F446313

General Info

Members Datasets Scaffolds Average Seq Length
449 245 436 300

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100000420|Ga0070667_10000042037
Length 353
Sequence VSYPSATNIAGATVGSVRRSTCLTTIRTDADARQRFIRHAGLGRGGLQLYRRDMDVRTGTARSGDLDIYYEDMGDPSDPAVLLIMGLGAQLLLWREGFCERLVNQGLRVIRYDNRDVGLSSKVEGRHTGARLAPRLVRSYLGKPSTAVYTLEDMADDAAALLDHLGIEKGHIVGGSMGGMIAQIFAARHADRTKTLGVIFSSNNQPLLPPPGPRQLKAITTRPKDTSREGVIANAVRVAKIIGSPGYPAPEETVRANAVEGYDRSYYPAGVARHVGAVLGSGSLLRYDKQITVPTVVIHGRADKLMRPSGGRAVAAAIRNARLVMFDGMGHDLPEALWDDMVGELKTTFAEVP

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
6 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
7 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
8 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
9 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
10 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
11 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
12 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
13 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
14 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
168 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
169 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
240 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
244 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
245 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.8
Nodule 0.22
Rhizoplane 13.14
Rhizosphere 67.26
Stem 0
Stem Tuber 0
Unclassified 9.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000851 3300001977 Bacteria 4730
2 JGI24744J21845_10000234 3300002077 Bacteria 8941
3 JGI24744J21845_10011863 3300002077 Bacteria 1775
4 JGI24034J26672_10002283 3300002239 Bacteria 2622
5 JGI24742J22300_10000984 3300002244 Bacteria 4369
6 rootH2_10278128 3300003320 Bacteria 1202
7 Ga0055540_1000118 3300003792 Bacteria 83025
8 Ga0055540_1000243 3300003792 Bacteria 49933
9 Ga0055540_1007321 3300003792 Bacteria 4191
10 Ga0055540_1008481 3300003792 Bacteria 3696
11 Ga0055540_1011409 3300003792 Bacteria 2868
12 Ga0070676_10021413 3300005328 Bacteria 3620
13 Ga0068869_100158472 3300005334 Bacteria 1761
14 Ga0070682_100007410 3300005337 Bacteria 6191
15 Ga0070682_100077619 3300005337 Bacteria 2141
16 Ga0070682_100186887 3300005337 Bacteria 1452
17 Ga0068868_100001453 3300005338 Bacteria 16341
18 Ga0070689_100038797 3300005340 Bacteria 3644
19 Ga0070689_100191189 3300005340 Bacteria 1667
20 Ga0070668_100010406 3300005347 Bacteria 6912
21 Ga0070669_100003791 3300005353 Bacteria 10919
22 Ga0070669_100051235 3300005353 Bacteria 3017
23 Ga0070669_100248880 3300005353 Bacteria 1415
24 Ga0070675_100101976 3300005354 Bacteria 2418
25 Ga0070671_100078525 3300005355 Bacteria 2759
26 Ga0070674_100003542 3300005356 Bacteria 8772
27 Ga0070674_100148974 3300005356 Bacteria 1764
28 Ga0070688_100057504 3300005365 Bacteria 2445
29 Ga0070667_100000420 3300005367 Bacteria 45173
30 Ga0070667_100001169 3300005367 Bacteria 23858
31 Ga0070667_100003133 3300005367 Bacteria 14200
32 Ga0070667_100029313 3300005367 Bacteria 4585
33 Ga0070667_100172439 3300005367 Bacteria 1910
34 Ga0070703_10053274 3300005406 Bacteria 1301
35 Ga0070709_10007976 3300005434 Bacteria 5817
36 Ga0070709_10010605 3300005434 Bacteria 5108
37 Ga0070714_100398078 3300005435 Bacteria 1301
38 Ga0070710_10002175 3300005437 Bacteria 9267
39 Ga0070710_10078265 3300005437 Bacteria 1924
40 Ga0070701_10000249 3300005438 Bacteria 17385
41 Ga0070711_100000280 3300005439 Bacteria 26351
42 Ga0070711_100011522 3300005439 Bacteria 5495
43 Ga0070705_100386451 3300005440 Bacteria 1032
44 Ga0070700_100002356 3300005441 Bacteria 9622
45 Ga0070694_100007691 3300005444 Bacteria 6579
46 Ga0070694_100397800 3300005444 Bacteria 1078
47 Ga0070663_100002851 3300005455 Bacteria 9828
48 Ga0070678_100000626 3300005456 Bacteria 17350
49 Ga0070662_100001387 3300005457 Bacteria 14912
50 Ga0068867_100000835 3300005459 Bacteria 20725
51 Ga0068867_100082410 3300005459 Bacteria 2426
52 Ga0070685_10090031 3300005466 Bacteria 1855
53 Ga0070707_100110690 3300005468 Bacteria 2663
54 Ga0068853_100027061 3300005539 Bacteria 4819
55 Ga0068853_100044604 3300005539 Bacteria 3796
56 Ga0068853_100151812 3300005539 Bacteria 2085
57 Ga0070695_100030973 3300005545 Bacteria 3333
58 Ga0070696_100038494 3300005546 Bacteria 3301
59 Ga0070693_100261658 3300005547 Bacteria 1151
60 Ga0070665_100007820 3300005548 Bacteria 10850
61 Ga0070665_100020517 3300005548 Bacteria 6638
62 Ga0070665_100021322 3300005548 Bacteria 6517
63 Ga0070665_100489499 3300005548 Bacteria 1241
64 Ga0070704_100001127 3300005549 Bacteria 13931
65 Ga0068855_100134431 3300005563 Bacteria 2822
66 Ga0068855_100165959 3300005563 Bacteria 2503
67 Ga0068854_100000551 3300005578 Bacteria 22591
68 Ga0068856_100188210 3300005614 Bacteria 2078
69 Ga0070702_100000921 3300005615 Bacteria 11514
70 Ga0070702_100111525 3300005615 Bacteria 1696
71 Ga0068852_100288494 3300005616 Bacteria 1584
72 Ga0068859_100011753 3300005617 Bacteria 8795
73 Ga0068859_100024328 3300005617 Bacteria 6077
74 Ga0068864_100025062 3300005618 Bacteria 5022
75 Ga0068866_10000378 3300005718 Bacteria 20967
76 Ga0068866_10020034 3300005718 Bacteria 3057
77 Ga0068866_10159364 3300005718 Bacteria 1314
78 Ga0068861_100002652 3300005719 Bacteria 11707
79 Ga0068861_100064586 3300005719 Bacteria 2817
80 Ga0068851_10093715 3300005834 Bacteria 1585
81 Ga0068863_100000818 3300005841 Bacteria 31194
82 Ga0068863_100003009 3300005841 Bacteria 16658
83 Ga0068863_100192413 3300005841 Bacteria 1961
84 Ga0068858_100005943 3300005842 Bacteria 11921
85 Ga0068858_100015983 3300005842 Bacteria 7048
86 Ga0068858_100185655 3300005842 Bacteria 1964
87 Ga0068860_100000048 3300005843 Bacteria 209375
88 Ga0068860_100001259 3300005843 Bacteria 27632
89 Ga0068860_100028547 3300005843 Bacteria 5372
90 Ga0068860_100125648 3300005843 Bacteria 2458
91 Ga0068862_100000053 3300005844 Bacteria 143631
92 Ga0068862_100004226 3300005844 Bacteria 12166
93 Ga0081455_10076214 3300005937 Bacteria 2763
94 Ga0081455_10175682 3300005937 Bacteria 1626
95 Ga0081538_10037563 3300005981 Bacteria 3139
96 Ga0075365_10045729 3300006038 Bacteria 2873
97 Ga0075365_10280111 3300006038 Bacteria 1173
98 Ga0075363_100001525 3300006048 Bacteria 8865
99 Ga0075363_100004874 3300006048 Bacteria 5928
100 Ga0075364_10001444 3300006051 Bacteria 12892
101 Ga0075364_10166224 3300006051 Bacteria 1490
102 Ga0070715_10001947 3300006163 Bacteria 6218
103 Ga0070715_10011038 3300006163 Bacteria 3240
104 Ga0070716_100012631 3300006173 Bacteria 4285
105 Ga0070712_100000899 3300006175 Bacteria 17814
106 Ga0070712_100008409 3300006175 Bacteria 6491
107 Ga0075362_10052936 3300006177 Bacteria 1820
108 Ga0075367_10210857 3300006178 Bacteria 1215
109 Ga0075369_10002208 3300006186 Bacteria 6892
110 Ga0075369_10112814 3300006186 Bacteria 1226
111 Ga0097621_100031308 3300006237 Bacteria 4221
112 Ga0075370_10006676 3300006353 Bacteria 5822
113 Ga0075370_10035826 3300006353 Bacteria 2786
114 Ga0075370_10052377 3300006353 Bacteria 2315
115 Ga0068871_100034431 3300006358 Bacteria 4019
116 Ga0075428_100003373 3300006844 Bacteria 17474
117 Ga0075430_100003049 3300006846 Bacteria 14003
118 Ga0075431_100504491 3300006847 Bacteria 1201
119 Ga0075434_100465662 3300006871 Bacteria 1285
120 Ga0068865_100001854 3300006881 Bacteria 12409
121 Ga0097620_100011753 3300006931 Bacteria 8795
122 Ga0097620_100024329 3300006931 Bacteria 6077
123 Ga0105250_10027701 3300009092 Bacteria 2284
124 Ga0105250_10036472 3300009092 Bacteria 1973
125 Ga0105245_10003469 3300009098 Bacteria 14114
126 Ga0105245_10484429 3300009098 Bacteria 1251
127 Ga0105247_10000195 3300009101 Bacteria 59840
128 Ga0105247_10001612 3300009101 Bacteria 15971
129 Ga0114129_10259129 3300009147 Bacteria 2332
130 Ga0105243_10005656 3300009148 Bacteria 9725
131 Ga0105243_10638342 3300009148 Bacteria 1030
132 Ga0105242_10002300 3300009176 Bacteria 15088
133 Ga0105242_10140857 3300009176 Bacteria 2092
134 Ga0105248_10000151 3300009177 Bacteria 81027
135 Ga0105248_10004806 3300009177 Bacteria 14951
136 Ga0105248_10015518 3300009177 Bacteria 8399
137 Ga0105248_10410892 3300009177 Bacteria 1524
138 Ga0105248_10524024 3300009177 Bacteria 1336
139 Ga0105237_10035159 3300009545 Bacteria 5071
140 Ga0105237_10045846 3300009545 Bacteria 4399
141 Ga0105249_10000022 3300009553 Bacteria 258377
142 Ga0105249_10001128 3300009553 Bacteria 23740
143 Ga0105239_10002159 3300010375 Bacteria 25319
144 Ga0105239_10031775 3300010375 Bacteria 5801
145 Ga0105239_10054725 3300010375 Bacteria 4378
146 Ga0105239_10059229 3300010375 Bacteria 4203
147 Ga0105239_10082420 3300010375 Bacteria 3542
148 Ga0157374_10778634 3300013296 Bacteria 972
149 Ga0157378_10001538 3300013297 Bacteria 20847
150 Ga0163162_10021879 3300013306 Bacteria 6300
151 Ga0163162_10193055 3300013306 Bacteria 2164
152 Ga0157372_10004672 3300013307 Bacteria 14546
153 Ga0157375_10001296 3300013308 Bacteria 21510
154 Ga0157375_10405815 3300013308 Bacteria 1529
155 Ga0163163_10275698 3300014325 Bacteria 1733
156 Ga0157380_10004287 3300014326 Bacteria 9876
157 Ga0157379_10011752 3300014968 Bacteria 7645
158 Ga0157379_10286258 3300014968 Bacteria 1500
159 Ga0157376_10080463 3300014969 Bacteria 2795
160 Ga0157376_10086311 3300014969 Bacteria 2706
161 Ga0163161_10002468 3300017792 Bacteria 13202
162 Ga0163161_10238647 3300017792 Bacteria 1413
163 Ga0209051_1000051 3300025303 Bacteria 283620
164 Ga0209051_1002640 3300025303 Bacteria 12554
165 Ga0209051_1008050 3300025303 Bacteria 5645
166 Ga0209051_1009996 3300025303 Bacteria 4833
167 Ga0207692_10005233 3300025898 Bacteria 5184
168 Ga0207642_10044747 3300025899 Bacteria 1961
169 Ga0207710_10000091 3300025900 Bacteria 121330
170 Ga0207710_10001343 3300025900 Bacteria 12351
171 Ga0207647_10074742 3300025904 Bacteria 2040
172 Ga0207685_10002555 3300025905 Bacteria 4198
173 Ga0207699_10034904 3300025906 Bacteria 2857
174 Ga0207671_10001698 3300025914 Bacteria 24924
175 Ga0207671_10031077 3300025914 Bacteria 3981
176 Ga0207693_10000638 3300025915 Bacteria 31340
177 Ga0207693_10002063 3300025915 Bacteria 17557
178 Ga0207663_10000215 3300025916 Bacteria 25655
179 Ga0207663_10010665 3300025916 Bacteria 4900
180 Ga0207646_10321333 3300025922 Unclassified 1399
181 Ga0207681_10002423 3300025923 Bacteria 11826
182 Ga0207681_10024765 3300025923 Bacteria 3853
183 Ga0207687_10003131 3300025927 Bacteria 11220
184 Ga0207687_10025264 3300025927 Bacteria 3974
185 Ga0207644_10013221 3300025931 Bacteria 5498
186 Ga0207644_10154381 3300025931 Bacteria 1779
187 Ga0207690_10073109 3300025932 Bacteria 2370
188 Ga0207706_10008315 3300025933 Bacteria 9568
189 Ga0207706_10034994 3300025933 Bacteria 4468
190 Ga0207686_10002576 3300025934 Bacteria 9864
191 Ga0207709_10010559 3300025935 Bacteria 5086
192 Ga0207670_10181898 3300025936 Bacteria 1584
193 Ga0207669_10000271 3300025937 Bacteria 23694
194 Ga0207669_10015692 3300025937 Bacteria 3828
195 Ga0207704_10000888 3300025938 Bacteria 13256
196 Ga0207665_10003774 3300025939 Bacteria 10120
197 Ga0207711_10000172 3300025941 Bacteria 69349
198 Ga0207711_10012248 3300025941 Bacteria 7131
199 Ga0207711_10107524 3300025941 Bacteria 2477
200 Ga0207689_10029186 3300025942 Bacteria 4609
201 Ga0207689_10039342 3300025942 Bacteria 3915
202 Ga0207712_10000005 3300025961 Bacteria 608697
203 Ga0207712_10004592 3300025961 Bacteria 8720
204 Ga0207712_10037858 3300025961 Bacteria 3294
205 Ga0207668_10014192 3300025972 Bacteria 4928
206 Ga0207640_10006806 3300025981 Bacteria 6287
207 Ga0207658_10000356 3300025986 Bacteria 45186
208 Ga0207658_10003028 3300025986 Bacteria 12012
209 Ga0207658_10005046 3300025986 Bacteria 9088
210 Ga0207658_10006350 3300025986 Bacteria 8071
211 Ga0207658_10028097 3300025986 Bacteria 3959
212 Ga0207658_10137201 3300025986 Bacteria 1974
213 Ga0207677_10008972 3300026023 Bacteria 5610
214 Ga0207677_10049410 3300026023 Bacteria 2838
215 Ga0207703_10002729 3300026035 Bacteria 15127
216 Ga0207703_10206427 3300026035 Bacteria 1749
217 Ga0207639_10029950 3300026041 Bacteria 3989
218 Ga0207678_10008697 3300026067 Bacteria 8939
219 Ga0207678_10009424 3300026067 Bacteria 8591
220 Ga0207708_10003202 3300026075 Bacteria 12060
221 Ga0207702_10144802 3300026078 Bacteria 2155
222 Ga0207641_10001808 3300026088 Bacteria 20564
223 Ga0207641_10057799 3300026088 Bacteria 3299
224 Ga0207648_10001982 3300026089 Bacteria 22367
225 Ga0207648_10041252 3300026089 Bacteria 4053
226 Ga0207676_10031197 3300026095 Bacteria 4007
227 Ga0207675_100003213 3300026118 Bacteria 16025
228 Ga0207683_10000874 3300026121 Bacteria 27618
229 Ga0207683_10029941 3300026121 Bacteria 4715
230 Ga0207698_10123986 3300026142 Bacteria 2193
231 Ga0268266_10003639 3300028379 Bacteria 15248
232 Ga0268266_10005343 3300028379 Bacteria 12014
233 Ga0268266_10034209 3300028379 Bacteria 4321
234 Ga0268266_10189064 3300028379 Bacteria 1879
235 Ga0268265_10000005 3300028380 Bacteria 535350
236 Ga0268265_10006350 3300028380 Bacteria 8013
237 Ga0268265_10276094 3300028380 Bacteria 1501
238 Ga0268264_10000005 3300028381 Bacteria 934972
239 Ga0268264_10002334 3300028381 Bacteria 16769
240 Ga0268264_10595718 3300028381 Bacteria 1089
241 Ga0265338_10045562 3300028800 Bacteria 4030
242 Ga0265332_10047222 3300031238 Bacteria 1853
243 Ga0265327_10001314 3300031251 Bacteria 32362
244 Ga0265342_10115341 3300031712 Bacteria 1517
245 Ga0307413_10027137 3300031824 Bacteria 3168
246 Ga0307406_10136297 3300031901 Bacteria 1731
247 Ga0307409_100023829 3300031995 Bacteria 4252
248 Ga0307409_100136455 3300031995 Bacteria 2106
249 Ga0307416_100026178 3300032002 Bacteria 4293
250 Ga0307414_10319616 3300032004 Bacteria 1321
251 Ga0307415_100112975 3300032126 Bacteria 2019
252 Ga0373942_0049067 3300035207 Bacteria 1178
253 Ga0373931_0037292 3300035691 Bacteria 2538
254 Ga0373925_0084076 3300037068 Bacteria 2425
255 Ga0436363_1038291 3300039450 Bacteria 2478
256 Ga0439461_0007761 3300041410 Bacteria 1911
257 Ga0439466_0002555 3300041411 Bacteria 7127
258 Ga0439466_0057973 3300041411 Bacteria 1253
259 Ga0439465_0002465 3300041413 Bacteria 6043
260 Ga0439465_0017859 3300041413 Bacteria 2216
261 Ga0439465_0063069 3300041413 Bacteria 1230
262 Ga0451793_0160153 3300041452 Bacteria 1430
263 Ga0439431_0008349 3300041997 Bacteria 2327
264 Ga0439442_003726 3300042002 Bacteria 3020
265 Ga0466972_0018142 3300044658 Bacteria 3520
266 Ga0466972_0059491 3300044658 Bacteria 1834
267 Ga0466965_0003008 3300044683 Bacteria 7321
268 Ga0466965_0007719 3300044683 Bacteria 4950
269 Ga0466965_0039936 3300044683 Bacteria 2308
270 Ga0466965_0103851 3300044683 Bacteria 1455
271 Ga0466965_0177061 3300044683 Bacteria 1124
272 Ga0466966_0003701 3300044684 Bacteria 10082
273 Ga0466966_0078443 3300044684 Bacteria 2059
274 Ga0466961_0014889 3300044693 Bacteria 4996
275 Ga0466961_0017857 3300044693 Bacteria 4561
276 Ga0466963_0192445 3300044694 Bacteria 1425
277 Ga0466964_0006720 3300044706 Bacteria 4289
278 Ga0466971_0015207 3300044719 Bacteria 3386
279 Ga0466968_0002392 3300044735 Bacteria 6875
280 Ga0466970_0003816 3300044765 Bacteria 7382
281 Ga0466970_0043990 3300044765 Bacteria 2377
282 Ga0466970_0118807 3300044765 Bacteria 1447
283 Ga0466970_0145497 3300044765 Bacteria 1307
284 Ga0466957_0012912 3300044842 Bacteria 4840
285 Ga0466957_0032998 3300044842 Bacteria 3103
286 Ga0466957_0267014 3300044842 Bacteria 1142
287 Ga0466960_0003902 3300044901 Bacteria 5785
288 Ga0466960_0026142 3300044901 Bacteria 2648
289 Ga0466959_0019263 3300045049 Bacteria 5017
290 Ga0466959_0061415 3300045049 Bacteria 2732
291 Ga0466959_0146164 3300045049 Bacteria 1668
292 Ga0466958_0003514 3300045836 Bacteria 8144
293 Ga0466958_0044716 3300045836 Bacteria 2669
294 Ga0466958_0132713 3300045836 Bacteria 1565
295 Ga0466967_0070573 3300045976 Bacteria 3125
296 Ga0466967_0095009 3300045976 Bacteria 2716
297 Ga0466967_0273305 3300045976 Bacteria 1620
298 Ga0495638_0135663 3300046460 Bacteria 1441
299 Ga0495641_0020022 3300046461 Bacteria 3406
300 Ga0495662_0012584 3300046476 Bacteria 4128
301 Ga0495640_0027632 3300046533 Bacteria 4090
302 Ga0495658_0033060 3300046683 Bacteria 2830
303 Ga0495613_0079116 3300046689 Bacteria 2391
304 Ga0495581_0014448 3300047315 Bacteria 4579
305 Ga0495676_0107621 3300047321 Bacteria 2052
306 Ga0496100_0000427 3300048903 Bacteria 20442
307 Ga0496100_0005596 3300048903 Bacteria 6784
308 Ga0496100_0016802 3300048903 Bacteria 4304
309 Ga0496100_0022533 3300048903 Bacteria 3812
310 Ga0496100_0037439 3300048903 Bacteria 3067
311 Ga0496101_0000020 3300048904 Bacteria 218859
312 Ga0496101_0000172 3300048904 Bacteria 53462
313 Ga0496101_0001046 3300048904 Bacteria 16358
314 Ga0496101_0005347 3300048904 Bacteria 8183
315 Ga0496101_0013637 3300048904 Bacteria 5451
316 Ga0496101_0016487 3300048904 Bacteria 4993
317 Ga0496101_0053280 3300048904 Bacteria 2918
318 Ga0496102_0000003 3300048905 Bacteria 592263
319 Ga0496102_0000050 3300048905 Bacteria 179469
320 Ga0496102_0002671 3300048905 Bacteria 15169
321 Ga0496102_0021962 3300048905 Bacteria 5651
322 Ga0496102_0022643 3300048905 Bacteria 5568
323 Ga0496102_0043033 3300048905 Bacteria 4093
324 Ga0496102_0169596 3300048905 Bacteria 2055
325 Ga0496102_0212590 3300048905 Bacteria 1823
326 Ga0496103_0000012 3300048906 Bacteria 301778
327 Ga0496103_0000291 3300048906 Bacteria 46970
328 Ga0496103_0000831 3300048906 Bacteria 22700
329 Ga0496103_0003278 3300048906 Bacteria 9916
330 Ga0496103_0011405 3300048906 Bacteria 5266
331 Ga0496103_0024353 3300048906 Bacteria 3654
332 Ga0496104_0011150 3300048907 Bacteria 8041
333 Ga0496104_0070537 3300048907 Bacteria 3322
334 Ga0496104_0184632 3300048907 Bacteria 1996
335 Ga0496105_0034470 3300048908 Bacteria 4163
336 Ga0496105_0089734 3300048908 Bacteria 2539
337 Ga0496106_0001002 3300048909 Bacteria 20648
338 Ga0496106_0002202 3300048909 Bacteria 14552
339 Ga0496106_0005207 3300048909 Bacteria 9631
340 Ga0496107_0000660 3300048910 Bacteria 19504
341 Ga0496107_0003496 3300048910 Bacteria 10507
342 Ga0496107_0017372 3300048910 Bacteria 5060
343 Ga0496107_0075766 3300048910 Bacteria 2449
344 Ga0496107_0180708 3300048910 Bacteria 1566
345 Ga0496107_0183379 3300048910 Bacteria 1554
346 Ga0496108_0000687 3300048911 Bacteria 26194
347 Ga0496109_0001121 3300048912 Bacteria 22262
348 Ga0496109_0002791 3300048912 Bacteria 14627
349 Ga0496109_0009421 3300048912 Bacteria 8324
350 Ga0496109_0039995 3300048912 Bacteria 4246
351 Ga0496110_0006509 3300048913 Bacteria 9265
352 Ga0496110_0031504 3300048913 Bacteria 4576
353 Ga0496111_0004064 3300048914 Bacteria 9191
354 Ga0496112_0020446 3300048915 Bacteria 6276
355 Ga0496112_0025513 3300048915 Bacteria 5675
356 Ga0496112_0128454 3300048915 Bacteria 2505
357 Ga0496113_0148457 3300048916 Bacteria 1848
358 Ga0496114_0001860 3300048917 Bacteria 15987
359 Ga0496114_0006169 3300048917 Bacteria 9433
360 Ga0496114_0009660 3300048917 Bacteria 7664
361 Ga0496115_0000584 3300048918 Bacteria 27971
362 Ga0496115_0003314 3300048918 Bacteria 11561
363 Ga0496115_0024543 3300048918 Bacteria 4688
364 Ga0496116_0000040 3300048919 Bacteria 346900
365 Ga0496116_0003640 3300048919 Bacteria 15131
366 Ga0496116_0006726 3300048919 Bacteria 10351
367 Ga0496117_0000003 3300048920 Bacteria 1881097
368 Ga0496117_0000459 3300048920 Bacteria 68055
369 Ga0496117_0051660 3300048920 Bacteria 2903
370 Ga0496118_0000001 3300048921 Bacteria 1881100
371 Ga0496118_0000452 3300048921 Bacteria 67982
372 Ga0496118_0001853 3300048921 Bacteria 30292
373 Ga0496118_0124849 3300048921 Bacteria 1668
374 Ga0496119_0000591 3300048922 Bacteria 49100
375 Ga0496119_0020823 3300048922 Bacteria 4763
376 Ga0496119_0021040 3300048922 Bacteria 4730
377 Ga0496120_0000293 3300048923 Bacteria 83834
378 Ga0496120_0013626 3300048923 Bacteria 5463
379 Ga0496120_0016712 3300048923 Bacteria 4787
380 Ga0496120_0017240 3300048923 Bacteria 4690
381 Ga0496121_0000002 3300048924 Bacteria 1494588
382 Ga0496121_0000019 3300048924 Bacteria 499976
383 Ga0496121_0003539 3300048924 Bacteria 22126
384 Ga0496122_0000078 3300048925 Bacteria 214068
385 Ga0496122_0091530 3300048925 Bacteria 2070
386 Ga0496123_0023377 3300048926 Bacteria 4731
387 Ga0496123_0037779 3300048926 Bacteria 3404
388 Ga0496124_0000002 3300048927 Bacteria 1494588
389 Ga0496125_0000002 3300048928 Bacteria 1480920
390 Ga0496125_0093467 3300048928 Bacteria 2244
391 Ga0496126_0000011 3300048929 Bacteria 744275
392 Ga0496126_0017919 3300048929 Bacteria 7044
393 Ga0496126_0018584 3300048929 Bacteria 6881
394 Ga0501032_0001855 3300049569 Bacteria 16721
395 Ga0501032_0003108 3300049569 Bacteria 12805
396 Ga0501033_0012173 3300049570 Bacteria 6566
397 Ga0501034_0003235 3300049571 Bacteria 18642
398 Ga0501034_0005687 3300049571 Bacteria 13553
399 Ga0501036_0017700 3300049572 Bacteria 5964
400 Ga0501036_0215437 3300049572 Bacteria 1613
401 Ga0501037_0006227 3300049573 Bacteria 8726
402 Ga0501037_0119976 3300049573 Bacteria 1891
403 Ga0501038_0016409 3300049574 Bacteria 6711
404 Ga0501043_0263994 3300049579 Bacteria 1323
405 Ga0501046_0000969 3300049580 Bacteria 28158
406 Ga0501047_0003181 3300049581 Bacteria 15564
407 Ga0501048_0004345 3300049582 Bacteria 10789
408 Ga0501070_0001271 3300049586 Bacteria 22663
409 Ga0501070_0006887 3300049586 Bacteria 9671
410 Ga0501080_0227516 3300049742 Bacteria 1705
411 Ga0501035_0001201 3300049822 Bacteria 26999
412 Ga0501044_0002283 3300049823 Bacteria 21835
413 Ga0501044_0012703 3300049823 Bacteria 9121
414 nmdc:mga03683_39569_c1 3300050489 Bacteria 1930
415 nmdc:mga03n38_1154_c1 3300050490 Bacteria 7328
416 nmdc:mga03n38_26188_c1 3300050490 Bacteria 2406
417 nmdc:mga03n38_26464_c1 3300050490 Bacteria 2395
418 nmdc:mga00v17_161453_c1 3300050491 Bacteria 1443
419 nmdc:mga00v17_2227_c1 3300050491 Bacteria 9954
420 nmdc:mga00v17_30505_c1 3300050491 Bacteria 3173
421 nmdc:mga00v17_4951_c1 3300050491 Bacteria 6987
422 nmdc:mga0yw44_99724_c1 3300050492 Bacteria 1848
423 nmdc:mga07m45_205349_c1 3300050496 Bacteria 1146
424 nmdc:mga07m45_9140_c1 3300050496 Bacteria 5121
425 nmdc:mga05p37_234750_c1 3300050507 Bacteria 2208
426 nmdc:mga0sz30_12972_c1 3300050516 Bacteria 3253
427 nmdc:mga0sz30_2281_c1 3300050516 Bacteria 6853
428 nmdc:mga0sz30_34404_c1 3300050516 Bacteria 2109
429 Ga0500643_008265 3300053087 Bacteria 4103
430 Ga0500641_0026695 3300053096 Bacteria 2244
431 Ga0500641_0072133 3300053096 Bacteria 1455
432 Ga0500562_008252 3300053108 Bacteria 2630
433 Ga0500628_010846 3300053129 Bacteria 1642
434 Ga0500652_000058 3300053131 Bacteria 50084
435 Ga0500652_018850 3300053131 Bacteria 2555
436 Ga0500645_000070 3300053730 Bacteria 79917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053096 Ga0500641_0072133 Ga0500641_0072133_16_852 260
2 3300005468 Ga0070707_100110690 Ga0070707_1001106905 271
3 3300025922 Ga0207646_10321333 Ga0207646_103213332 271
4 3300044683 Ga0466965_0103851 Ga0466965_0103851_26_982 272
5 3300044684 Ga0466966_0003701 Ga0466966_0003701_2666_3622 272
6 3300044693 Ga0466961_0017857 Ga0466961_0017857_2837_3793 272
7 3300044765 Ga0466970_0118807 Ga0466970_0118807_449_1405 272
8 3300044842 Ga0466957_0012912 Ga0466957_0012912_3519_4475 272
9 3300045049 Ga0466959_0061415 Ga0466959_0061415_208_1164 272
10 3300045836 Ga0466958_0044716 Ga0466958_0044716_1041_1997 272
11 3300003320 rootH2_10278128 rootH2_102781282 283
12 3300005981 Ga0081538_10037563 Ga0081538_100375633 283
13 3300028800 Ga0265338_10045562 Ga0265338_100455623 283
14 3300031238 Ga0265332_10047222 Ga0265332_100472223 283
15 3300031712 Ga0265342_10115341 Ga0265342_101153412 283
16 3300009098 Ga0105245_10484429 Ga0105245_104844292 284
17 3300028381 Ga0268264_10595718 Ga0268264_105957181 284
18 3300006038 Ga0075365_10280111 Ga0075365_102801112 285
19 3300006051 Ga0075364_10166224 Ga0075364_101662242 285
20 3300025906 Ga0207699_10034904 Ga0207699_100349042 285
21 3300048905 Ga0496102_0000003 Ga0496102_0000003_301844_302728 285
22 3300048906 Ga0496103_0000012 Ga0496103_0000012_11356_12240 285
23 3300048919 Ga0496116_0000040 Ga0496116_0000040_56484_57368 285
24 3300048920 Ga0496117_0000003 Ga0496117_0000003_289536_290420 285
25 3300048921 Ga0496118_0000001 Ga0496118_0000001_289539_290423 285
26 3300050491 nmdc:mga00v17_161453_c1 nmdc:mga00v17_161453_c1_41_940 285
27 3300050492 nmdc:mga0yw44_99724_c1 nmdc:mga0yw44_99724_c1_608_1507 285
28 3300050516 nmdc:mga0sz30_34404_c1 nmdc:mga0sz30_34404_c1_504_1403 285
29 iso_pu_bacteria 2643221715 2644635166 285
30 iso_pu_bacteria 2902810491 2902813799 285
31 3300003792 Ga0055540_1007321 Ga0055540_10073214 286
32 3300025303 Ga0209051_1008050 Ga0209051_10080503 286
33 3300045976 Ga0466967_0095009 Ga0466967_0095009_639_1538 286
34 iso_pu_bacteria 2738543034 2739366608 286
35 3300048904 Ga0496101_0053280 Ga0496101_0053280_868_1764 287
36 3300048915 Ga0496112_0128454 Ga0496112_0128454_197_1093 287
37 3300048916 Ga0496113_0148457 Ga0496113_0148457_663_1559 287
38 3300048923 Ga0496120_0013626 Ga0496120_0013626_4046_4942 287
39 3300048925 Ga0496122_0091530 Ga0496122_0091530_198_1094 287
40 3300048926 Ga0496123_0037779 Ga0496123_0037779_858_1754 287
41 3300048929 Ga0496126_0018584 Ga0496126_0018584_3804_4700 287
42 iso_pu_bacteria 2643221687 2644486942 287
43 iso_pu_bacteria 2842134933 2842136695 287
44 iso_pu_bacteria 2902792274 2902792900 287
45 iso_pu_bacteria 2902837492 2902841844 287
46 iso_pu_bacteria 2929212328 2929213686 287
47 iso_pu_bacteria 2939582691 2939586724 288
48 3300005435 Ga0070714_100398078 Ga0070714_1003980782 289
49 3300005719 Ga0068861_100064586 Ga0068861_1000645864 289
50 3300009092 Ga0105250_10027701 Ga0105250_100277012 289
51 3300009177 Ga0105248_10524024 Ga0105248_105240242 289
52 3300025986 Ga0207658_10137201 Ga0207658_101372012 289
53 3300032004 Ga0307414_10319616 Ga0307414_103196162 289
54 3300041410 Ga0439461_0007761 Ga0439461_0007761_449_1345 289
55 3300041411 Ga0439466_0002555 Ga0439466_0002555_2113_3009 289
56 3300041411 Ga0439466_0057973 Ga0439466_0057973_151_1047 289
57 3300041413 Ga0439465_0017859 Ga0439465_0017859_218_1114 289
58 3300044683 Ga0466965_0007719 Ga0466965_0007719_1960_2856 289
59 3300044735 Ga0466968_0002392 Ga0466968_0002392_4530_5426 289
60 3300044765 Ga0466970_0043990 Ga0466970_0043990_882_1778 289
61 3300044842 Ga0466957_0032998 Ga0466957_0032998_1470_2366 289
62 3300044901 Ga0466960_0026142 Ga0466960_0026142_1016_1912 289
63 3300045836 Ga0466958_0132713 Ga0466958_0132713_453_1358 289
64 3300048912 Ga0496109_0009421 Ga0496109_0009421_227_1126 289
65 3300048928 Ga0496125_0093467 Ga0496125_0093467_1141_2049 289
66 3300053730 Ga0500645_000070 Ga0500645_000070_62287_63195 289
67 3300005937 Ga0081455_10076214 Ga0081455_100762142 290
68 3300006177 Ga0075362_10052936 Ga0075362_100529362 290
69 3300006178 Ga0075367_10210857 Ga0075367_102108572 290
70 3300006186 Ga0075369_10112814 Ga0075369_101128141 290
71 3300006353 Ga0075370_10035826 Ga0075370_100358263 290
72 3300006353 Ga0075370_10052377 Ga0075370_100523772 290
73 3300013296 Ga0157374_10778634 Ga0157374_107786341 290
74 3300031824 Ga0307413_10027137 Ga0307413_100271373 290
75 3300031901 Ga0307406_10136297 Ga0307406_101362972 290
76 3300031995 Ga0307409_100023829 Ga0307409_1000238292 290
77 3300032002 Ga0307416_100026178 Ga0307416_1000261784 290
78 3300032126 Ga0307415_100112975 Ga0307415_1001129752 290
79 3300044683 Ga0466965_0003008 Ga0466965_0003008_5390_6307 290
80 3300044901 Ga0466960_0003902 Ga0466960_0003902_864_1781 290
81 3300045976 Ga0466967_0273305 Ga0466967_0273305_304_1206 290
82 3300046460 Ga0495638_0135663 Ga0495638_0135663_68_976 290
83 3300049569 Ga0501032_0003108 Ga0501032_0003108_4619_5524 290
84 3300049571 Ga0501034_0005687 Ga0501034_0005687_12275_13180 290
85 3300049572 Ga0501036_0017700 Ga0501036_0017700_2356_3261 290
86 3300049573 Ga0501037_0006227 Ga0501037_0006227_4898_5803 290
87 3300049574 Ga0501038_0016409 Ga0501038_0016409_4770_5675 290
88 3300049586 Ga0501070_0006887 Ga0501070_0006887_2852_3757 290
89 3300049823 Ga0501044_0012703 Ga0501044_0012703_3761_4666 290
90 3300050489 nmdc:mga03683_39569_c1 nmdc:mga03683_39569_c1_236_1135 290
91 3300050490 nmdc:mga03n38_26188_c1 nmdc:mga03n38_26188_c1_1291_2190 290
92 3300050491 nmdc:mga00v17_30505_c1 nmdc:mga00v17_30505_c1_1922_2824 290
93 3300050496 nmdc:mga07m45_205349_c1 nmdc:mga07m45_205349_c1_114_1013 290
94 3300053087 Ga0500643_008265 Ga0500643_008265_586_1494 290
95 3300053096 Ga0500641_0026695 Ga0500641_0026695_485_1393 290
96 3300053131 Ga0500652_018850 Ga0500652_018850_1438_2346 290
97 iso_pu_bacteria 2751185725 2753037839 290
98 iso_pu_bacteria 2751185792 2753325707 290
99 3300002077 JGI24744J21845_10000234 JGI24744J21845_100002343 291
100 3300002239 JGI24034J26672_10002283 JGI24034J26672_100022832 291
101 3300002244 JGI24742J22300_10000984 JGI24742J22300_100009842 291
102 3300003792 Ga0055540_1000118 Ga0055540_100011819 291
103 3300003792 Ga0055540_1000243 Ga0055540_100024320 291
104 3300003792 Ga0055540_1008481 Ga0055540_10084811 291
105 3300003792 Ga0055540_1011409 Ga0055540_10114092 291
106 3300005328 Ga0070676_10021413 Ga0070676_100214133 291
107 3300005337 Ga0070682_100007410 Ga0070682_1000074102 291
108 3300005337 Ga0070682_100077619 Ga0070682_1000776192 291
109 3300005337 Ga0070682_100186887 Ga0070682_1001868872 291
110 3300005338 Ga0068868_100001453 Ga0068868_10000145310 291
111 3300005340 Ga0070689_100038797 Ga0070689_1000387972 291
112 3300005347 Ga0070668_100010406 Ga0070668_1000104062 291
113 3300005353 Ga0070669_100003791 Ga0070669_1000037919 291
114 3300005353 Ga0070669_100051235 Ga0070669_1000512352 291
115 3300005354 Ga0070675_100101976 Ga0070675_1001019761 291
116 3300005355 Ga0070671_100078525 Ga0070671_1000785252 291
117 3300005356 Ga0070674_100003542 Ga0070674_1000035427 291
118 3300005356 Ga0070674_100148974 Ga0070674_1001489742 291
119 3300005365 Ga0070688_100057504 Ga0070688_1000575042 291
120 3300005367 Ga0070667_100000420 Ga0070667_10000042037 291
121 3300005367 Ga0070667_100001169 Ga0070667_10000116918 291
122 3300005367 Ga0070667_100003133 Ga0070667_1000031338 291
123 3300005367 Ga0070667_100029313 Ga0070667_1000293134 291
124 3300005367 Ga0070667_100172439 Ga0070667_1001724392 291
125 3300005406 Ga0070703_10053274 Ga0070703_100532741 291
126 3300005434 Ga0070709_10010605 Ga0070709_100106055 291
127 3300005437 Ga0070710_10002175 Ga0070710_100021753 291
128 3300005438 Ga0070701_10000249 Ga0070701_1000024911 291
129 3300005439 Ga0070711_100000280 Ga0070711_10000028010 291
130 3300005440 Ga0070705_100386451 Ga0070705_1003864511 291
131 3300005441 Ga0070700_100002356 Ga0070700_1000023561 291
132 3300005444 Ga0070694_100007691 Ga0070694_1000076912 291
133 3300005455 Ga0070663_100002851 Ga0070663_10000285110 291
134 3300005456 Ga0070678_100000626 Ga0070678_1000006268 291
135 3300005457 Ga0070662_100001387 Ga0070662_1000013877 291
136 3300005459 Ga0068867_100000835 Ga0068867_10000083510 291
137 3300005466 Ga0070685_10090031 Ga0070685_100900312 291
138 3300005539 Ga0068853_100027061 Ga0068853_1000270615 291
139 3300005539 Ga0068853_100044604 Ga0068853_1000446044 291
140 3300005545 Ga0070695_100030973 Ga0070695_1000309732 291
141 3300005546 Ga0070696_100038494 Ga0070696_1000384942 291
142 3300005547 Ga0070693_100261658 Ga0070693_1002616581 291
143 3300005548 Ga0070665_100007820 Ga0070665_1000078207 291
144 3300005548 Ga0070665_100020517 Ga0070665_1000205173 291
145 3300005548 Ga0070665_100021322 Ga0070665_1000213223 291
146 3300005548 Ga0070665_100489499 Ga0070665_1004894992 291
147 3300005549 Ga0070704_100001127 Ga0070704_10000112710 291
148 3300005563 Ga0068855_100165959 Ga0068855_1001659592 291
149 3300005578 Ga0068854_100000551 Ga0068854_10000055111 291
150 3300005614 Ga0068856_100188210 Ga0068856_1001882101 291
151 3300005615 Ga0070702_100000921 Ga0070702_1000009213 291
152 3300005616 Ga0068852_100288494 Ga0068852_1002884942 291
153 3300005617 Ga0068859_100011753 Ga0068859_1000117536 291
154 3300005617 Ga0068859_100024328 Ga0068859_1000243284 291
155 3300005718 Ga0068866_10000378 Ga0068866_100003784 291
156 3300005718 Ga0068866_10159364 Ga0068866_101593642 291
157 3300005719 Ga0068861_100002652 Ga0068861_10000265210 291
158 3300005841 Ga0068863_100000818 Ga0068863_10000081810 291
159 3300005841 Ga0068863_100003009 Ga0068863_1000030093 291
160 3300005842 Ga0068858_100005943 Ga0068858_1000059439 291
161 3300005842 Ga0068858_100015983 Ga0068858_1000159837 291
162 3300005842 Ga0068858_100185655 Ga0068858_1001856552 291
163 3300005843 Ga0068860_100000048 Ga0068860_100000048187 291
164 3300005843 Ga0068860_100001259 Ga0068860_10000125911 291
165 3300005843 Ga0068860_100028547 Ga0068860_1000285474 291
166 3300005844 Ga0068862_100000053 Ga0068862_100000053125 291
167 3300005844 Ga0068862_100004226 Ga0068862_10000422610 291
168 3300005937 Ga0081455_10175682 Ga0081455_101756822 291
169 3300006038 Ga0075365_10045729 Ga0075365_100457293 291
170 3300006048 Ga0075363_100001525 Ga0075363_1000015257 291
171 3300006048 Ga0075363_100004874 Ga0075363_1000048744 291
172 3300006051 Ga0075364_10001444 Ga0075364_100014443 291
173 3300006163 Ga0070715_10011038 Ga0070715_100110382 291
174 3300006173 Ga0070716_100012631 Ga0070716_1000126312 291
175 3300006175 Ga0070712_100000899 Ga0070712_10000089910 291
176 3300006186 Ga0075369_10002208 Ga0075369_100022084 291
177 3300006237 Ga0097621_100031308 Ga0097621_1000313084 291
178 3300006353 Ga0075370_10006676 Ga0075370_100066761 291
179 3300006358 Ga0068871_100034431 Ga0068871_1000344314 291
180 3300006844 Ga0075428_100003373 Ga0075428_1000033735 291
181 3300006846 Ga0075430_100003049 Ga0075430_1000030492 291
182 3300006847 Ga0075431_100504491 Ga0075431_1005044911 291
183 3300006881 Ga0068865_100001854 Ga0068865_10000185411 291
184 3300006931 Ga0097620_100011753 Ga0097620_1000117536 291
185 3300006931 Ga0097620_100024329 Ga0097620_1000243294 291
186 3300009092 Ga0105250_10036472 Ga0105250_100364722 291
187 3300009098 Ga0105245_10003469 Ga0105245_1000346911 291
188 3300009101 Ga0105247_10000195 Ga0105247_1000019524 291
189 3300009101 Ga0105247_10001612 Ga0105247_100016127 291
190 3300009147 Ga0114129_10259129 Ga0114129_102591292 291
191 3300009148 Ga0105243_10005656 Ga0105243_100056563 291
192 3300009148 Ga0105243_10638342 Ga0105243_106383421 291
193 3300009176 Ga0105242_10002300 Ga0105242_100023007 291
194 3300009177 Ga0105248_10000151 Ga0105248_1000015114 291
195 3300009177 Ga0105248_10004806 Ga0105248_100048066 291
196 3300009177 Ga0105248_10015518 Ga0105248_100155188 291
197 3300009177 Ga0105248_10410892 Ga0105248_104108922 291
198 3300009545 Ga0105237_10035159 Ga0105237_100351592 291
199 3300009545 Ga0105237_10045846 Ga0105237_100458463 291
200 3300009553 Ga0105249_10000022 Ga0105249_10000022178 291
201 3300009553 Ga0105249_10001128 Ga0105249_1000112811 291
202 3300010375 Ga0105239_10002159 Ga0105239_1000215917 291
203 3300010375 Ga0105239_10031775 Ga0105239_100317752 291
204 3300010375 Ga0105239_10054725 Ga0105239_100547252 291
205 3300010375 Ga0105239_10059229 Ga0105239_100592295 291
206 3300010375 Ga0105239_10082420 Ga0105239_100824203 291
207 3300013297 Ga0157378_10001538 Ga0157378_1000153811 291
208 3300013306 Ga0163162_10021879 Ga0163162_100218794 291
209 3300013306 Ga0163162_10193055 Ga0163162_101930552 291
210 3300013307 Ga0157372_10004672 Ga0157372_100046722 291
211 3300013308 Ga0157375_10001296 Ga0157375_1000129611 291
212 3300013308 Ga0157375_10405815 Ga0157375_104058151 291
213 3300014325 Ga0163163_10275698 Ga0163163_102756982 291
214 3300014326 Ga0157380_10004287 Ga0157380_100042874 291
215 3300014968 Ga0157379_10011752 Ga0157379_100117526 291
216 3300014968 Ga0157379_10286258 Ga0157379_102862582 291
217 3300014969 Ga0157376_10086311 Ga0157376_100863113 291
218 3300017792 Ga0163161_10002468 Ga0163161_1000246812 291
219 3300025303 Ga0209051_1000051 Ga0209051_1000051213 291
220 3300025303 Ga0209051_1002640 Ga0209051_10026407 291
221 3300025303 Ga0209051_1009996 Ga0209051_10099962 291
222 3300025898 Ga0207692_10005233 Ga0207692_100052332 291
223 3300025900 Ga0207710_10000091 Ga0207710_1000009177 291
224 3300025900 Ga0207710_10001343 Ga0207710_1000134310 291
225 3300025904 Ga0207647_10074742 Ga0207647_100747421 291
226 3300025905 Ga0207685_10002555 Ga0207685_100025552 291
227 3300025914 Ga0207671_10001698 Ga0207671_1000169817 291
228 3300025914 Ga0207671_10031077 Ga0207671_100310773 291
229 3300025915 Ga0207693_10000638 Ga0207693_1000063810 291
230 3300025916 Ga0207663_10000215 Ga0207663_1000021510 291
231 3300025923 Ga0207681_10002423 Ga0207681_100024236 291
232 3300025923 Ga0207681_10024765 Ga0207681_100247653 291
233 3300025927 Ga0207687_10003131 Ga0207687_100031314 291
234 3300025931 Ga0207644_10013221 Ga0207644_100132215 291
235 3300025931 Ga0207644_10154381 Ga0207644_101543812 291
236 3300025933 Ga0207706_10008315 Ga0207706_100083153 291
237 3300025934 Ga0207686_10002576 Ga0207686_100025767 291
238 3300025935 Ga0207709_10010559 Ga0207709_100105592 291
239 3300025937 Ga0207669_10000271 Ga0207669_100002717 291
240 3300025937 Ga0207669_10015692 Ga0207669_100156924 291
241 3300025938 Ga0207704_10000888 Ga0207704_100008887 291
242 3300025939 Ga0207665_10003774 Ga0207665_100037743 291
243 3300025941 Ga0207711_10000172 Ga0207711_1000017225 291
244 3300025941 Ga0207711_10012248 Ga0207711_100122482 291
245 3300025941 Ga0207711_10107524 Ga0207711_101075242 291
246 3300025942 Ga0207689_10029186 Ga0207689_100291865 291
247 3300025961 Ga0207712_10000005 Ga0207712_10000005179 291
248 3300025961 Ga0207712_10004592 Ga0207712_100045923 291
249 3300025972 Ga0207668_10014192 Ga0207668_100141921 291
250 3300025981 Ga0207640_10006806 Ga0207640_100068063 291
251 3300025986 Ga0207658_10000356 Ga0207658_1000035638 291
252 3300025986 Ga0207658_10003028 Ga0207658_100030289 291
253 3300025986 Ga0207658_10005046 Ga0207658_100050467 291
254 3300025986 Ga0207658_10006350 Ga0207658_100063505 291
255 3300025986 Ga0207658_10028097 Ga0207658_100280973 291
256 3300026023 Ga0207677_10008972 Ga0207677_100089722 291
257 3300026035 Ga0207703_10002729 Ga0207703_1000272913 291
258 3300026035 Ga0207703_10206427 Ga0207703_102064272 291
259 3300026041 Ga0207639_10029950 Ga0207639_100299503 291
260 3300026067 Ga0207678_10008697 Ga0207678_100086978 291
261 3300026067 Ga0207678_10009424 Ga0207678_100094247 291
262 3300026075 Ga0207708_10003202 Ga0207708_1000320211 291
263 3300026078 Ga0207702_10144802 Ga0207702_101448022 291
264 3300026088 Ga0207641_10001808 Ga0207641_100018083 291
265 3300026088 Ga0207641_10057799 Ga0207641_100577993 291
266 3300026089 Ga0207648_10001982 Ga0207648_1000198210 291
267 3300026118 Ga0207675_100003213 Ga0207675_1000032137 291
268 3300026121 Ga0207683_10000874 Ga0207683_1000087410 291
269 3300026142 Ga0207698_10123986 Ga0207698_101239862 291
270 3300028379 Ga0268266_10003639 Ga0268266_1000363919 291
271 3300028379 Ga0268266_10005343 Ga0268266_100053436 291
272 3300028379 Ga0268266_10034209 Ga0268266_100342092 291
273 3300028380 Ga0268265_10000005 Ga0268265_10000005472 291
274 3300028380 Ga0268265_10006350 Ga0268265_100063502 291
275 3300028381 Ga0268264_10000005 Ga0268264_10000005179 291
276 3300028381 Ga0268264_10002334 Ga0268264_100023347 291
277 3300031251 Ga0265327_10001314 Ga0265327_1000131420 291
278 3300031995 Ga0307409_100136455 Ga0307409_1001364553 291
279 3300035691 Ga0373931_0037292 Ga0373931_0037292_1381_2283 291
280 3300037068 Ga0373925_0084076 Ga0373925_0084076_123_1025 291
281 3300041413 Ga0439465_0002465 Ga0439465_0002465_2815_3717 291
282 3300041452 Ga0451793_0160153 Ga0451793_0160153_45_980 291
283 3300041997 Ga0439431_0008349 Ga0439431_0008349_799_1701 291
284 3300042002 Ga0439442_003726 Ga0439442_003726_622_1524 291
285 3300044658 Ga0466972_0018142 Ga0466972_0018142_2314_3216 291
286 3300044658 Ga0466972_0059491 Ga0466972_0059491_688_1590 291
287 3300044683 Ga0466965_0039936 Ga0466965_0039936_1356_2258 291
288 3300044683 Ga0466965_0177061 Ga0466965_0177061_44_961 291
289 3300044684 Ga0466966_0078443 Ga0466966_0078443_557_1459 291
290 3300044693 Ga0466961_0014889 Ga0466961_0014889_1613_2515 291
291 3300044694 Ga0466963_0192445 Ga0466963_0192445_482_1384 291
292 3300044706 Ga0466964_0006720 Ga0466964_0006720_2061_2963 291
293 3300044719 Ga0466971_0015207 Ga0466971_0015207_1619_2521 291
294 3300044765 Ga0466970_0003816 Ga0466970_0003816_5253_6155 291
295 3300044842 Ga0466957_0267014 Ga0466957_0267014_185_1090 291
296 3300045049 Ga0466959_0019263 Ga0466959_0019263_1628_2530 291
297 3300045049 Ga0466959_0146164 Ga0466959_0146164_143_1045 291
298 3300045836 Ga0466958_0003514 Ga0466958_0003514_2069_2971 291
299 3300045976 Ga0466967_0070573 Ga0466967_0070573_1237_2142 291
300 3300046461 Ga0495641_0020022 Ga0495641_0020022_384_1286 291
301 3300046476 Ga0495662_0012584 Ga0495662_0012584_2589_3491 291
302 3300046533 Ga0495640_0027632 Ga0495640_0027632_1754_2656 291
303 3300046683 Ga0495658_0033060 Ga0495658_0033060_1250_2152 291
304 3300046689 Ga0495613_0079116 Ga0495613_0079116_596_1498 291
305 3300047315 Ga0495581_0014448 Ga0495581_0014448_1878_2780 291
306 3300047321 Ga0495676_0107621 Ga0495676_0107621_1056_1958 291
307 3300048903 Ga0496100_0000427 Ga0496100_0000427_1151_2077 291
308 3300048903 Ga0496100_0005596 Ga0496100_0005596_5062_5964 291
309 3300048903 Ga0496100_0016802 Ga0496100_0016802_2874_3776 291
310 3300048903 Ga0496100_0022533 Ga0496100_0022533_165_1067 291
311 3300048904 Ga0496101_0000020 Ga0496101_0000020_44956_45882 291
312 3300048904 Ga0496101_0000172 Ga0496101_0000172_18117_19019 291
313 3300048904 Ga0496101_0001046 Ga0496101_0001046_6354_7256 291
314 3300048904 Ga0496101_0005347 Ga0496101_0005347_5226_6128 291
315 3300048904 Ga0496101_0013637 Ga0496101_0013637_262_1164 291
316 3300048905 Ga0496102_0000050 Ga0496102_0000050_83143_84045 291
317 3300048905 Ga0496102_0002671 Ga0496102_0002671_12290_13192 291
318 3300048905 Ga0496102_0022643 Ga0496102_0022643_402_1304 291
319 3300048905 Ga0496102_0043033 Ga0496102_0043033_1262_2188 291
320 3300048905 Ga0496102_0169596 Ga0496102_0169596_519_1421 291
321 3300048905 Ga0496102_0212590 Ga0496102_0212590_736_1638 291
322 3300048906 Ga0496103_0000291 Ga0496103_0000291_1160_2086 291
323 3300048906 Ga0496103_0000831 Ga0496103_0000831_15917_16819 291
324 3300048906 Ga0496103_0003278 Ga0496103_0003278_8571_9473 291
325 3300048906 Ga0496103_0024353 Ga0496103_0024353_2680_3585 291
326 3300048907 Ga0496104_0011150 Ga0496104_0011150_762_1664 291
327 3300048907 Ga0496104_0184632 Ga0496104_0184632_476_1378 291
328 3300048908 Ga0496105_0034470 Ga0496105_0034470_2866_3768 291
329 3300048908 Ga0496105_0089734 Ga0496105_0089734_750_1652 291
330 3300048909 Ga0496106_0001002 Ga0496106_0001002_10305_11231 291
331 3300048909 Ga0496106_0002202 Ga0496106_0002202_5668_6570 291
332 3300048909 Ga0496106_0005207 Ga0496106_0005207_3711_4613 291
333 3300048910 Ga0496107_0000660 Ga0496107_0000660_1033_1959 291
334 3300048910 Ga0496107_0003496 Ga0496107_0003496_4565_5467 291
335 3300048910 Ga0496107_0017372 Ga0496107_0017372_2392_3294 291
336 3300048910 Ga0496107_0075766 Ga0496107_0075766_1040_1969 291
337 3300048910 Ga0496107_0183379 Ga0496107_0183379_118_1020 291
338 3300048912 Ga0496109_0001121 Ga0496109_0001121_961_1887 291
339 3300048912 Ga0496109_0039995 Ga0496109_0039995_2334_3236 291
340 3300048913 Ga0496110_0006509 Ga0496110_0006509_5139_6065 291
341 3300048914 Ga0496111_0004064 Ga0496111_0004064_7093_8019 291
342 3300048915 Ga0496112_0025513 Ga0496112_0025513_3860_4762 291
343 3300048917 Ga0496114_0001860 Ga0496114_0001860_9101_10003 291
344 3300048917 Ga0496114_0006169 Ga0496114_0006169_1121_2047 291
345 3300048917 Ga0496114_0009660 Ga0496114_0009660_6386_7288 291
346 3300048918 Ga0496115_0000584 Ga0496115_0000584_10652_11554 291
347 3300048918 Ga0496115_0003314 Ga0496115_0003314_8210_9112 291
348 3300048918 Ga0496115_0024543 Ga0496115_0024543_1159_2085 291
349 3300048919 Ga0496116_0003640 Ga0496116_0003640_11215_12141 291
350 3300048919 Ga0496116_0006726 Ga0496116_0006726_5440_6342 291
351 3300048920 Ga0496117_0000459 Ga0496117_0000459_15362_16264 291
352 3300048920 Ga0496117_0051660 Ga0496117_0051660_256_1182 291
353 3300048921 Ga0496118_0000452 Ga0496118_0000452_37494_38399 291
354 3300048921 Ga0496118_0001853 Ga0496118_0001853_23497_24399 291
355 3300048921 Ga0496118_0124849 Ga0496118_0124849_615_1541 291
356 3300048922 Ga0496119_0000591 Ga0496119_0000591_39257_40159 291
357 3300048922 Ga0496119_0020823 Ga0496119_0020823_1141_2067 291
358 3300048922 Ga0496119_0021040 Ga0496119_0021040_73_975 291
359 3300048923 Ga0496120_0000293 Ga0496120_0000293_26455_27357 291
360 3300048923 Ga0496120_0016712 Ga0496120_0016712_1038_1964 291
361 3300048923 Ga0496120_0017240 Ga0496120_0017240_3269_4171 291
362 3300048924 Ga0496121_0000002 Ga0496121_0000002_751480_752406 291
363 3300048924 Ga0496121_0000019 Ga0496121_0000019_311244_312146 291
364 3300048924 Ga0496121_0003539 Ga0496121_0003539_2457_3359 291
365 3300048925 Ga0496122_0000078 Ga0496122_0000078_65979_66905 291
366 3300048926 Ga0496123_0023377 Ga0496123_0023377_2779_3705 291
367 3300048927 Ga0496124_0000002 Ga0496124_0000002_742183_743109 291
368 3300048928 Ga0496125_0000002 Ga0496125_0000002_751480_752406 291
369 3300048929 Ga0496126_0000011 Ga0496126_0000011_742183_743109 291
370 3300048929 Ga0496126_0017919 Ga0496126_0017919_5401_6303 291
371 3300049569 Ga0501032_0001855 Ga0501032_0001855_7060_7965 291
372 3300049570 Ga0501033_0012173 Ga0501033_0012173_5209_6114 291
373 3300049571 Ga0501034_0003235 Ga0501034_0003235_9451_10356 291
374 3300049572 Ga0501036_0215437 Ga0501036_0215437_73_978 291
375 3300049573 Ga0501037_0119976 Ga0501037_0119976_334_1239 291
376 3300049579 Ga0501043_0263994 Ga0501043_0263994_316_1221 291
377 3300049580 Ga0501046_0000969 Ga0501046_0000969_26019_26924 291
378 3300049581 Ga0501047_0003181 Ga0501047_0003181_10270_11175 291
379 3300049582 Ga0501048_0004345 Ga0501048_0004345_1013_1918 291
380 3300049586 Ga0501070_0001271 Ga0501070_0001271_4102_5007 291
381 3300049742 Ga0501080_0227516 Ga0501080_0227516_17_922 291
382 3300049822 Ga0501035_0001201 Ga0501035_0001201_14637_15542 291
383 3300049823 Ga0501044_0002283 Ga0501044_0002283_9323_10228 291
384 3300050490 nmdc:mga03n38_1154_c1 nmdc:mga03n38_1154_c1_2102_3007 291
385 3300050490 nmdc:mga03n38_26464_c1 nmdc:mga03n38_26464_c1_1145_2047 291
386 3300050491 nmdc:mga00v17_2227_c1 nmdc:mga00v17_2227_c1_3750_4655 291
387 3300050491 nmdc:mga00v17_4951_c1 nmdc:mga00v17_4951_c1_3137_4039 291
388 3300050496 nmdc:mga07m45_9140_c1 nmdc:mga07m45_9140_c1_3519_4424 291
389 3300050507 nmdc:mga05p37_234750_c1 nmdc:mga05p37_234750_c1_1292_2194 291
390 3300050516 nmdc:mga0sz30_12972_c1 nmdc:mga0sz30_12972_c1_1674_2576 291
391 3300050516 nmdc:mga0sz30_2281_c1 nmdc:mga0sz30_2281_c1_3447_4349 291
392 3300053108 Ga0500562_008252 Ga0500562_008252_1030_1932 291
393 3300053129 Ga0500628_010846 Ga0500628_010846_591_1493 291
394 3300053131 Ga0500652_000058 Ga0500652_000058_11166_12104 291
395 iso_pu_bacteria 2738541264 2738664179 291
396 iso_pu_bacteria 2738541356 2739143314 291
397 3300044765 Ga0466970_0145497 Ga0466970_0145497_163_1089 295
398 3300006871 Ga0075434_100465662 Ga0075434_1004656621 296
399 3300005444 Ga0070694_100397800 Ga0070694_1003978001 297
400 3300009176 Ga0105242_10140857 Ga0105242_101408572 297
401 3300026089 Ga0207648_10041252 Ga0207648_100412522 297
402 3300039450 Ga0436363_1038291 Ga0436363_1038291_933_1874 299
403 3300005841 Ga0068863_100192413 Ga0068863_1001924131 300
404 3300001977 JGI24746J21847_1000851 JGI24746J21847_10008513 301
405 3300002077 JGI24744J21845_10011863 JGI24744J21845_100118632 301
406 3300005334 Ga0068869_100158472 Ga0068869_1001584722 301
407 3300005340 Ga0070689_100191189 Ga0070689_1001911892 301
408 3300005353 Ga0070669_100248880 Ga0070669_1002488802 301
409 3300005434 Ga0070709_10007976 Ga0070709_100079765 301
410 3300005437 Ga0070710_10078265 Ga0070710_100782652 301
411 3300005439 Ga0070711_100011522 Ga0070711_1000115225 301
412 3300005459 Ga0068867_100082410 Ga0068867_1000824101 301
413 3300005539 Ga0068853_100151812 Ga0068853_1001518122 301
414 3300005563 Ga0068855_100134431 Ga0068855_1001344313 301
415 3300005615 Ga0070702_100111525 Ga0070702_1001115252 301
416 3300005618 Ga0068864_100025062 Ga0068864_1000250622 301
417 3300005718 Ga0068866_10020034 Ga0068866_100200343 301
418 3300005834 Ga0068851_10093715 Ga0068851_100937152 301
419 3300005843 Ga0068860_100125648 Ga0068860_1001256482 301
420 3300006163 Ga0070715_10001947 Ga0070715_100019473 301
421 3300006175 Ga0070712_100008409 Ga0070712_1000084094 301
422 3300014969 Ga0157376_10080463 Ga0157376_100804631 301
423 3300017792 Ga0163161_10238647 Ga0163161_102386472 301
424 3300025899 Ga0207642_10044747 Ga0207642_100447472 301
425 3300025915 Ga0207693_10002063 Ga0207693_100020634 301
426 3300025916 Ga0207663_10010665 Ga0207663_100106652 301
427 3300025927 Ga0207687_10025264 Ga0207687_100252642 301
428 3300025932 Ga0207690_10073109 Ga0207690_100731092 301
429 3300025933 Ga0207706_10034994 Ga0207706_100349942 301
430 3300025936 Ga0207670_10181898 Ga0207670_101818982 301
431 3300025942 Ga0207689_10039342 Ga0207689_100393424 301
432 3300025961 Ga0207712_10037858 Ga0207712_100378582 301
433 3300026023 Ga0207677_10049410 Ga0207677_100494102 301
434 3300026095 Ga0207676_10031197 Ga0207676_100311973 301
435 3300026121 Ga0207683_10029941 Ga0207683_100299412 301
436 3300028379 Ga0268266_10189064 Ga0268266_101890642 301
437 3300028380 Ga0268265_10276094 Ga0268265_102760942 301
438 3300035207 Ga0373942_0049067 Ga0373942_0049067_146_1078 301
439 3300041413 Ga0439465_0063069 Ga0439465_0063069_50_982 301
440 3300048903 Ga0496100_0037439 Ga0496100_0037439_1416_2348 301
441 3300048904 Ga0496101_0016487 Ga0496101_0016487_1863_2795 301
442 3300048905 Ga0496102_0021962 Ga0496102_0021962_1622_2554 301
443 3300048906 Ga0496103_0011405 Ga0496103_0011405_2812_3744 301
444 3300048907 Ga0496104_0070537 Ga0496104_0070537_1737_2669 301
445 3300048910 Ga0496107_0180708 Ga0496107_0180708_412_1344 301
446 3300048911 Ga0496108_0000687 Ga0496108_0000687_18156_19088 301
447 3300048912 Ga0496109_0002791 Ga0496109_0002791_10382_11314 301
448 3300048913 Ga0496110_0031504 Ga0496110_0031504_2263_3195 301
449 3300048915 Ga0496112_0020446 Ga0496112_0020446_1915_2847 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

79

241

0.88

PF12146

Hydrolase_4

Serine aminopeptidase, S33

75

335

0.8

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

81

344

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eb3-assembly3.cif.gz_C structural and enzymatic characterization of an esterase from a metagenomic library 0.8423 9 298
6eb3-assembly4.cif.gz_D structural and enzymatic characterization of an esterase from a metagenomic library 0.8378 9 298
5ie5-assembly2.cif.gz_C-2 crystal structure of a lactonase double mutant in complex with substrate a 0.8284 25 155
6eb3-assembly3.cif.gz_C structural and enzymatic characterization of an esterase from a metagenomic library 0.821 9 298
6eb3-assembly4.cif.gz_D structural and enzymatic characterization of an esterase from a metagenomic library 0.8173 9 298
ID Description Score Start End Superfamily
af_P96935_7_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9527 20 299 3.40.50.1820
af_P96935_7_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9055 20 299 3.40.50.1820
af_Q4CQ95_18_306_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.898 22 297 3.40.50.1820
af_A4HXH8_39_324_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8954 22 292 3.40.50.1820
af_A4HXI2_64_377_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8933 22 296 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5A7S8M7-F1-model_v4 Alpha/beta hydrolase 0.9544 42 301 GO:0004806
GO:0046503
AF-A0A2S8MH70-F1-model_v4 deleted 0.9503 87 263
AF-A0A147GQ79-F1-model_v4 deleted 0.9434 107 297
AF-A0A2L0GHY4-F1-model_v4 Alpha/beta hydrolase 0.9311 23 298 GO:0004806
GO:0046503
AF-A0A522TTL1-F1-model_v4 Alpha/beta hydrolase 0.9305 110 300 GO:0004806
GO:0046503

Feature Viewer

pLDDT pTM Quality
86.36 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map