F446254

General Info

Members Datasets Scaffolds Average Seq Length
448 199 896 616

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_32718_c1|nmdc:mga0yw44_32718_c1_233_2080
Length 615
Sequence MAGSEATRTAPTMSDHKPVDHPEGIVTNFIRTRIDGDLAAGKYARRTWAGAPGDAAKQAGXXXXPAKIRTRFPPEPNGYLHFGHAKSICLNFGLARDYAGVCHMRFDDTNPEKEEQEYVDSILDSVHWLGFGWEGFGVNHQYFASDYFDILYRFAELFIEKGLAYVDSQSAEELKLARGSFTEAGKESPYRNRTPAENLALFREMRDGKHAERTHVLRLKIDMASPNINMRDPAIYRIRHAEHHRTGAKWCVYPLYDYTHCISDALENITHSICTLEFQDHRPLYDWVLAKLAEFGQLQVPLPQQIEFARLQLTYVVLSKRKLIKLVKEGYVSGWDDPRMPTLVGARRRGYTPAGFRLFAERIGVAKADSLIDYSTLEECMREDLNETAPRRVAVLDPLKLIIDNYPAGEQEESRMPNHPQKPVLGERVVPFTGELWIEREDFMEVPSKGYFRLFPGNKVRLRHGFVVECIGADKDAAGNITAVHCNYFPDSKSGTDGSNNYKVKGNIHWVSAKHAYAAEVRLYDRLFKVPHPGGRREGDPEDLERDFVEDINPDSVKVITAQVEPALKDAKAEEIFQFERHGYFVADRIDSQPGTPKFNRAVSMKDSWAPPKKK

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.46
Nodule 0
Rhizoplane 3.12
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_32718_c1 3300050492 Bacteria 3032
2 JGI24743J22301_10002764 3300001991 Bacteria 2693
3 JGI24749J21850_1002723 3300002076 Bacteria 2475
4 Ga0070658_10056038 3300005327 Bacteria 3203
5 Ga0070676_10000409 3300005328 Bacteria 20112
6 Ga0070676_10007710 3300005328 Bacteria 5779
7 Ga0070683_100004039 3300005329 Bacteria 12016
8 Ga0070683_100080073 3300005329 Bacteria 3058
9 Ga0070690_100003370 3300005330 Bacteria 8723
10 Ga0070690_100016902 3300005330 Bacteria 4379
11 Ga0070690_100026835 3300005330 Bacteria 3556
12 Ga0070670_100014220 3300005331 Bacteria 6827
13 Ga0070670_100028203 3300005331 Bacteria 4831
14 Ga0070670_100040937 3300005331 Bacteria 3982
15 Ga0070670_100045408 3300005331 Bacteria 3777
16 Ga0068869_100000241 3300005334 Bacteria 28780
17 Ga0068869_100003459 3300005334 Bacteria 9654
18 Ga0068869_100033795 3300005334 Bacteria 3613
19 Ga0070666_10008499 3300005335 Bacteria 6377
20 Ga0068868_100078105 3300005338 Bacteria 2649
21 Ga0070660_100002491 3300005339 Bacteria 12640
22 Ga0070660_100072357 3300005339 Bacteria 2694
23 Ga0070689_100009420 3300005340 Bacteria 6924
24 Ga0070689_100043341 3300005340 Bacteria 3458
25 Ga0070661_100002610 3300005344 Bacteria 12360
26 Ga0070661_100005939 3300005344 Bacteria 8409
27 Ga0070661_100008060 3300005344 Bacteria 7271
28 Ga0070692_10017508 3300005345 Bacteria 3427
29 Ga0070668_100001824 3300005347 Bacteria 15505
30 Ga0070668_100008440 3300005347 Bacteria 7648
31 Ga0070668_100010286 3300005347 Bacteria 6945
32 Ga0070668_100032019 3300005347 Bacteria 4001
33 Ga0070668_100032199 3300005347 Bacteria 3990
34 Ga0070669_100001002 3300005353 Bacteria 20558
35 Ga0070669_100010129 3300005353 Bacteria 6706
36 Ga0070669_100010823 3300005353 Bacteria 6475
37 Ga0070669_100080667 3300005353 Bacteria 2422
38 Ga0070675_100001486 3300005354 Bacteria 17301
39 Ga0070675_100016434 3300005354 Bacteria 5873
40 Ga0070675_100060069 3300005354 Bacteria 3138
41 Ga0070671_100003732 3300005355 Bacteria 11955
42 Ga0070671_100005429 3300005355 Bacteria 10175
43 Ga0070671_100007647 3300005355 Bacteria 8640
44 Ga0070671_100018327 3300005355 Bacteria 5685
45 Ga0070671_100029995 3300005355 Bacteria 4487
46 Ga0070671_100078708 3300005355 Bacteria 2755
47 Ga0070674_100032646 3300005356 Bacteria 3458
48 Ga0070674_100041610 3300005356 Bacteria 3115
49 Ga0070673_100000369 3300005364 Bacteria 23581
50 Ga0070673_100022022 3300005364 Bacteria 4632
51 Ga0070673_100022764 3300005364 Bacteria 4566
52 Ga0070659_100003342 3300005366 Bacteria 11413
53 Ga0070659_100003585 3300005366 Bacteria 11042
54 Ga0070659_100006802 3300005366 Bacteria 8277
55 Ga0070659_100060471 3300005366 Bacteria 2992
56 Ga0070667_100001414 3300005367 Bacteria 21485
57 Ga0070667_100004046 3300005367 Bacteria 12399
58 Ga0070667_100008559 3300005367 Bacteria 8480
59 Ga0070667_100093680 3300005367 Bacteria 2587
60 Ga0070709_10004947 3300005434 Bacteria 7201
61 Ga0070714_100000881 3300005435 Bacteria 21343
62 Ga0070714_100064775 3300005435 Bacteria 3147
63 Ga0070713_100000161 3300005436 Bacteria 45444
64 Ga0070713_100004999 3300005436 Bacteria 9004
65 Ga0070701_10003210 3300005438 Bacteria 6438
66 Ga0070705_100015928 3300005440 Bacteria 3896
67 Ga0070700_100001388 3300005441 Bacteria 12024
68 Ga0070708_100000721 3300005445 Bacteria 25106
69 Ga0070663_100003516 3300005455 Bacteria 9045
70 Ga0070663_100012142 3300005455 Bacteria 5437
71 Ga0070663_100018475 3300005455 Bacteria 4573
72 Ga0070678_100000697 3300005456 Bacteria 16601
73 Ga0070678_100010882 3300005456 Bacteria 5580
74 Ga0070662_100000340 3300005457 Bacteria 28030
75 Ga0070662_100010780 3300005457 Bacteria 6017
76 Ga0070681_10004643 3300005458 Bacteria 13120
77 Ga0070681_10009351 3300005458 Bacteria 9643
78 Ga0070681_10065093 3300005458 Bacteria 3615
79 Ga0070681_10150807 3300005458 Bacteria 2251
80 Ga0068867_100002597 3300005459 Bacteria 12738
81 Ga0068867_100009237 3300005459 Bacteria 6957
82 Ga0070685_10003123 3300005466 Bacteria 8423
83 Ga0070707_100053504 3300005468 Bacteria 3870
84 Ga0070698_100031587 3300005471 Bacteria 5489
85 Ga0070679_100031360 3300005530 Bacteria 5250
86 Ga0070684_100003132 3300005535 Bacteria 12343
87 Ga0070684_100037056 3300005535 Bacteria 4181
88 Ga0070697_100012449 3300005536 Bacteria 6666
89 Ga0068853_100004329 3300005539 Bacteria 10982
90 Ga0068853_100005128 3300005539 Bacteria 10239
91 Ga0068853_100104565 3300005539 Bacteria 2507
92 Ga0070672_100000618 3300005543 Bacteria 20856
93 Ga0070672_100000746 3300005543 Bacteria 19295
94 Ga0070672_100018599 3300005543 Bacteria 5028
95 Ga0070672_100027958 3300005543 Bacteria 4213
96 Ga0070672_100075869 3300005543 Bacteria 2685
97 Ga0070686_100006481 3300005544 Bacteria 6509
98 Ga0070686_100025178 3300005544 Bacteria 3577
99 Ga0070695_100021162 3300005545 Bacteria 3977
100 Ga0070696_100002786 3300005546 Bacteria 11603
101 Ga0070696_100054171 3300005546 Bacteria 2794
102 Ga0070696_100070273 3300005546 Bacteria 2462
103 Ga0070665_100002113 3300005548 Bacteria 22201
104 Ga0070665_100038023 3300005548 Bacteria 4838
105 Ga0070665_100040078 3300005548 Bacteria 4708
106 Ga0070665_100057008 3300005548 Bacteria 3917
107 Ga0068855_100003919 3300005563 Bacteria 18171
108 Ga0068855_100009230 3300005563 Bacteria 11912
109 Ga0068855_100126830 3300005563 Bacteria 2917
110 Ga0070664_100006183 3300005564 Bacteria 9676
111 Ga0070664_100020841 3300005564 Bacteria 5400
112 Ga0070664_100058031 3300005564 Bacteria 3292
113 Ga0070664_100069609 3300005564 Bacteria 3011
114 Ga0068857_100026296 3300005577 Bacteria 5128
115 Ga0068857_100040945 3300005577 Bacteria 4107
116 Ga0068857_100133491 3300005577 Bacteria 2240
117 Ga0068854_100004294 3300005578 Bacteria 8980
118 Ga0068854_100021837 3300005578 Bacteria 4350
119 Ga0068856_100000121 3300005614 Bacteria 78250
120 Ga0068856_100002936 3300005614 Bacteria 17469
121 Ga0068856_100006037 3300005614 Bacteria 11913
122 Ga0068856_100016863 3300005614 Bacteria 7079
123 Ga0068856_100118836 3300005614 Bacteria 2644
124 Ga0070702_100001194 3300005615 Bacteria 10479
125 Ga0070702_100053589 3300005615 Bacteria 2318
126 Ga0068852_100001886 3300005616 Bacteria 14284
127 Ga0068852_100005100 3300005616 Bacteria 9351
128 Ga0068859_100001091 3300005617 Bacteria 27670
129 Ga0068859_100069502 3300005617 Bacteria 3557
130 Ga0068864_100000584 3300005618 Bacteria 31036
131 Ga0068864_100004990 3300005618 Bacteria 10872
132 Ga0068864_100006490 3300005618 Bacteria 9583
133 Ga0068864_100050009 3300005618 Bacteria 3597
134 Ga0068866_10000796 3300005718 Bacteria 14142
135 Ga0068861_100000823 3300005719 Bacteria 18760
136 Ga0068861_100027431 3300005719 Bacteria 4146
137 Ga0068861_100043144 3300005719 Bacteria 3383
138 Ga0068851_10000310 3300005834 Bacteria 22166
139 Ga0068851_10000364 3300005834 Bacteria 20414
140 Ga0068851_10017676 3300005834 Bacteria 3428
141 Ga0068870_10015189 3300005840 Bacteria 3649
142 Ga0068870_10034161 3300005840 Bacteria 2601
143 Ga0068863_100001050 3300005841 Bacteria 27624
144 Ga0068863_100003644 3300005841 Bacteria 15215
145 Ga0068863_100006241 3300005841 Bacteria 11708
146 Ga0068863_100024523 3300005841 Bacteria 5753
147 Ga0068863_100041202 3300005841 Bacteria 4390
148 Ga0068863_100075008 3300005841 Bacteria 3200
149 Ga0068863_100088944 3300005841 Bacteria 2927
150 Ga0068858_100003652 3300005842 Bacteria 15229
151 Ga0068858_100007734 3300005842 Bacteria 10371
152 Ga0068858_100013481 3300005842 Bacteria 7712
153 Ga0068858_100018130 3300005842 Bacteria 6595
154 Ga0068858_100034960 3300005842 Bacteria 4661
155 Ga0068858_100058532 3300005842 Bacteria 3563
156 Ga0068858_100074982 3300005842 Bacteria 3142
157 Ga0068860_100001726 3300005843 Bacteria 23325
158 Ga0068860_100028277 3300005843 Bacteria 5396
159 Ga0068860_100069247 3300005843 Bacteria 3353
160 Ga0068860_100133901 3300005843 Bacteria 2380
161 Ga0068862_100002356 3300005844 Bacteria 16824
162 Ga0068862_100016027 3300005844 Bacteria 6233
163 Ga0068862_100017315 3300005844 Bacteria 6000
164 Ga0068862_100029557 3300005844 Bacteria 4618
165 Ga0068862_100080505 3300005844 Bacteria 2824
166 Ga0081539_10010944 3300005985 Bacteria 7275
167 Ga0075368_10003125 3300006042 Bacteria 5493
168 Ga0075369_10017083 3300006186 Bacteria 2936
169 Ga0075366_10048518 3300006195 Bacteria 2518
170 Ga0097621_100004190 3300006237 Bacteria 10005
171 Ga0097621_100020302 3300006237 Bacteria 5118
172 Ga0097621_100021787 3300006237 Bacteria 4965
173 Ga0097621_100033429 3300006237 Bacteria 4096
174 Ga0097621_100052218 3300006237 Bacteria 3330
175 Ga0097621_100140224 3300006237 Bacteria 2065
176 Ga0075370_10009875 3300006353 Bacteria 4973
177 Ga0068871_100010324 3300006358 Bacteria 6808
178 Ga0068871_100020774 3300006358 Bacteria 5035
179 Ga0068871_100024180 3300006358 Bacteria 4707
180 Ga0068865_100011577 3300006881 Bacteria 5527
181 Ga0068865_100020446 3300006881 Bacteria 4292
182 Ga0068865_100041746 3300006881 Bacteria 3124
183 Ga0097620_100001092 3300006931 Bacteria 27670
184 Ga0097620_100069499 3300006931 Bacteria 3557
185 Ga0099794_10008573 3300007265 Bacteria 4255
186 Ga0105240_10003341 3300009093 Bacteria 24979
187 Ga0105240_10044573 3300009093 Bacteria 5635
188 Ga0111539_10062512 3300009094 Bacteria 4407
189 Ga0105245_10021004 3300009098 Bacteria 5727
190 Ga0105243_10022296 3300009148 Bacteria 4812
191 Ga0105243_10025731 3300009148 Bacteria 4500
192 Ga0105241_10047110 3300009174 Bacteria 3277
193 Ga0105242_10017710 3300009176 Bacteria 5556
194 Ga0105242_10087349 3300009176 Bacteria 2618
195 Ga0105248_10009560 3300009177 Bacteria 10671
196 Ga0105248_10011247 3300009177 Bacteria 9870
197 Ga0105248_10021011 3300009177 Bacteria 7234
198 Ga0105248_10043658 3300009177 Bacteria 5027
199 Ga0105238_10002111 3300009551 Bacteria 20074
200 Ga0105238_10024732 3300009551 Bacteria 6122
201 Ga0105239_10022524 3300010375 Bacteria 6946
202 Ga0105239_10061782 3300010375 Bacteria 4112
203 Ga0157373_10000313 3300013100 Bacteria 39072
204 Ga0157371_10001341 3300013102 Bacteria 25918
205 Ga0157371_10061896 3300013102 Bacteria 2654
206 Ga0157370_10012667 3300013104 Bacteria 8733
207 Ga0157370_10017427 3300013104 Bacteria 7247
208 Ga0157370_10036534 3300013104 Bacteria 4767
209 Ga0157370_10127357 3300013104 Bacteria 2377
210 Ga0157369_10087933 3300013105 Bacteria 3317
211 Ga0157374_10026634 3300013296 Bacteria 5205
212 Ga0157374_10068695 3300013296 Bacteria 3334
213 Ga0157374_10080110 3300013296 Bacteria 3096
214 Ga0157378_10007496 3300013297 Bacteria 9528
215 Ga0157378_10041300 3300013297 Bacteria 4091
216 Ga0157378_10053727 3300013297 Bacteria 3587
217 Ga0163162_10027844 3300013306 Bacteria 5590
218 Ga0163162_10039103 3300013306 Bacteria 4738
219 Ga0157372_10005180 3300013307 Bacteria 13866
220 Ga0157372_10017912 3300013307 Bacteria 7611
221 Ga0157372_10045220 3300013307 Bacteria 4882
222 Ga0157372_10065779 3300013307 Bacteria 4072
223 Ga0157375_10013307 3300013308 Bacteria 7317
224 Ga0157375_10014402 3300013308 Bacteria 7053
225 Ga0157375_10042237 3300013308 Bacteria 4412
226 Ga0157375_10047351 3300013308 Bacteria 4198
227 Ga0157375_10129433 3300013308 Bacteria 2642
228 Ga0163163_10000642 3300014325 Bacteria 29971
229 Ga0163163_10005036 3300014325 Bacteria 11387
230 Ga0163163_10012468 3300014325 Bacteria 7746
231 Ga0163163_10088879 3300014325 Bacteria 3101
232 Ga0157380_10001123 3300014326 Bacteria 17254
233 Ga0157380_10005564 3300014326 Bacteria 8808
234 Ga0157380_10106033 3300014326 Bacteria 2351
235 Ga0157377_10005499 3300014745 Bacteria 5961
236 Ga0157379_10000555 3300014968 Bacteria 30137
237 Ga0157379_10001305 3300014968 Bacteria 20314
238 Ga0157379_10008059 3300014968 Bacteria 9148
239 Ga0157379_10017142 3300014968 Bacteria 6378
240 Ga0157376_10005392 3300014969 Bacteria 8942
241 Ga0157376_10015463 3300014969 Bacteria 5765
242 Ga0157376_10028221 3300014969 Bacteria 4458
243 Ga0163161_10004118 3300017792 Bacteria 10173
244 Ga0163161_10047405 3300017792 Bacteria 3103
245 Ga0207697_10000552 3300025315 Bacteria 21216
246 Ga0207682_10000696 3300025893 Bacteria 15554
247 Ga0207682_10001581 3300025893 Bacteria 10476
248 Ga0207680_10003849 3300025903 Bacteria 7065
249 Ga0207680_10008445 3300025903 Bacteria 5056
250 Ga0207680_10012720 3300025903 Bacteria 4296
251 Ga0207645_10000077 3300025907 Bacteria 69960
252 Ga0207645_10001675 3300025907 Bacteria 18033
253 Ga0207645_10002559 3300025907 Bacteria 14215
254 Ga0207643_10000579 3300025908 Bacteria 23210
255 Ga0207643_10017810 3300025908 Bacteria 3889
256 Ga0207705_10045156 3300025909 Bacteria 3167
257 Ga0207707_10012775 3300025912 Bacteria 7305
258 Ga0207707_10036484 3300025912 Bacteria 4297
259 Ga0207707_10078032 3300025912 Bacteria 2891
260 Ga0207707_10117004 3300025912 Bacteria 2330
261 Ga0207707_10119063 3300025912 Bacteria 2308
262 Ga0207695_10006083 3300025913 Bacteria 15748
263 Ga0207695_10013182 3300025913 Bacteria 9865
264 Ga0207695_10029541 3300025913 Bacteria 6053
265 Ga0207671_10019474 3300025914 Bacteria 5188
266 Ga0207693_10049661 3300025915 Bacteria 3295
267 Ga0207662_10000516 3300025918 Bacteria 17183
268 Ga0207662_10052433 3300025918 Bacteria 2427
269 Ga0207657_10000809 3300025919 Bacteria 33036
270 Ga0207657_10000995 3300025919 Bacteria 30092
271 Ga0207649_10011776 3300025920 Bacteria 4836
272 Ga0207649_10084432 3300025920 Bacteria 2064
273 Ga0207652_10103317 3300025921 Bacteria 2519
274 Ga0207646_10005173 3300025922 Bacteria 13797
275 Ga0207681_10008991 3300025923 Bacteria 6101
276 Ga0207681_10014287 3300025923 Bacteria 4931
277 Ga0207694_10005020 3300025924 Bacteria 10238
278 Ga0207694_10018840 3300025924 Bacteria 5217
279 Ga0207650_10001400 3300025925 Bacteria 17395
280 Ga0207650_10031052 3300025925 Bacteria 3855
281 Ga0207650_10040037 3300025925 Bacteria 3428
282 Ga0207650_10047458 3300025925 Bacteria 3165
283 Ga0207650_10078730 3300025925 Bacteria 2494
284 Ga0207650_10121202 3300025925 Bacteria 2036
285 Ga0207659_10017397 3300025926 Bacteria 4697
286 Ga0207687_10000379 3300025927 Bacteria 29896
287 Ga0207664_10022129 3300025929 Bacteria 4741
288 Ga0207644_10002447 3300025931 Bacteria 11978
289 Ga0207644_10006501 3300025931 Bacteria 7620
290 Ga0207644_10014671 3300025931 Bacteria 5249
291 Ga0207644_10032788 3300025931 Bacteria 3627
292 Ga0207690_10001081 3300025932 Bacteria 17428
293 Ga0207690_10015651 3300025932 Bacteria 4601
294 Ga0207706_10000351 3300025933 Bacteria 49664
295 Ga0207706_10002579 3300025933 Bacteria 17647
296 Ga0207706_10012482 3300025933 Bacteria 7739
297 Ga0207706_10067063 3300025933 Bacteria 3157
298 Ga0207686_10002634 3300025934 Bacteria 9733
299 Ga0207686_10057390 3300025934 Bacteria 2451
300 Ga0207709_10001934 3300025935 Bacteria 13610
301 Ga0207670_10042943 3300025936 Bacteria 2983
302 Ga0207704_10007441 3300025938 Bacteria 5174
303 Ga0207704_10008866 3300025938 Bacteria 4830
304 Ga0207691_10000499 3300025940 Bacteria 39022
305 Ga0207691_10001011 3300025940 Bacteria 27902
306 Ga0207691_10002200 3300025940 Bacteria 19071
307 Ga0207691_10002929 3300025940 Bacteria 16652
308 Ga0207691_10003403 3300025940 Bacteria 15465
309 Ga0207691_10010343 3300025940 Bacteria 8949
310 Ga0207691_10013887 3300025940 Bacteria 7685
311 Ga0207691_10052287 3300025940 Bacteria 3731
312 Ga0207711_10036766 3300025941 Bacteria 4155
313 Ga0207711_10097359 3300025941 Bacteria 2598
314 Ga0207689_10000003 3300025942 Bacteria 175710
315 Ga0207689_10001066 3300025942 Bacteria 26408
316 Ga0207689_10005681 3300025942 Bacteria 11099
317 Ga0207689_10019181 3300025942 Bacteria 5766
318 Ga0207689_10028124 3300025942 Bacteria 4702
319 Ga0207661_10019665 3300025944 Bacteria 5040
320 Ga0207661_10042397 3300025944 Bacteria 3587
321 Ga0207661_10055828 3300025944 Bacteria 3169
322 Ga0207679_10003087 3300025945 Bacteria 10309
323 Ga0207679_10004504 3300025945 Bacteria 8678
324 Ga0207679_10082504 3300025945 Bacteria 2461
325 Ga0207667_10001104 3300025949 Bacteria 34133
326 Ga0207667_10003582 3300025949 Bacteria 19195
327 Ga0207651_10001712 3300025960 Bacteria 10127
328 Ga0207651_10009844 3300025960 Bacteria 5261
329 Ga0207651_10014031 3300025960 Bacteria 4612
330 Ga0207651_10026020 3300025960 Bacteria 3647
331 Ga0207668_10003581 3300025972 Bacteria 9126
332 Ga0207668_10026999 3300025972 Bacteria 3736
333 Ga0207640_10002153 3300025981 Bacteria 10582
334 Ga0207640_10022730 3300025981 Bacteria 3759
335 Ga0207658_10004601 3300025986 Bacteria 9568
336 Ga0207658_10025571 3300025986 Bacteria 4134
337 Ga0207658_10039627 3300025986 Bacteria 3400
338 Ga0207658_10055257 3300025986 Bacteria 2942
339 Ga0207677_10014048 3300026023 Bacteria 4661
340 Ga0207703_10000904 3300026035 Bacteria 29021
341 Ga0207703_10005562 3300026035 Bacteria 10114
342 Ga0207703_10017151 3300026035 Bacteria 5648
343 Ga0207703_10025683 3300026035 Bacteria 4634
344 Ga0207703_10041648 3300026035 Bacteria 3681
345 Ga0207703_10121286 3300026035 Bacteria 2244
346 Ga0207639_10002265 3300026041 Bacteria 12933
347 Ga0207639_10025932 3300026041 Bacteria 4254
348 Ga0207678_10002339 3300026067 Bacteria 17182
349 Ga0207678_10003679 3300026067 Bacteria 13784
350 Ga0207678_10008888 3300026067 Bacteria 8847
351 Ga0207708_10000049 3300026075 Bacteria 114743
352 Ga0207708_10000693 3300026075 Bacteria 25576
353 Ga0207708_10023331 3300026075 Bacteria 4676
354 Ga0207702_10002222 3300026078 Bacteria 18606
355 Ga0207702_10002542 3300026078 Bacteria 17175
356 Ga0207702_10006152 3300026078 Bacteria 10390
357 Ga0207702_10009988 3300026078 Bacteria 7956
358 Ga0207641_10002961 3300026088 Bacteria 15359
359 Ga0207641_10026730 3300026088 Bacteria 4763
360 Ga0207648_10000126 3300026089 Bacteria 75403
361 Ga0207648_10000589 3300026089 Bacteria 40773
362 Ga0207648_10001872 3300026089 Bacteria 23010
363 Ga0207648_10002126 3300026089 Bacteria 21549
364 Ga0207648_10002919 3300026089 Bacteria 18093
365 Ga0207648_10018976 3300026089 Bacteria 6210
366 Ga0207676_10000762 3300026095 Bacteria 25182
367 Ga0207676_10019522 3300026095 Bacteria 4947
368 Ga0207676_10019660 3300026095 Bacteria 4931
369 Ga0207676_10068902 3300026095 Bacteria 2831
370 Ga0207674_10004946 3300026116 Bacteria 15914
371 Ga0207674_10016301 3300026116 Bacteria 8138
372 Ga0207674_10019440 3300026116 Bacteria 7355
373 Ga0207675_100001747 3300026118 Bacteria 21721
374 Ga0207675_100012787 3300026118 Bacteria 7841
375 Ga0207683_10000280 3300026121 Bacteria 45558
376 Ga0207683_10001731 3300026121 Bacteria 19437
377 Ga0207683_10006222 3300026121 Bacteria 10230
378 Ga0207683_10114639 3300026121 Bacteria 2415
379 Ga0207698_10009365 3300026142 Bacteria 6243
380 Ga0207698_10012240 3300026142 Bacteria 5605
381 Ga0207698_10035501 3300026142 Bacteria 3648
382 Ga0209813_10001057 3300027866 Bacteria 6201
383 Ga0209974_10004825 3300027876 Bacteria 4779
384 Ga0209974_10009273 3300027876 Bacteria 3341
385 Ga0207428_10014978 3300027907 Bacteria 6719
386 Ga0268266_10056257 3300028379 Bacteria 3384
387 Ga0268266_10059818 3300028379 Bacteria 3282
388 Ga0268266_10079030 3300028379 Bacteria 2863
389 Ga0268265_10004994 3300028380 Bacteria 9105
390 Ga0268265_10013273 3300028380 Bacteria 5598
391 Ga0268265_10053291 3300028380 Bacteria 3064
392 Ga0268265_10145164 3300028380 Bacteria 1993
393 Ga0268264_10007085 3300028381 Bacteria 9396
394 Ga0268264_10024875 3300028381 Bacteria 4893
395 Ga0268264_10051758 3300028381 Bacteria 3423
396 Ga0307511_10000574 3300030521 Bacteria 39348
397 Ga0265330_10003053 3300031235 Bacteria 8874
398 Ga0265332_10000284 3300031238 Bacteria 39799
399 Ga0265320_10014350 3300031240 Bacteria 4515
400 Ga0265329_10005042 3300031242 Bacteria 5391
401 Ga0265331_10000415 3300031250 Bacteria 43326
402 Ga0265327_10004174 3300031251 Bacteria 13030
403 Ga0307408_100004748 3300031548 Bacteria 9163
404 Ga0307408_100026343 3300031548 Bacteria 3993
405 Ga0265314_10017192 3300031711 Bacteria 5683
406 Ga0307405_10000547 3300031731 Bacteria 14284
407 Ga0307405_10000931 3300031731 Bacteria 11645
408 Ga0307410_10005943 3300031852 Bacteria 6526
409 Ga0307410_10037162 3300031852 Bacteria 3178
410 Ga0307406_10006227 3300031901 Bacteria 6570
411 Ga0307412_10014646 3300031911 Bacteria 4632
412 Ga0307409_100020047 3300031995 Bacteria 4546
413 Ga0307409_100029171 3300031995 Bacteria 3944
414 Ga0307416_100035114 3300032002 Bacteria 3824
415 Ga0307416_100075743 3300032002 Bacteria 2817
416 Ga0307415_100000868 3300032126 Bacteria 13824
417 Ga0307507_10025624 3300033179 Bacteria 6392
418 Ga0373947_0086541 3300035725 Bacteria 1948
419 Ga0373937_0055171 3300036401 Bacteria 3647
420 Ga0395898_0119569 3300037466 Bacteria 2524
421 Ga0395905_0028209 3300037471 Bacteria 5292
422 Ga0466967_0101643 3300045976 Bacteria 2628
423 Ga0496100_0024257 3300048903 Bacteria 3697
424 Ga0496100_0054440 3300048903 Bacteria 2610
425 Ga0496102_0036514 3300048905 Bacteria 4427
426 Ga0496103_0054345 3300048906 Bacteria 2482
427 Ga0496104_0098455 3300048907 Bacteria 2799
428 Ga0496106_0000971 3300048909 Bacteria 20941
429 Ga0496106_0109941 3300048909 Bacteria 2145
430 Ga0496107_0002428 3300048910 Bacteria 12074
431 Ga0496109_0041278 3300048912 Bacteria 4180
432 Ga0496109_0047622 3300048912 Bacteria 3898
433 Ga0496110_0061665 3300048913 Bacteria 3311
434 Ga0496110_0061978 3300048913 Bacteria 3302
435 Ga0496111_0066337 3300048914 Bacteria 2621
436 Ga0496115_0034929 3300048918 Bacteria 3975
437 Ga0501069_0044690 3300049585 Bacteria 2452
438 Ga0501070_0089975 3300049586 Bacteria 2540
439 Ga0501074_0044044 3300049590 Bacteria 3231
440 nmdc:mga03n38_4077_c1 3300050490 Bacteria 4789
441 nmdc:mga0k408_5952_c1 3300050493 Bacteria 6507
442 nmdc:mga06z11_3221_c1 3300050494 Bacteria 6306
443 nmdc:mga07m45_6236_c1 3300050496 Bacteria 4743
444 nmdc:mga08y16_34775_c1 3300050511 Bacteria 5294
445 nmdc:mga0n895_80206_c1 3300050512 Bacteria 3251
446 nmdc:mga08x19_34112_c1 3300050514 Bacteria 3215
447 nmdc:mga0sz30_4547_c1 3300050516 Bacteria 5024
448 8039104044 8039098773 Bacteria 6602928
449 nmdc:mga0yw44_32718_c1
450 JGI24743J22301_10002764
451 JGI24749J21850_1002723
452 Ga0070658_10056038
453 Ga0070676_10000409
454 Ga0070676_10007710
455 Ga0070683_100004039
456 Ga0070683_100080073
457 Ga0070690_100003370
458 Ga0070690_100016902
459 Ga0070690_100026835
460 Ga0070670_100014220
461 Ga0070670_100028203
462 Ga0070670_100040937
463 Ga0070670_100045408
464 Ga0068869_100000241
465 Ga0068869_100003459
466 Ga0068869_100033795
467 Ga0070666_10008499
468 Ga0068868_100078105
469 Ga0070660_100002491
470 Ga0070660_100072357
471 Ga0070689_100009420
472 Ga0070689_100043341
473 Ga0070661_100002610
474 Ga0070661_100005939
475 Ga0070661_100008060
476 Ga0070692_10017508
477 Ga0070668_100001824
478 Ga0070668_100008440
479 Ga0070668_100010286
480 Ga0070668_100032019
481 Ga0070668_100032199
482 Ga0070669_100001002
483 Ga0070669_100010129
484 Ga0070669_100010823
485 Ga0070669_100080667
486 Ga0070675_100001486
487 Ga0070675_100016434
488 Ga0070675_100060069
489 Ga0070671_100003732
490 Ga0070671_100005429
491 Ga0070671_100007647
492 Ga0070671_100018327
493 Ga0070671_100029995
494 Ga0070671_100078708
495 Ga0070674_100032646
496 Ga0070674_100041610
497 Ga0070673_100000369
498 Ga0070673_100022022
499 Ga0070673_100022764
500 Ga0070659_100003342
501 Ga0070659_100003585
502 Ga0070659_100006802
503 Ga0070659_100060471
504 Ga0070667_100001414
505 Ga0070667_100004046
506 Ga0070667_100008559
507 Ga0070667_100093680
508 Ga0070709_10004947
509 Ga0070714_100000881
510 Ga0070714_100064775
511 Ga0070713_100000161
512 Ga0070713_100004999
513 Ga0070701_10003210
514 Ga0070705_100015928
515 Ga0070700_100001388
516 Ga0070708_100000721
517 Ga0070663_100003516
518 Ga0070663_100012142
519 Ga0070663_100018475
520 Ga0070678_100000697
521 Ga0070678_100010882
522 Ga0070662_100000340
523 Ga0070662_100010780
524 Ga0070681_10004643
525 Ga0070681_10009351
526 Ga0070681_10065093
527 Ga0070681_10150807
528 Ga0068867_100002597
529 Ga0068867_100009237
530 Ga0070685_10003123
531 Ga0070707_100053504
532 Ga0070698_100031587
533 Ga0070679_100031360
534 Ga0070684_100003132
535 Ga0070684_100037056
536 Ga0070697_100012449
537 Ga0068853_100004329
538 Ga0068853_100005128
539 Ga0068853_100104565
540 Ga0070672_100000618
541 Ga0070672_100000746
542 Ga0070672_100018599
543 Ga0070672_100027958
544 Ga0070672_100075869
545 Ga0070686_100006481
546 Ga0070686_100025178
547 Ga0070695_100021162
548 Ga0070696_100002786
549 Ga0070696_100054171
550 Ga0070696_100070273
551 Ga0070665_100002113
552 Ga0070665_100038023
553 Ga0070665_100040078
554 Ga0070665_100057008
555 Ga0068855_100003919
556 Ga0068855_100009230
557 Ga0068855_100126830
558 Ga0070664_100006183
559 Ga0070664_100020841
560 Ga0070664_100058031
561 Ga0070664_100069609
562 Ga0068857_100026296
563 Ga0068857_100040945
564 Ga0068857_100133491
565 Ga0068854_100004294
566 Ga0068854_100021837
567 Ga0068856_100000121
568 Ga0068856_100002936
569 Ga0068856_100006037
570 Ga0068856_100016863
571 Ga0068856_100118836
572 Ga0070702_100001194
573 Ga0070702_100053589
574 Ga0068852_100001886
575 Ga0068852_100005100
576 Ga0068859_100001091
577 Ga0068859_100069502
578 Ga0068864_100000584
579 Ga0068864_100004990
580 Ga0068864_100006490
581 Ga0068864_100050009
582 Ga0068866_10000796
583 Ga0068861_100000823
584 Ga0068861_100027431
585 Ga0068861_100043144
586 Ga0068851_10000310
587 Ga0068851_10000364
588 Ga0068851_10017676
589 Ga0068870_10015189
590 Ga0068870_10034161
591 Ga0068863_100001050
592 Ga0068863_100003644
593 Ga0068863_100006241
594 Ga0068863_100024523
595 Ga0068863_100041202
596 Ga0068863_100075008
597 Ga0068863_100088944
598 Ga0068858_100003652
599 Ga0068858_100007734
600 Ga0068858_100013481
601 Ga0068858_100018130
602 Ga0068858_100034960
603 Ga0068858_100058532
604 Ga0068858_100074982
605 Ga0068860_100001726
606 Ga0068860_100028277
607 Ga0068860_100069247
608 Ga0068860_100133901
609 Ga0068862_100002356
610 Ga0068862_100016027
611 Ga0068862_100017315
612 Ga0068862_100029557
613 Ga0068862_100080505
614 Ga0081539_10010944
615 Ga0075368_10003125
616 Ga0075369_10017083
617 Ga0075366_10048518
618 Ga0097621_100004190
619 Ga0097621_100020302
620 Ga0097621_100021787
621 Ga0097621_100033429
622 Ga0097621_100052218
623 Ga0097621_100140224
624 Ga0075370_10009875
625 Ga0068871_100010324
626 Ga0068871_100020774
627 Ga0068871_100024180
628 Ga0068865_100011577
629 Ga0068865_100020446
630 Ga0068865_100041746
631 Ga0097620_100001092
632 Ga0097620_100069499
633 Ga0099794_10008573
634 Ga0105240_10003341
635 Ga0105240_10044573
636 Ga0111539_10062512
637 Ga0105245_10021004
638 Ga0105243_10022296
639 Ga0105243_10025731
640 Ga0105241_10047110
641 Ga0105242_10017710
642 Ga0105242_10087349
643 Ga0105248_10009560
644 Ga0105248_10011247
645 Ga0105248_10021011
646 Ga0105248_10043658
647 Ga0105238_10002111
648 Ga0105238_10024732
649 Ga0105239_10022524
650 Ga0105239_10061782
651 Ga0157373_10000313
652 Ga0157371_10001341
653 Ga0157371_10061896
654 Ga0157370_10012667
655 Ga0157370_10017427
656 Ga0157370_10036534
657 Ga0157370_10127357
658 Ga0157369_10087933
659 Ga0157374_10026634
660 Ga0157374_10068695
661 Ga0157374_10080110
662 Ga0157378_10007496
663 Ga0157378_10041300
664 Ga0157378_10053727
665 Ga0163162_10027844
666 Ga0163162_10039103
667 Ga0157372_10005180
668 Ga0157372_10017912
669 Ga0157372_10045220
670 Ga0157372_10065779
671 Ga0157375_10013307
672 Ga0157375_10014402
673 Ga0157375_10042237
674 Ga0157375_10047351
675 Ga0157375_10129433
676 Ga0163163_10000642
677 Ga0163163_10005036
678 Ga0163163_10012468
679 Ga0163163_10088879
680 Ga0157380_10001123
681 Ga0157380_10005564
682 Ga0157380_10106033
683 Ga0157377_10005499
684 Ga0157379_10000555
685 Ga0157379_10001305
686 Ga0157379_10008059
687 Ga0157379_10017142
688 Ga0157376_10005392
689 Ga0157376_10015463
690 Ga0157376_10028221
691 Ga0163161_10004118
692 Ga0163161_10047405
693 Ga0207697_10000552
694 Ga0207682_10000696
695 Ga0207682_10001581
696 Ga0207680_10003849
697 Ga0207680_10008445
698 Ga0207680_10012720
699 Ga0207645_10000077
700 Ga0207645_10001675
701 Ga0207645_10002559
702 Ga0207643_10000579
703 Ga0207643_10017810
704 Ga0207705_10045156
705 Ga0207707_10012775
706 Ga0207707_10036484
707 Ga0207707_10078032
708 Ga0207707_10117004
709 Ga0207707_10119063
710 Ga0207695_10006083
711 Ga0207695_10013182
712 Ga0207695_10029541
713 Ga0207671_10019474
714 Ga0207693_10049661
715 Ga0207662_10000516
716 Ga0207662_10052433
717 Ga0207657_10000809
718 Ga0207657_10000995
719 Ga0207649_10011776
720 Ga0207649_10084432
721 Ga0207652_10103317
722 Ga0207646_10005173
723 Ga0207681_10008991
724 Ga0207681_10014287
725 Ga0207694_10005020
726 Ga0207694_10018840
727 Ga0207650_10001400
728 Ga0207650_10031052
729 Ga0207650_10040037
730 Ga0207650_10047458
731 Ga0207650_10078730
732 Ga0207650_10121202
733 Ga0207659_10017397
734 Ga0207687_10000379
735 Ga0207664_10022129
736 Ga0207644_10002447
737 Ga0207644_10006501
738 Ga0207644_10014671
739 Ga0207644_10032788
740 Ga0207690_10001081
741 Ga0207690_10015651
742 Ga0207706_10000351
743 Ga0207706_10002579
744 Ga0207706_10012482
745 Ga0207706_10067063
746 Ga0207686_10002634
747 Ga0207686_10057390
748 Ga0207709_10001934
749 Ga0207670_10042943
750 Ga0207704_10007441
751 Ga0207704_10008866
752 Ga0207691_10000499
753 Ga0207691_10001011
754 Ga0207691_10002200
755 Ga0207691_10002929
756 Ga0207691_10003403
757 Ga0207691_10010343
758 Ga0207691_10013887
759 Ga0207691_10052287
760 Ga0207711_10036766
761 Ga0207711_10097359
762 Ga0207689_10000003
763 Ga0207689_10001066
764 Ga0207689_10005681
765 Ga0207689_10019181
766 Ga0207689_10028124
767 Ga0207661_10019665
768 Ga0207661_10042397
769 Ga0207661_10055828
770 Ga0207679_10003087
771 Ga0207679_10004504
772 Ga0207679_10082504
773 Ga0207667_10001104
774 Ga0207667_10003582
775 Ga0207651_10001712
776 Ga0207651_10009844
777 Ga0207651_10014031
778 Ga0207651_10026020
779 Ga0207668_10003581
780 Ga0207668_10026999
781 Ga0207640_10002153
782 Ga0207640_10022730
783 Ga0207658_10004601
784 Ga0207658_10025571
785 Ga0207658_10039627
786 Ga0207658_10055257
787 Ga0207677_10014048
788 Ga0207703_10000904
789 Ga0207703_10005562
790 Ga0207703_10017151
791 Ga0207703_10025683
792 Ga0207703_10041648
793 Ga0207703_10121286
794 Ga0207639_10002265
795 Ga0207639_10025932
796 Ga0207678_10002339
797 Ga0207678_10003679
798 Ga0207678_10008888
799 Ga0207708_10000049
800 Ga0207708_10000693
801 Ga0207708_10023331
802 Ga0207702_10002222
803 Ga0207702_10002542
804 Ga0207702_10006152
805 Ga0207702_10009988
806 Ga0207641_10002961
807 Ga0207641_10026730
808 Ga0207648_10000126
809 Ga0207648_10000589
810 Ga0207648_10001872
811 Ga0207648_10002126
812 Ga0207648_10002919
813 Ga0207648_10018976
814 Ga0207676_10000762
815 Ga0207676_10019522
816 Ga0207676_10019660
817 Ga0207676_10068902
818 Ga0207674_10004946
819 Ga0207674_10016301
820 Ga0207674_10019440
821 Ga0207675_100001747
822 Ga0207675_100012787
823 Ga0207683_10000280
824 Ga0207683_10001731
825 Ga0207683_10006222
826 Ga0207683_10114639
827 Ga0207698_10009365
828 Ga0207698_10012240
829 Ga0207698_10035501
830 Ga0209813_10001057
831 Ga0209974_10004825
832 Ga0209974_10009273
833 Ga0207428_10014978
834 Ga0268266_10056257
835 Ga0268266_10059818
836 Ga0268266_10079030
837 Ga0268265_10004994
838 Ga0268265_10013273
839 Ga0268265_10053291
840 Ga0268265_10145164
841 Ga0268264_10007085
842 Ga0268264_10024875
843 Ga0268264_10051758
844 Ga0307511_10000574
845 Ga0265330_10003053
846 Ga0265332_10000284
847 Ga0265320_10014350
848 Ga0265329_10005042
849 Ga0265331_10000415
850 Ga0265327_10004174
851 Ga0307408_100004748
852 Ga0307408_100026343
853 Ga0265314_10017192
854 Ga0307405_10000547
855 Ga0307405_10000931
856 Ga0307410_10005943
857 Ga0307410_10037162
858 Ga0307406_10006227
859 Ga0307412_10014646
860 Ga0307409_100020047
861 Ga0307409_100029171
862 Ga0307416_100035114
863 Ga0307416_100075743
864 Ga0307415_100000868
865 Ga0307507_10025624
866 Ga0373947_0086541
867 Ga0373937_0055171
868 Ga0395898_0119569
869 Ga0395905_0028209
870 Ga0466967_0101643
871 Ga0496100_0024257
872 Ga0496100_0054440
873 Ga0496102_0036514
874 Ga0496103_0054345
875 Ga0496104_0098455
876 Ga0496106_0000971
877 Ga0496106_0109941
878 Ga0496107_0002428
879 Ga0496109_0041278
880 Ga0496109_0047622
881 Ga0496110_0061665
882 Ga0496110_0061978
883 Ga0496111_0066337
884 Ga0496115_0034929
885 Ga0501069_0044690
886 Ga0501070_0089975
887 Ga0501074_0044044
888 nmdc:mga03n38_4077_c1
889 nmdc:mga0k408_5952_c1
890 nmdc:mga06z11_3221_c1
891 nmdc:mga07m45_6236_c1
892 nmdc:mga08y16_34775_c1
893 nmdc:mga0n895_80206_c1
894 nmdc:mga08x19_34112_c1
895 nmdc:mga0sz30_4547_c1
896 8039104044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03950

tRNA-synt_1c_C

tRNA synthetases class I (E and Q), anti-codon binding domain

389

489

0.98

PF00749

tRNA-synt_1c

tRNA synthetases class I (E and Q), catalytic domain

67

387

0.95

PF20974

tRNA-synt_1c_C2

tRNA synthetases class I (E and Q), anti-codon binding domain

507

588

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bnz-assembly1.cif.gz_A crystal structure of glutamine-trna ligase /glutaminyl-trna synthetase (glnrs) from pseudomonas aeruginosa 0.9671 62 644
5bnz-assembly1.cif.gz_A crystal structure of glutamine-trna ligase /glutaminyl-trna synthetase (glnrs) from pseudomonas aeruginosa 0.9601 62 644
4jxx-assembly1.cif.gz_A crystal structure of e coli e. coli glutaminyl-trna synthetase bound to trna(gln)(cug) and atp from novel cryostabilization conditions 0.9555 61 642
4jyz-assembly1.cif.gz_A crystal structure of e. coli glutaminyl-trna synthetase bound to atp and native trna(gln) containing the cmnm5s2u34 anticodon wobble base 0.9546 61 642
1qtq-assembly1.cif.gz_A glutaminyl-trna synthetase complexed with trna and an amino acid analog 0.9537 61 641
ID Description Score Start End Superfamily
4p2bA02 Alpha Beta;Alpha-Beta Complex;Glutamyl-tRNA Synthetase; domain 3;Glutamyl-tRNA Synthetase; Domain 3 0.9658 155 262 3.90.800.10
af_O13775_172_516_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9598 79 400 3.40.50.620
af_Q58772_87_395_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9516 80 397 3.40.50.620
4p2bA02 Alpha Beta;Alpha-Beta Complex;Glutamyl-tRNA Synthetase; domain 3;Glutamyl-tRNA Synthetase; Domain 3 0.9474 155 262 3.90.800.10
2hz7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9464 81 318 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2T4CRZ5-F1-model_v4 Glutamine--tRNA ligase (EC 6.1.1.18) 0.9958 115 295 GO:0004819
GO:0005524
GO:0005829
GO:0006425
AF-A0A536SES4-F1-model_v4 Glutamine--tRNA ligase 0.9955 81 256 GO:0004819
GO:0005524
GO:0005829
GO:0006425
AF-A0A2Z2GMI9-F1-model_v4 Glutaminyl-tRNA synthetase 0.9927 144 287 GO:0004819
GO:0005524
GO:0005829
GO:0006425
AF-A0A351VE97-F1-model_v4 Glutamine--tRNA ligase (EC 6.1.1.18) 0.9923 85 269 GO:0004819
GO:0005524
GO:0005829
GO:0006425
AF-A0A7X4AK46-F1-model_v4 Glutamine--tRNA ligase (EC 6.1.1.18) 0.9914 62 242 GO:0004819
GO:0005524
GO:0005829
GO:0006425

Map