0667583 | Ga0501048_0667583_10_540 | 176 |
| 117 | 3300049583 | Ga0501067_0363209 | Ga0501067_0363209_201_731 | 176 |
| 118 | 3300049587 | Ga0501071_0370248 | Ga0501071_0370248_29_559 | 176 |
| 119 | 3300049822 | Ga0501035_0031789 | Ga0501035_0031789_356_886 | 176 |
| 120 | 3300049823 | Ga0501044_0109906 | Ga0501044_0109906_1881_2411 | 176 |
| 121 | 3300034818 | Ga0373950_0043011 | Ga0373950_0043011_148_681 | 177 |
| 122 | 3300049569 | Ga0501032_0121490 | Ga0501032_0121490_37_570 | 177 |
| 123 | 3300049570 | Ga0501033_0065753 | Ga0501033_0065753_1451_1984 | 177 |
| 124 | 3300049571 | Ga0501034_0307554 | Ga0501034_0307554_509_1042 | 177 |
| 125 | 3300049571 | Ga0501034_1067469 | Ga0501034_1067469_114_647 | 177 |
| 126 | 3300049573 | Ga0501037_0288302 | Ga0501037_0288302_499_1032 | 177 |
| 127 | 3300049575 | Ga0501039_0371548 | Ga0501039_0371548_136_669 | 177 |
| 128 | 3300049576 | Ga0501040_0065023 | Ga0501040_0065023_368_901 | 177 |
| 129 | 3300049578 | Ga0501042_0142203 | Ga0501042_0142203_785_1318 | 177 |
| 130 | 3300049579 | Ga0501043_0103059 | Ga0501043_0103059_1448_1981 | 177 |
| 131 | 3300049582 | Ga0501048_0230386 | Ga0501048_0230386_276_809 | 177 |
| 132 | 3300049583 | Ga0501067_0109906 | Ga0501067_0109906_373_906 | 177 |
| 133 | 3300049585 | Ga0501069_0026184 | Ga0501069_0026184_2276_2809 | 177 |
| 134 | 3300049586 | Ga0501070_0407170 | Ga0501070_0407170_308_841 | 177 |
| 135 | 3300049587 | Ga0501071_0423494 | Ga0501071_0423494_92_625 | 177 |
| 136 | 3300049590 | Ga0501074_0064758 | Ga0501074_0064758_56_589 | 177 |
| 137 | 3300049822 | Ga0501035_0677694 | Ga0501035_0677694_71_604 | 177 |
| 138 | 3300049823 | Ga0501044_0999167 | Ga0501044_0999167_34_567 | 177 |
| 139 | 3300054114 | Ga0501084_0133775 | Ga0501084_0133775_141_674 | 177 |
| 140 | 3300060353 | Ga0501082_0062344 | Ga0501082_0062344_891_1424 | 177 |
| 141 | 3300009147 | Ga0114129_10311945 | Ga0114129_103119452 | 178 |
| 142 | 3300050507 | nmdc:mga05p37_353538_c1 | nmdc:mga05p37_353538_c1_1057_1605 | 178 |
| 143 | 3300050515 | nmdc:mga0a205_689746_c1 | nmdc:mga0a205_689746_c1_204_752 | 178 |
| 144 | 3300005336 | Ga0070680_100071048 | Ga0070680_1000710482 | 179 |
| 145 | 3300005337 | Ga0070682_100073753 | Ga0070682_1000737532 | 179 |
| 146 | 3300005366 | Ga0070659_100040357 | Ga0070659_1000403573 | 179 |
| 147 | 3300005458 | Ga0070681_10090943 | Ga0070681_100909433 | 179 |
| 148 | 3300005530 | Ga0070679_100052373 | Ga0070679_1000523735 | 179 |
| 149 | 3300005530 | Ga0070679_100054373 | Ga0070679_1000543733 | 179 |
| 150 | 3300005539 | Ga0068853_100027296 | Ga0068853_1000272963 | 179 |
| 151 | 3300005563 | Ga0068855_100300499 | Ga0068855_1003004992 | 179 |
| 152 | 3300005577 | Ga0068857_100306682 | Ga0068857_1003066822 | 179 |
| 153 | 3300005578 | Ga0068854_100173590 | Ga0068854_1001735902 | 179 |
| 154 | 3300005614 | Ga0068856_100191413 | Ga0068856_1001914132 | 179 |
| 155 | 3300013100 | Ga0157373_10060338 | Ga0157373_100603382 | 179 |
| 156 | 3300025912 | Ga0207707_10061709 | Ga0207707_100617093 | 179 |
| 157 | 3300025917 | Ga0207660_10032599 | Ga0207660_100325992 | 179 |
| 158 | 3300025921 | Ga0207652_10105522 | Ga0207652_101055222 | 179 |
| 159 | 3300025932 | Ga0207690_10024995 | Ga0207690_100249953 | 179 |
| 160 | 3300025949 | Ga0207667_10571415 | Ga0207667_105714152 | 179 |
| 161 | 3300025981 | Ga0207640_10043059 | Ga0207640_100430592 | 179 |
| 162 | 3300026116 | Ga0207674_10304865 | Ga0207674_103048652 | 179 |
| 163 | 3300046460 | Ga0495638_0199017 | Ga0495638_0199017_242_781 | 179 |
| 164 | 3300049568 | Ga0501031_0058989 | Ga0501031_0058989_765_1310 | 179 |
| 165 | 3300049569 | Ga0501032_0132036 | Ga0501032_0132036_187_732 | 179 |
| 166 | 3300049570 | Ga0501033_0080757 | Ga0501033_0080757_661_1206 | 179 |
| 167 | 3300049571 | Ga0501034_0100176 | Ga0501034_0100176_1786_2331 | 179 |
| 168 | 3300049572 | Ga0501036_0054125 | Ga0501036_0054125_1054_1599 | 179 |
| 169 | 3300049573 | Ga0501037_0018261 | Ga0501037_0018261_4154_4699 | 179 |
| 170 | 3300049574 | Ga0501038_0013678 | Ga0501038_0013678_1180_1725 | 179 |
| 171 | 3300049575 | Ga0501039_0043201 | Ga0501039_0043201_376_921 | 179 |
| 172 | 3300049579 | Ga0501043_0043265 | Ga0501043_0043265_1436_1981 | 179 |
| 173 | 3300049581 | Ga0501047_0100515 | Ga0501047_0100515_1437_1982 | 179 |
| 174 | 3300049583 | Ga0501067_0055594 | Ga0501067_0055594_126_671 | 179 |
| 175 | 3300049586 | Ga0501070_0094910 | Ga0501070_0094910_154_693 | 179 |
| 176 | 3300049589 | Ga0501073_0010200 | Ga0501073_0010200_1421_1966 | 179 |
| 177 | 3300049742 | Ga0501080_0058013 | Ga0501080_0058013_1908_2453 | 179 |
| 178 | 3300049744 | Ga0501083_0381802 | Ga0501083_0381802_231_776 | 179 |
| 179 | 3300049823 | Ga0501044_0019008 | Ga0501044_0019008_1250_1795 | 179 |
| 180 | 3300049823 | Ga0501044_0253694 | Ga0501044_0253694_1002_1544 | 179 |
| 181 | 3300053087 | Ga0500643_008577 | Ga0500643_008577_856_1395 | 179 |
| 182 | 3300053088 | Ga0500644_0006029 | Ga0500644_0006029_271_810 | 179 |
| 183 | 3300053093 | Ga0500651_0025973 | Ga0500651_0025973_930_1469 | 179 |
| 184 | 3300053118 | Ga0500594_0094914 | Ga0500594_0094914_294_833 | 179 |
| 185 | 3300053131 | Ga0500652_031232 | Ga0500652_031232_1370_1909 | 179 |
| 186 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1436728_1437267 | 179 |
| 187 | 3300053730 | Ga0500645_001709 | Ga0500645_001709_7518_8057 | 179 |
| 188 | 3300054114 | Ga0501084_0034964 | Ga0501084_0034964_3254_3799 | 179 |
| 189 | 3300060353 | Ga0501082_0140587 | Ga0501082_0140587_1390_1935 | 179 |
| 190 | iso_pu_bacteria | 2876808645 | 2876811583 | 179 |
| 191 | iso_pu_bacteria | 2879110137 | 2879114203 | 179 |
| 192 | 3300003659 | JGI25404J52841_10000584 | JGI25404J52841_100005843 | 180 |
| 193 | 3300005434 | Ga0070709_10059120 | Ga0070709_100591202 | 180 |
| 194 | 3300005437 | Ga0070710_10044867 | Ga0070710_100448673 | 180 |
| 195 | 3300005439 | Ga0070711_100580049 | Ga0070711_1005800492 | 180 |
| 196 | 3300005535 | Ga0070684_100181416 | Ga0070684_1001814162 | 180 |
| 197 | 3300005547 | Ga0070693_100026930 | Ga0070693_1000269302 | 180 |
| 198 | 3300005983 | Ga0081540_1000300 | Ga0081540_100030039 | 180 |
| 199 | 3300006028 | Ga0070717_10446948 | Ga0070717_104469482 | 180 |
| 200 | 3300006871 | Ga0075434_100533961 | Ga0075434_1005339612 | 180 |
| 201 | 3300006914 | Ga0075436_100050194 | Ga0075436_1000501942 | 180 |
| 202 | 3300013307 | Ga0157372_10149209 | Ga0157372_101492091 | 180 |
| 203 | 3300025906 | Ga0207699_10513197 | Ga0207699_105131971 | 180 |
| 204 | 3300025913 | Ga0207695_10085049 | Ga0207695_100850492 | 180 |
| 205 | 3300025915 | Ga0207693_10005987 | Ga0207693_100059872 | 180 |
| 206 | 3300025928 | Ga0207700_10300792 | Ga0207700_103007922 | 180 |
| 207 | 3300031241 | Ga0265325_10003470 | Ga0265325_1000347010 | 180 |
| 208 | 3300031595 | Ga0265313_10000339 | Ga0265313_1000033917 | 180 |
| 209 | 3300031595 | Ga0265313_10021913 | Ga0265313_100219133 | 180 |
| 210 | 3300035113 | Ga0373936_0017635 | Ga0373936_0017635_1699_2244 | 180 |
| 211 | 3300049823 | Ga0501044_0926289 | Ga0501044_0926289_14_559 | 180 |
| 212 | 3300053163 | Ga0500639_064371 | Ga0500639_064371_489_1034 | 180 |
| 213 | 3300005530 | Ga0070679_100179692 | Ga0070679_1001796923 | 181 |
| 214 | 3300005530 | Ga0070679_100208310 | Ga0070679_1002083102 | 181 |
| 215 | 3300005563 | Ga0068855_100019111 | Ga0068855_1000191113 | 181 |
| 216 | 3300005563 | Ga0068855_100083173 | Ga0068855_1000831732 | 181 |
| 217 | 3300005614 | Ga0068856_100170170 | Ga0068856_1001701702 | 181 |
| 218 | 3300005983 | Ga0081540_1003666 | Ga0081540_10036666 | 181 |
| 219 | 3300009093 | Ga0105240_10167703 | Ga0105240_101677032 | 181 |
| 220 | 3300009093 | Ga0105240_10512801 | Ga0105240_105128012 | 181 |
| 221 | 3300013102 | Ga0157371_10049586 | Ga0157371_100495863 | 181 |
| 222 | 3300013104 | Ga0157370_10133748 | Ga0157370_101337482 | 181 |
| 223 | 3300013105 | Ga0157369_10467927 | Ga0157369_104679272 | 181 |
| 224 | 3300013307 | Ga0157372_10248177 | Ga0157372_102481773 | 181 |
| 225 | 3300020070 | Ga0206356_10393450 | Ga0206356_103934503 | 181 |
| 226 | 3300020081 | Ga0206354_10592092 | Ga0206354_105920923 | 181 |
| 227 | 3300020082 | Ga0206353_11411820 | Ga0206353_114118201 | 181 |
| 228 | 3300025909 | Ga0207705_10012753 | Ga0207705_100127536 | 181 |
| 229 | 3300025909 | Ga0207705_10089639 | Ga0207705_100896392 | 181 |
| 230 | 3300025912 | Ga0207707_10144776 | Ga0207707_101447762 | 181 |
| 231 | 3300025913 | Ga0207695_10085628 | Ga0207695_100856283 | 181 |
| 232 | 3300025913 | Ga0207695_10462596 | Ga0207695_104625961 | 181 |
| 233 | 3300025917 | Ga0207660_10028935 | Ga0207660_100289353 | 181 |
| 234 | 3300025919 | Ga0207657_10433044 | Ga0207657_104330442 | 181 |
| 235 | 3300025921 | Ga0207652_10148776 | Ga0207652_101487762 | 181 |
| 236 | 3300025921 | Ga0207652_10429951 | Ga0207652_104299512 | 181 |
| 237 | 3300025924 | Ga0207694_10040374 | Ga0207694_100403742 | 181 |
| 238 | 3300025944 | Ga0207661_10169112 | Ga0207661_101691122 | 181 |
| 239 | 3300025949 | Ga0207667_10011279 | Ga0207667_1001127912 | 181 |
| 240 | 3300025949 | Ga0207667_10190351 | Ga0207667_101903512 | 181 |
| 241 | 3300026041 | Ga0207639_10449083 | Ga0207639_104490832 | 181 |
| 242 | 3300026078 | Ga0207702_10428829 | Ga0207702_104288292 | 181 |
| 243 | 3300026142 | Ga0207698_10100835 | Ga0207698_101008353 | 181 |
| 244 | 3300045976 | Ga0466967_0913982 | Ga0466967_0913982_84_638 | 181 |
| 245 | 3300046455 | Ga0495603_0290175 | Ga0495603_0290175_107_652 | 181 |
| 246 | 3300046499 | Ga0495594_0245739 | Ga0495594_0245739_260_805 | 181 |
| 247 | 3300046557 | Ga0495622_0232462 | Ga0495622_0232462_221_766 | 181 |
| 248 | 3300053131 | Ga0500652_000014 | Ga0500652_000014_55703_56248 | 181 |
| 249 | 3300053177 | Ga0500636_0010455 | Ga0500636_0010455_4121_4666 | 181 |
| 250 | 3300005336 | Ga0070680_100100083 | Ga0070680_1001000832 | 182 |
| 251 | 3300006186 | Ga0075369_10005687 | Ga0075369_100056874 | 182 |
| 252 | 3300025917 | Ga0207660_10124655 | Ga0207660_101246552 | 182 |
| 253 | 3300035115 | Ga0373941_0000158 | Ga0373941_0000158_11453_12001 | 182 |
| 254 | 3300049571 | Ga0501034_0149844 | Ga0501034_0149844_1680_2228 | 182 |
| 255 | 3300049581 | Ga0501047_0329988 | Ga0501047_0329988_413_961 | 182 |
| 256 | 3300049589 | Ga0501073_0153519 | Ga0501073_0153519_528_1076 | 182 |
| 257 | 3300050490 | nmdc:mga03n38_106582_c1 | nmdc:mga03n38_106582_c1_27_575 | 182 |
| 258 | 3300050491 | nmdc:mga00v17_158597_c1 | nmdc:mga00v17_158597_c1_320_868 | 182 |
| 259 | 3300050492 | nmdc:mga0yw44_88044_c1 | nmdc:mga0yw44_88044_c1_694_1242 | 182 |
| 260 | 3300050516 | nmdc:mga0sz30_3800_c1 | nmdc:mga0sz30_3800_c1_4544_5092 | 182 |
| 261 | 3300046683 | Ga0495658_0065888 | Ga0495658_0065888_1147_1701 | 183 |
| 262 | 3300005436 | Ga0070713_100028421 | Ga0070713_1000284213 | 184 |
| 263 | 3300005985 | Ga0081539_10107613 | Ga0081539_101076132 | 184 |
| 264 | 3300025898 | Ga0207692_10191016 | Ga0207692_101910162 | 184 |
| 265 | 3300025934 | Ga0207686_10026691 | Ga0207686_100266913 | 184 |
| 266 | 3300031242 | Ga0265329_10060464 | Ga0265329_100604642 | 184 |
| 267 | 3300031250 | Ga0265331_10161207 | Ga0265331_101612072 | 184 |
| 268 | 3300035118 | Ga0373954_0007693 | Ga0373954_0007693_1058_1618 | 184 |
| 269 | 3300035120 | Ga0373957_0006765 | Ga0373957_0006765_1621_2175 | 184 |
| 270 | 3300035120 | Ga0373957_0148171 | Ga0373957_0148171_367_927 | 184 |
| 271 | 3300035172 | Ga0373955_0001732 | Ga0373955_0001732_7982_8542 | 184 |
| 272 | 3300035410 | Ga0373924_0001989 | Ga0373924_0001989_2472_3032 | 184 |
| 273 | 3300035724 | Ga0373933_0001526 | Ga0373933_0001526_4615_5175 | 184 |
| 274 | 3300036401 | Ga0373937_0002031 | Ga0373937_0002031_5209_5769 | 184 |
| 275 | 3300036401 | Ga0373937_0002067 | Ga0373937_0002067_10204_10758 | 184 |
| 276 | 3300046454 | Ga0495592_0008608 | Ga0495592_0008608_643_1197 | 184 |
| 277 | 3300046454 | Ga0495592_0127634 | Ga0495592_0127634_190_750 | 184 |
| 278 | 3300046462 | Ga0495651_0017806 | Ga0495651_0017806_1669_2229 | 184 |
| 279 | 3300046462 | Ga0495651_0019768 | Ga0495651_0019768_1397_1951 | 184 |
| 280 | 3300046463 | Ga0495653_0033340 | Ga0495653_0033340_2286_2840 | 184 |
| 281 | 3300046477 | Ga0495664_0090573 | Ga0495664_0090573_665_1219 | 184 |
| 282 | 3300046511 | Ga0495608_0006088 | Ga0495608_0006088_1972_2526 | 184 |
| 283 | 3300046514 | Ga0495618_0038863 | Ga0495618_0038863_217_771 | 184 |
| 284 | 3300046516 | Ga0495628_0083278 | Ga0495628_0083278_1725_2279 | 184 |
| 285 | 3300046536 | Ga0495587_0002925 | Ga0495587_0002925_8684_9238 | 184 |
| 286 | 3300046543 | Ga0495645_0003668 | Ga0495645_0003668_7153_7707 | 184 |
| 287 | 3300046559 | Ga0495667_0003478 | Ga0495667_0003478_9023_9577 | 184 |
| 288 | 3300046559 | Ga0495667_0024428 | Ga0495667_0024428_1187_1747 | 184 |
| 289 | 3300046663 | Ga0495635_0017003 | Ga0495635_0017003_4243_4797 | 184 |
| 290 | 3300046675 | Ga0495657_0528166 | Ga0495657_0528166_59_613 | 184 |
| 291 | 3300046678 | Ga0495599_0027101 | Ga0495599_0027101_2400_2954 | 184 |
| 292 | 3300046679 | Ga0495623_0002450 | Ga0495623_0002450_6588_7142 | 184 |
| 293 | 3300046680 | Ga0495646_0077527 | Ga0495646_0077527_624_1178 | 184 |
| 294 | 3300046809 | Ga0495600_0046747 | Ga0495600_0046747_1459_2019 | 184 |
| 295 | 3300047317 | Ga0495604_0009839 | Ga0495604_0009839_6035_6589 | 184 |
| 296 | 3300047319 | Ga0495674_0193066 | Ga0495674_0193066_329_883 | 184 |
| 297 | 3300047322 | Ga0495680_0037049 | Ga0495680_0037049_2401_2955 | 184 |
| 298 | 3300047444 | Ga0495675_0004145 | Ga0495675_0004145_1341_1895 | 184 |
| 299 | 3300047471 | Ga0495684_0177225 | Ga0495684_0177225_306_860 | 184 |
| 300 | 3300048088 | Ga0495602_0001877 | Ga0495602_0001877_6080_6634 | 184 |
| 301 | 3300048088 | Ga0495602_0042715 | Ga0495602_0042715_1804_2364 | 184 |
| 302 | 3300053077 | Ga0495601_0001233 | Ga0495601_0001233_7124_7684 | 184 |
| 303 | 3300053077 | Ga0495601_0002814 | Ga0495601_0002814_8987_9541 | 184 |
| 304 | 3300053078 | Ga0495612_0005171 | Ga0495612_0005171_3147_3701 | 184 |
| 305 | 3300053084 | Ga0495595_0005027 | Ga0495595_0005027_2133_2693 | 184 |
| 306 | 3300053085 | Ga0495619_0001277 | Ga0495619_0001277_14173_14733 | 184 |
| 307 | 3300053085 | Ga0495619_0064410 | Ga0495619_0064410_1580_2134 | 184 |
| 308 | 2209111006 | 2214947991 | 2214010752 | 185 |
| 309 | 3300005327 | Ga0070658_10215674 | Ga0070658_102156742 | 185 |
| 310 | 3300005331 | Ga0070670_100079424 | Ga0070670_1000794242 | 185 |
| 311 | 3300005335 | Ga0070666_10002410 | Ga0070666_100024107 | 185 |
| 312 | 3300005337 | Ga0070682_100073868 | Ga0070682_1000738683 | 185 |
| 313 | 3300005339 | Ga0070660_100154211 | Ga0070660_1001542112 | 185 |
| 314 | 3300005343 | Ga0070687_100053108 | Ga0070687_1000531083 | 185 |
| 315 | 3300005355 | Ga0070671_100038169 | Ga0070671_1000381694 | 185 |
| 316 | 3300005356 | Ga0070674_100025988 | Ga0070674_1000259885 | 185 |
| 317 | 3300005364 | Ga0070673_100006321 | Ga0070673_1000063219 | 185 |
| 318 | 3300005366 | Ga0070659_100123426 | Ga0070659_1001234262 | 185 |
| 319 | 3300005367 | Ga0070667_100043894 | Ga0070667_1000438942 | 185 |
| 320 | 3300005434 | Ga0070709_10001471 | Ga0070709_1000147111 | 185 |
| 321 | 3300005435 | Ga0070714_100040278 | Ga0070714_1000402781 | 185 |
| 322 | 3300005436 | Ga0070713_100002952 | Ga0070713_1000029523 | 185 |
| 323 | 3300005439 | Ga0070711_100049935 | Ga0070711_1000499351 | 185 |
| 324 | 3300005441 | Ga0070700_100040752 | Ga0070700_1000407523 | 185 |
| 325 | 3300005466 | Ga0070685_10019043 | Ga0070685_100190431 | 185 |
| 326 | 3300005543 | Ga0070672_100147749 | Ga0070672_1001477493 | 185 |
| 327 | 3300005544 | Ga0070686_100022976 | Ga0070686_1000229765 | 185 |
| 328 | 3300005546 | Ga0070696_100211207 | Ga0070696_1002112072 | 185 |
| 329 | 3300005547 | Ga0070693_100015849 | Ga0070693_1000158495 | 185 |
| 330 | 3300005548 | Ga0070665_100010668 | Ga0070665_1000106683 | 185 |
| 331 | 3300005549 | Ga0070704_100089474 | Ga0070704_1000894742 | 185 |
| 332 | 3300005615 | Ga0070702_100048785 | Ga0070702_1000487853 | 185 |
| 333 | 3300005618 | Ga0068864_100185416 | Ga0068864_1001854162 | 185 |
| 334 | 3300005718 | Ga0068866_10013309 | Ga0068866_100133093 | 185 |
| 335 | 3300006028 | Ga0070717_10000817 | Ga0070717_1000081712 | 185 |
| 336 | 3300006173 | Ga0070716_100000940 | Ga0070716_1000009405 | 185 |
| 337 | 3300006175 | Ga0070712_100007317 | Ga0070712_1000073174 | 185 |
| 338 | 3300006237 | Ga0097621_100015295 | Ga0097621_1000152952 | 185 |
| 339 | 3300006871 | Ga0075434_100155266 | Ga0075434_1001552662 | 185 |
| 340 | 3300006881 | Ga0068865_100072868 | Ga0068865_1000728682 | 185 |
| 341 | 3300006914 | Ga0075436_100045218 | Ga0075436_1000452183 | 185 |
| 342 | 3300007076 | Ga0075435_100069589 | Ga0075435_1000695893 | 185 |
| 343 | 3300009011 | Ga0105251_10040178 | Ga0105251_100401783 | 185 |
| 344 | 3300009092 | Ga0105250_10031700 | Ga0105250_100317003 | 185 |
| 345 | 3300009098 | Ga0105245_10094228 | Ga0105245_100942282 | 185 |
| 346 | 3300009148 | Ga0105243_10021264 | Ga0105243_100212644 | 185 |
| 347 | 3300009174 | Ga0105241_10044626 | Ga0105241_100446263 | 185 |
| 348 | 3300009176 | Ga0105242_10013376 | Ga0105242_100133766 | 185 |
| 349 | 3300009177 | Ga0105248_10145238 | Ga0105248_101452383 | 185 |
| 350 | 3300009545 | Ga0105237_10042836 | Ga0105237_100428364 | 185 |
| 351 | 3300009551 | Ga0105238_10062917 | Ga0105238_100629172 | 185 |
| 352 | 3300009553 | Ga0105249_10548336 | Ga0105249_105483362 | 185 |
| 353 | 3300010375 | Ga0105239_10081090 | Ga0105239_100810904 | 185 |
| 354 | 3300012492 | Ga0157335_1003505 | Ga0157335_10035052 | 185 |
| 355 | 3300012515 | Ga0157338_1000838 | Ga0157338_10008382 | 185 |
| 356 | 3300013297 | Ga0157378_10041712 | Ga0157378_100417123 | 185 |
| 357 | 3300013306 | Ga0163162_10784080 | Ga0163162_107840801 | 185 |
| 358 | 3300013307 | Ga0157372_10488699 | Ga0157372_104886992 | 185 |
| 359 | 3300013308 | Ga0157375_10130156 | Ga0157375_101301563 | 185 |
| 360 | 3300014325 | Ga0163163_10148844 | Ga0163163_101488443 | 185 |
| 361 | 3300014326 | Ga0157380_10062937 | Ga0157380_100629373 | 185 |
| 362 | 3300014745 | Ga0157377_10456143 | Ga0157377_104561432 | 185 |
| 363 | 3300014968 | Ga0157379_10067139 | Ga0157379_100671394 | 185 |
| 364 | 3300014969 | Ga0157376_10059328 | Ga0157376_100593284 | 185 |
| 365 | 3300025315 | Ga0207697_10110365 | Ga0207697_101103652 | 185 |
| 366 | 3300025735 | Ga0207713_1053699 | Ga0207713_10536992 | 185 |
| 367 | 3300025900 | Ga0207710_10001206 | Ga0207710_1000120615 | 185 |
| 368 | 3300025903 | Ga0207680_10002299 | Ga0207680_100022995 | 185 |
| 369 | 3300025905 | Ga0207685_10000115 | Ga0207685_1000011511 | 185 |
| 370 | 3300025906 | Ga0207699_10004298 | Ga0207699_100042987 | 185 |
| 371 | 3300025907 | Ga0207645_10020372 | Ga0207645_100203723 | 185 |
| 372 | 3300025909 | Ga0207705_10103307 | Ga0207705_101033072 | 185 |
| 373 | 3300025911 | Ga0207654_10055084 | Ga0207654_100550842 | 185 |
| 374 | 3300025914 | Ga0207671_10052959 | Ga0207671_100529593 | 185 |
| 375 | 3300025915 | Ga0207693_10061659 | Ga0207693_100616592 | 185 |
| 376 | 3300025916 | Ga0207663_10137758 | Ga0207663_101377582 | 185 |
| 377 | 3300025919 | Ga0207657_10016100 | Ga0207657_100161007 | 185 |
| 378 | 3300025920 | Ga0207649_10034482 | Ga0207649_100344821 | 185 |
| 379 | 3300025925 | Ga0207650_10022817 | Ga0207650_100228174 | 185 |
| 380 | 3300025927 | Ga0207687_10003698 | Ga0207687_100036982 | 185 |
| 381 | 3300025928 | Ga0207700_10000623 | Ga0207700_1000062316 | 185 |
| 382 | 3300025929 | Ga0207664_10011407 | Ga0207664_100114072 | 185 |
| 383 | 3300025932 | Ga0207690_10168826 | Ga0207690_101688262 | 185 |
| 384 | 3300025934 | Ga0207686_10060525 | Ga0207686_100605252 | 185 |
| 385 | 3300025936 | Ga0207670_10063991 | Ga0207670_100639913 | 185 |
| 386 | 3300025938 | Ga0207704_10041140 | Ga0207704_100411403 | 185 |
| 387 | 3300025939 | Ga0207665_10001669 | Ga0207665_100016695 | 185 |
| 388 | 3300025941 | Ga0207711_10005790 | Ga0207711_100057904 | 185 |
| 389 | 3300025944 | Ga0207661_10022549 | Ga0207661_100225492 | 185 |
| 390 | 3300025945 | Ga0207679_10098699 | Ga0207679_100986993 | 185 |
| 391 | 3300025960 | Ga0207651_10021074 | Ga0207651_100210742 | 185 |
| 392 | 3300025986 | Ga0207658_10016873 | Ga0207658_100168733 | 185 |
| 393 | 3300026035 | Ga0207703_10007095 | Ga0207703_100070953 | 185 |
| 394 | 3300026067 | Ga0207678_10030649 | Ga0207678_100306495 | 185 |
| 395 | 3300026088 | Ga0207641_10076926 | Ga0207641_100769263 | 185 |
| 396 | 3300026095 | Ga0207676_10003269 | Ga0207676_1000326911 | 185 |
| 397 | 3300026118 | Ga0207675_100029099 | Ga0207675_1000290994 | 185 |
| 398 | 3300026121 | Ga0207683_10003304 | Ga0207683_1000330410 | 185 |
| 399 | 3300027907 | Ga0207428_10074757 | Ga0207428_100747573 | 185 |
| 400 | 3300028379 | Ga0268266_10004404 | Ga0268266_100044042 | 185 |
| 401 | 3300034818 | Ga0373950_0006370 | Ga0373950_0006370_936_1493 | 185 |
| 402 | 3300035084 | Ga0373928_0002249 | Ga0373928_0002249_273_830 | 185 |
| 403 | 3300035085 | Ga0373929_0004239 | Ga0373929_0004239_885_1442 | 185 |
| 404 | 3300035091 | Ga0373951_0014794 | Ga0373951_0014794_64_621 | 185 |
| 405 | 3300035114 | Ga0373939_0003623 | Ga0373939_0003623_1519_2076 | 185 |
| 406 | 3300035115 | Ga0373941_0000578 | Ga0373941_0000578_4406_4963 | 185 |
| 407 | 3300035116 | Ga0373945_0057819 | Ga0373945_0057819_305_862 | 185 |
| 408 | 3300035121 | Ga0373960_0011114 | Ga0373960_0011114_185_742 | 185 |
| 409 | 3300035170 | Ga0373943_0006929 | Ga0373943_0006929_4109_4666 | 185 |
| 410 | 3300035171 | Ga0373946_0078451 | Ga0373946_0078451_70_627 | 185 |
| 411 | 3300035207 | Ga0373942_0013172 | Ga0373942_0013172_1379_1936 | 185 |
| 412 | 3300035242 | Ga0373962_0003681 | Ga0373962_0003681_2034_2591 | 185 |
| 413 | 3300035691 | Ga0373931_0012190 | Ga0373931_0012190_1391_1948 | 185 |
| 414 | 3300035692 | Ga0373935_0024245 | Ga0373935_0024245_2892_3449 | 185 |
| 415 | 3300035695 | Ga0373927_0043102 | Ga0373927_0043102_1875_2432 | 185 |
| 416 | 3300035725 | Ga0373947_0021848 | Ga0373947_0021848_55_612 | 185 |
| 417 | 3300037068 | Ga0373925_0004333 | Ga0373925_0004333_6121_6678 | 185 |
| 418 | 3300046455 | Ga0495603_0003171 | Ga0495603_0003171_2910_3467 | 185 |
| 419 | 3300046459 | Ga0495629_0000026 | Ga0495629_0000026_108580_109137 | 185 |
| 420 | 3300046473 | Ga0495582_0012086 | Ga0495582_0012086_1440_1997 | 185 |
| 421 | 3300046664 | Ga0495659_0074144 | Ga0495659_0074144_296_856 | 185 |
| 422 | 3300046681 | Ga0495647_0013379 | Ga0495647_0013379_38_595 | 185 |
| 423 | 3300046683 | Ga0495658_0001690 | Ga0495658_0001690_10529_11086 | 185 |
| 424 | 3300046689 | Ga0495613_0003849 | Ga0495613_0003849_3929_4486 | 185 |
| 425 | 3300047315 | Ga0495581_0021568 | Ga0495581_0021568_1493_2050 | 185 |
| 426 | 3300047322 | Ga0495680_0029843 | Ga0495680_0029843_3544_4101 | 185 |
| 427 | 3300047673 | Ga0495593_0013909 | Ga0495593_0013909_3532_4089 | 185 |
| 428 | 3300048903 | Ga0496100_0005905 | Ga0496100_0005905_3251_3808 | 185 |
| 429 | 3300048904 | Ga0496101_0214951 | Ga0496101_0214951_267_824 | 185 |
| 430 | 3300048907 | Ga0496104_0089492 | Ga0496104_0089492_2351_2908 | 185 |
| 431 | 3300048908 | Ga0496105_0024612 | Ga0496105_0024612_2381_2938 | 185 |
| 432 | 3300048910 | Ga0496107_0095025 | Ga0496107_0095025_1379_1936 | 185 |
| 433 | 3300048911 | Ga0496108_0110460 | Ga0496108_0110460_1761_2318 | 185 |
| 434 | 3300048914 | Ga0496111_0016164 | Ga0496111_0016164_1271_1828 | 185 |
| 435 | 3300048915 | Ga0496112_0002087 | Ga0496112_0002087_9442_9999 | 185 |
| 436 | 3300048917 | Ga0496114_0099648 | Ga0496114_0099648_267_824 | 185 |
| 437 | 3300048918 | Ga0496115_0008142 | Ga0496115_0008142_3251_3808 | 185 |
| 438 | 3300048918 | Ga0496115_0241224 | Ga0496115_0241224_99_656 | 185 |
| 439 | 3300049571 | Ga0501034_0043434 | Ga0501034_0043434_2863_3423 | 185 |
| 440 | 3300049581 | Ga0501047_0862225 | Ga0501047_0862225_108_668 | 185 |
| 441 | 3300049585 | Ga0501069_0246816 | Ga0501069_0246816_334_894 | 185 |
| 442 | 3300049586 | Ga0501070_0210572 | Ga0501070_0210572_334_894 | 185 |
| 443 | 3300049590 | Ga0501074_0120925 | Ga0501074_0120925_468_1028 | 185 |
| 444 | 3300050511 | nmdc:mga08y16_182951_c1 | nmdc:mga08y16_182951_c1_806_1363 | 185 |
| 445 | 3300050512 | nmdc:mga0n895_217761_c1 | nmdc:mga0n895_217761_c1_139_696 | 185 |
| 446 | 3300050514 | nmdc:mga08x19_22982_c1 | nmdc:mga08x19_22982_c1_2096_2653 | 185 |
| 447 | 3300050515 | nmdc:mga0a205_438984_c1 | nmdc:mga0a205_438984_c1_16_573 | 185 |
| 448 | 3300053085 | Ga0495619_0000360 | Ga0495619_0000360_15446_16003 | 185 |
| 449 | 3300060353 | Ga0501082_0828045 | Ga0501082_0828045_225_785 | 185 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9174 | 61 | 121 |
| 4ija-assembly1.cif.gz_B | structure of s. aureus methicillin resistance factor mecr2 | 0.9165 | 61 | 120 |
| 4ija-assembly1.cif.gz_A | structure of s. aureus methicillin resistance factor mecr2 | 0.9012 | 61 | 120 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.888 | 61 | 121 |
| 3bp8-assembly2.cif.gz_B | crystal structure of mlc/eiib complex | 0.8788 | 62 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58948_3_81_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9261 | 58 | 134 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9174 | 61 | 121 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.907 | 58 | 119 | 1.10.10.10 |
| af_Q57693_7_69_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9028 | 63 | 130 | 1.10.10.10 |
| 4ijaA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9025 | 61 | 121 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B7VP73-F1-model_v4 | Transcriptional regulator | 0.915 | 50 | 161 |
GO:0003677
GO:0003700 |
| AF-B4RBE8-F1-model_v4 | Transcriptional regulator, MarR family | 0.9143 | 50 | 161 |
GO:0003677
GO:0003700 |
| AF-W7C2K5-F1-model_v4 | deleted | 0.9102 | 50 | 169 |
|
| AF-A0A1H5Z1A7-F1-model_v4 | DNA-binding transcriptional regulator, MarR family | 0.8989 | 51 | 160 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A7C5N3D8-F1-model_v4 | MarR family transcriptional regulator | 0.8939 | 51 | 158 |
GO:0003700
GO:0006950 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar