F446223

General Info

Members Datasets Scaffolds Average Seq Length
448 211 446 155

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0549235|Ga0466957_0549235_278_769
Length 155
Sequence MRRHIFEAMMPAHEHQLHEGDALLSAARGRLTGQGEQWTEMRAAVFEALAGFDKPASAYDVAEAVSRKQDRRVAANSVYRILARRVESANAYIANAHPDCLHDCIFLICDRCGQAVHIDDDRLSSGIREAAKKAGFSAPRPVIEVRGTCGDCDEG

Samples

Sample ID Description Type Environment
1 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
2 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
164 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
185 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
209 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
210 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0.89
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.01
Nodule 0
Rhizoplane 4.24
Rhizosphere 91.07
Stem 0
Stem Tuber 0
Unclassified 2.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008605 3300001979 Bacteria 4054
2 JGI24739J22299_10064366 3300001989 Bacteria 1152
3 JGI24739J22299_10090181 3300001989 Bacteria 934
4 JGI24735J21928_10059666 3300002067 Bacteria 1096
5 JGI24735J21928_10072222 3300002067 Bacteria 988
6 JGI24034J26672_10059551 3300002239 Bacteria 668
7 rootL2_10123961 3300003322 Bacteria 1618
8 Ga0065165_1001921 3300005262 Bacteria 19835
9 Ga0065712_10094237 3300005290 Bacteria 2247
10 Ga0070658_10048736 3300005327 Bacteria 3430
11 Ga0070658_10289540 3300005327 Bacteria 1395
12 Ga0070658_10615509 3300005327 Bacteria 941
13 Ga0070658_11154646 3300005327 Bacteria 673
14 Ga0070676_10019824 3300005328 Bacteria 3746
15 Ga0070683_100059595 3300005329 Bacteria 3546
16 Ga0070670_100001034 3300005331 Bacteria 22016
17 Ga0070666_10175324 3300005335 Bacteria 1503
18 Ga0070666_10188818 3300005335 Bacteria 1447
19 Ga0070666_11341649 3300005335 Bacteria 534
20 Ga0070680_100017636 3300005336 Bacteria 5631
21 Ga0070680_100222129 3300005336 Bacteria 1595
22 Ga0070682_100053399 3300005337 Bacteria 2532
23 Ga0070682_100412958 3300005337 Bacteria 1024
24 Ga0068868_100040920 3300005338 Bacteria 3609
25 Ga0068868_100158504 3300005338 Bacteria 1868
26 Ga0070660_100000493 3300005339 Bacteria 26295
27 Ga0070660_100007352 3300005339 Bacteria 7673
28 Ga0070660_100019247 3300005339 Bacteria 4999
29 Ga0070660_100036808 3300005339 Bacteria 3709
30 Ga0070660_100113511 3300005339 Bacteria 2157
31 Ga0070660_100352866 3300005339 Bacteria 1211
32 Ga0070660_100515296 3300005339 Bacteria 996
33 Ga0070691_10006375 3300005341 Bacteria 5393
34 Ga0070661_100013982 3300005344 Bacteria 5643
35 Ga0070661_100044664 3300005344 Bacteria 3237
36 Ga0070661_100060656 3300005344 Bacteria 2775
37 Ga0070661_100116348 3300005344 Bacteria 2000
38 Ga0070661_100365665 3300005344 Bacteria 1134
39 Ga0070692_10019550 3300005345 Bacteria 3270
40 Ga0070692_10031674 3300005345 Bacteria 2653
41 Ga0070668_100276052 3300005347 Bacteria 1402
42 Ga0070669_100195425 3300005353 Bacteria 1589
43 Ga0070675_100013986 3300005354 Bacteria 6319
44 Ga0070675_100036496 3300005354 Bacteria 4000
45 Ga0070671_100023793 3300005355 Bacteria 5014
46 Ga0070671_100121534 3300005355 Bacteria 2198
47 Ga0070674_100155714 3300005356 Bacteria 1729
48 Ga0070674_100407773 3300005356 Bacteria 1112
49 Ga0070674_100853039 3300005356 Bacteria 790
50 Ga0070673_100002512 3300005364 Bacteria 11196
51 Ga0070673_100024928 3300005364 Bacteria 4393
52 Ga0070673_100052467 3300005364 Bacteria 3199
53 Ga0070673_100664441 3300005364 Bacteria 955
54 Ga0070659_100000034 3300005366 Bacteria 115416
55 Ga0070659_100065110 3300005366 Bacteria 2886
56 Ga0070659_100317045 3300005366 Bacteria 1303
57 Ga0070667_100005333 3300005367 Bacteria 10739
58 Ga0070667_100279128 3300005367 Bacteria 1500
59 Ga0070667_101174893 3300005367 Bacteria 718
60 Ga0070714_100010037 3300005435 Bacteria 7471
61 Ga0070714_100098392 3300005435 Bacteria 2574
62 Ga0070713_100005994 3300005436 Bacteria 8365
63 Ga0070713_100078826 3300005436 Bacteria 2805
64 Ga0070713_101697878 3300005436 Bacteria 613
65 Ga0070663_100029451 3300005455 Bacteria 3752
66 Ga0070663_100084574 3300005455 Bacteria 2339
67 Ga0070663_100161809 3300005455 Bacteria 1723
68 Ga0070663_100766216 3300005455 Bacteria 825
69 Ga0070678_100032582 3300005456 Bacteria 3608
70 Ga0070678_100424803 3300005456 Bacteria 1159
71 Ga0070678_100564541 3300005456 Bacteria 1012
72 Ga0070662_100001652 3300005457 Bacteria 13715
73 Ga0070662_100006322 3300005457 Bacteria 7629
74 Ga0070662_100014307 3300005457 Bacteria 5298
75 Ga0070662_100076316 3300005457 Bacteria 2484
76 Ga0070662_100154175 3300005457 Bacteria 1792
77 Ga0070662_100197714 3300005457 Bacteria 1593
78 Ga0070681_10093694 3300005458 Bacteria 2952
79 Ga0070681_10402016 3300005458 Bacteria 1281
80 Ga0068867_100187656 3300005459 Bacteria 1648
81 Ga0070685_10309034 3300005466 Bacteria 1068
82 Ga0070679_100334993 3300005530 Bacteria 1461
83 Ga0070684_100007275 3300005535 Bacteria 8605
84 Ga0070684_100057990 3300005535 Bacteria 3382
85 Ga0070684_100549818 3300005535 Bacteria 1071
86 Ga0068853_100011622 3300005539 Bacteria 7156
87 Ga0068853_100099668 3300005539 Bacteria 2567
88 Ga0068853_100370587 3300005539 Bacteria 1336
89 Ga0068853_100510600 3300005539 Bacteria 1135
90 Ga0068853_100733794 3300005539 Bacteria 943
91 Ga0070672_100022888 3300005543 Bacteria 4598
92 Ga0070686_100000140 3300005544 Bacteria 49544
93 Ga0070665_100000105 3300005548 Bacteria 157734
94 Ga0070665_100000155 3300005548 Bacteria 125017
95 Ga0070665_100005893 3300005548 Bacteria 12557
96 Ga0070665_100044781 3300005548 Bacteria 4442
97 Ga0070665_100167811 3300005548 Bacteria 2197
98 Ga0070665_101515203 3300005548 Bacteria 679
99 Ga0070704_100628374 3300005549 Bacteria 946
100 Ga0068855_101958046 3300005563 Bacteria 593
101 Ga0070664_100014497 3300005564 Bacteria 6427
102 Ga0070664_100060424 3300005564 Bacteria 3227
103 Ga0070664_100311923 3300005564 Bacteria 1424
104 Ga0070664_100329228 3300005564 Bacteria 1385
105 Ga0068857_100028109 3300005577 Bacteria 4961
106 Ga0068857_100078813 3300005577 Bacteria 2940
107 Ga0068857_100623649 3300005577 Bacteria 1020
108 Ga0068854_100043828 3300005578 Bacteria 3173
109 Ga0068854_100065463 3300005578 Bacteria 2642
110 Ga0068854_100071352 3300005578 Bacteria 2540
111 Ga0068854_100311205 3300005578 Bacteria 1277
112 Ga0068854_100541639 3300005578 Bacteria 986
113 Ga0068856_100321116 3300005614 Bacteria 1565
114 Ga0068852_100217235 3300005616 Bacteria 1817
115 Ga0068852_100316603 3300005616 Bacteria 1514
116 Ga0068852_100371451 3300005616 Bacteria 1401
117 Ga0068852_100585612 3300005616 Bacteria 1119
118 Ga0068852_100651850 3300005616 Bacteria 1060
119 Ga0068859_100037542 3300005617 Bacteria 4862
120 Ga0068859_100078102 3300005617 Bacteria 3351
121 Ga0068859_101683006 3300005617 Bacteria 701
122 Ga0068861_100013143 3300005719 Bacteria 5790
123 Ga0068851_10046728 3300005834 Bacteria 2191
124 Ga0068870_10400966 3300005840 Bacteria 892
125 Ga0068863_100025159 3300005841 Bacteria 5676
126 Ga0068863_100033328 3300005841 Bacteria 4907
127 Ga0068858_100003225 3300005842 Bacteria 16284
128 Ga0068858_100162227 3300005842 Bacteria 2105
129 Ga0068860_100004562 3300005843 Bacteria 14135
130 Ga0068860_100051361 3300005843 Bacteria 3923
131 Ga0068862_100284718 3300005844 Bacteria 1516
132 Ga0070717_10470975 3300006028 Bacteria 1134
133 Ga0097621_100307297 3300006237 Bacteria 1402
134 Ga0068871_100238088 3300006358 Bacteria 1581
135 Ga0075430_100645589 3300006846 Bacteria 873
136 Ga0075434_100299844 3300006871 Bacteria 1628
137 Ga0068865_100083711 3300006881 Bacteria 2297
138 Ga0097620_100037542 3300006931 Bacteria 4862
139 Ga0097620_100078099 3300006931 Bacteria 3351
140 Ga0097620_101682938 3300006931 Bacteria 701
141 Ga0075435_101486991 3300007076 Bacteria 594
142 Ga0105240_10071890 3300009093 Bacteria 4277
143 Ga0105240_10119591 3300009093 Bacteria 3173
144 Ga0105245_10418496 3300009098 Bacteria 1343
145 Ga0105243_12150079 3300009148 Bacteria 594
146 Ga0105241_11581925 3300009174 Bacteria 633
147 Ga0105242_10514128 3300009176 Bacteria 1141
148 Ga0105248_10004580 3300009177 Bacteria 15309
149 Ga0105248_10122482 3300009177 Bacteria 2934
150 Ga0105248_10992173 3300009177 Bacteria 949
151 Ga0105248_12154195 3300009177 Bacteria 634
152 Ga0105237_10059044 3300009545 Bacteria 3838
153 Ga0105238_10150477 3300009551 Bacteria 2303
154 Ga0105238_10151906 3300009551 Bacteria 2291
155 Ga0105238_10174177 3300009551 Bacteria 2128
156 Ga0105249_10078026 3300009553 Bacteria 3072
157 Ga0105239_12709369 3300010375 Bacteria 578
158 Ga0157373_10027783 3300013100 Bacteria 4082
159 Ga0157373_10121285 3300013100 Bacteria 1837
160 Ga0157373_10168088 3300013100 Bacteria 1543
161 Ga0157371_10022019 3300013102 Bacteria 4677
162 Ga0157371_10048250 3300013102 Bacteria 3027
163 Ga0157371_10207819 3300013102 Bacteria 1404
164 Ga0157371_10591895 3300013102 Bacteria 824
165 Ga0157370_10021937 3300013104 Bacteria 6359
166 Ga0157370_10064826 3300013104 Bacteria 3457
167 Ga0157370_10217817 3300013104 Bacteria 1769
168 Ga0157370_10461209 3300013104 Bacteria 1168
169 Ga0157370_10695236 3300013104 Bacteria 928
170 Ga0157369_10008490 3300013105 Bacteria 11778
171 Ga0157369_10015109 3300013105 Bacteria 8713
172 Ga0157369_10062341 3300013105 Bacteria 4018
173 Ga0157369_10246020 3300013105 Bacteria 1867
174 Ga0157369_10969075 3300013105 Bacteria 871
175 Ga0157369_11869372 3300013105 Bacteria 610
176 Ga0157369_11886304 3300013105 Bacteria 607
177 Ga0157374_10006143 3300013296 Bacteria 10175
178 Ga0157374_10040625 3300013296 Bacteria 4285
179 Ga0157378_10088921 3300013297 Bacteria 2804
180 Ga0157378_10255971 3300013297 Bacteria 1678
181 Ga0157378_10729739 3300013297 Bacteria 1012
182 Ga0163162_10003899 3300013306 Bacteria 14323
183 Ga0163162_10060325 3300013306 Bacteria 3828
184 Ga0163162_10920801 3300013306 Bacteria 986
185 Ga0157372_10176333 3300013307 Bacteria 2474
186 Ga0157372_10210265 3300013307 Bacteria 2254
187 Ga0157375_10003022 3300013308 Bacteria 14591
188 Ga0157375_10083253 3300013308 Bacteria 3244
189 Ga0157375_10351342 3300013308 Bacteria 1640
190 Ga0157375_11129690 3300013308 Bacteria 918
191 Ga0157375_12504379 3300013308 Bacteria 616
192 Ga0163163_10006110 3300014325 Bacteria 10486
193 Ga0157380_11003545 3300014326 Bacteria 868
194 Ga0157376_10250455 3300014969 Bacteria 1654
195 Ga0206356_11863626 3300020070 Bacteria 1724
196 Ga0206354_10364096 3300020081 Bacteria 1174
197 Ga0206353_10501187 3300020082 Bacteria 1451
198 Ga0207697_10201253 3300025315 Bacteria 876
199 Ga0207688_10085286 3300025901 Bacteria 1809
200 Ga0207680_10008260 3300025903 Bacteria 5103
201 Ga0207680_10070333 3300025903 Bacteria 2166
202 Ga0207680_10671798 3300025903 Bacteria 742
203 Ga0207647_10006225 3300025904 Bacteria 8695
204 Ga0207647_10098727 3300025904 Bacteria 1735
205 Ga0207647_10222360 3300025904 Bacteria 1088
206 Ga0207645_10023748 3300025907 Bacteria 3981
207 Ga0207645_10096203 3300025907 Bacteria 1907
208 Ga0207643_10280556 3300025908 Bacteria 1033
209 Ga0207705_10005516 3300025909 Bacteria 9460
210 Ga0207705_10019599 3300025909 Bacteria 4836
211 Ga0207705_10023281 3300025909 Bacteria 4419
212 Ga0207705_10026804 3300025909 Bacteria 4107
213 Ga0207654_10029437 3300025911 Bacteria 3007
214 Ga0207707_10159519 3300025912 Bacteria 1972
215 Ga0207695_10011178 3300025913 Bacteria 10892
216 Ga0207671_10234042 3300025914 Bacteria 1442
217 Ga0207663_11683638 3300025916 Bacteria 510
218 Ga0207660_10033761 3300025917 Bacteria 3542
219 Ga0207657_10000020 3300025919 Bacteria 157826
220 Ga0207657_10000956 3300025919 Bacteria 30551
221 Ga0207657_10001472 3300025919 Bacteria 25161
222 Ga0207657_10008938 3300025919 Bacteria 10122
223 Ga0207657_10016201 3300025919 Bacteria 7195
224 Ga0207657_10023326 3300025919 Bacteria 5764
225 Ga0207657_10040377 3300025919 Bacteria 4134
226 Ga0207657_10123942 3300025919 Bacteria 2123
227 Ga0207657_10218127 3300025919 Bacteria 1529
228 Ga0207657_10350145 3300025919 Bacteria 1165
229 Ga0207649_10006175 3300025920 Bacteria 6502
230 Ga0207649_10006974 3300025920 Bacteria 6139
231 Ga0207649_10040996 3300025920 Bacteria 2817
232 Ga0207649_10085951 3300025920 Bacteria 2048
233 Ga0207649_10166874 3300025920 Bacteria 1530
234 Ga0207649_10298133 3300025920 Bacteria 1178
235 Ga0207649_10705919 3300025920 Bacteria 782
236 Ga0207681_10182144 3300025923 Bacteria 1601
237 Ga0207681_10563855 3300025923 Bacteria 938
238 Ga0207694_10012584 3300025924 Bacteria 6377
239 Ga0207650_10014857 3300025925 Bacteria 5416
240 Ga0207650_10126560 3300025925 Bacteria 1995
241 Ga0207650_10463340 3300025925 Bacteria 1056
242 Ga0207659_10010954 3300025926 Bacteria 5712
243 Ga0207659_10054843 3300025926 Bacteria 2848
244 Ga0207659_10106311 3300025926 Bacteria 2125
245 Ga0207687_10106570 3300025927 Bacteria 2072
246 Ga0207664_10048259 3300025929 Bacteria 3348
247 Ga0207644_10008480 3300025931 Bacteria 6728
248 Ga0207644_10022518 3300025931 Bacteria 4305
249 Ga0207644_10417773 3300025931 Bacteria 1098
250 Ga0207690_10000005 3300025932 Bacteria 581199
251 Ga0207690_10006514 3300025932 Bacteria 6922
252 Ga0207690_10035807 3300025932 Bacteria 3210
253 Ga0207690_10184377 3300025932 Bacteria 1574
254 Ga0207690_10818042 3300025932 Bacteria 770
255 Ga0207706_10004731 3300025933 Bacteria 12745
256 Ga0207706_10008102 3300025933 Bacteria 9697
257 Ga0207706_10042070 3300025933 Bacteria 4048
258 Ga0207706_10048797 3300025933 Bacteria 3744
259 Ga0207706_10128318 3300025933 Bacteria 2230
260 Ga0207706_10190921 3300025933 Bacteria 1798
261 Ga0207706_10325113 3300025933 Bacteria 1338
262 Ga0207686_10608442 3300025934 Bacteria 861
263 Ga0207669_10132330 3300025937 Bacteria 1716
264 Ga0207669_11201930 3300025937 Bacteria 642
265 Ga0207665_10181708 3300025939 Bacteria 1524
266 Ga0207691_10017864 3300025940 Bacteria 6721
267 Ga0207691_10535897 3300025940 Bacteria 993
268 Ga0207711_10029264 3300025941 Bacteria 4644
269 Ga0207711_10092092 3300025941 Bacteria 2667
270 Ga0207711_10252837 3300025941 Bacteria 1618
271 Ga0207661_10001385 3300025944 Bacteria 16276
272 Ga0207661_10016355 3300025944 Bacteria 5471
273 Ga0207661_10119172 3300025944 Bacteria 2245
274 Ga0207661_10664410 3300025944 Bacteria 958
275 Ga0207679_10069227 3300025945 Bacteria 2655
276 Ga0207679_10155549 3300025945 Bacteria 1866
277 Ga0207679_10303797 3300025945 Bacteria 1376
278 Ga0207679_10422249 3300025945 Bacteria 1177
279 Ga0207667_10013474 3300025949 Bacteria 9356
280 Ga0207667_10016897 3300025949 Bacteria 8232
281 Ga0207667_10471395 3300025949 Bacteria 1275
282 Ga0207651_10003994 3300025960 Bacteria 7332
283 Ga0207651_10105317 3300025960 Bacteria 2103
284 Ga0207668_10206272 3300025972 Bacteria 1569
285 Ga0207640_10009988 3300025981 Bacteria 5331
286 Ga0207640_10554571 3300025981 Bacteria 966
287 Ga0207658_10006970 3300025986 Bacteria 7693
288 Ga0207658_10405482 3300025986 Bacteria 1199
289 Ga0207677_10000029 3300026023 Bacteria 121521
290 Ga0207677_10099949 3300026023 Bacteria 2132
291 Ga0207677_10357908 3300026023 Bacteria 1225
292 Ga0207703_10055508 3300026035 Bacteria 3223
293 Ga0207703_10084841 3300026035 Bacteria 2649
294 Ga0207703_10229687 3300026035 Bacteria 1663
295 Ga0207639_10015722 3300026041 Bacteria 5339
296 Ga0207639_10084223 3300026041 Bacteria 2525
297 Ga0207639_10104336 3300026041 Bacteria 2298
298 Ga0207639_11575717 3300026041 Bacteria 616
299 Ga0207678_10001839 3300026067 Bacteria 19467
300 Ga0207678_10039236 3300026067 Bacteria 4110
301 Ga0207678_10049333 3300026067 Bacteria 3638
302 Ga0207678_10110665 3300026067 Bacteria 2343
303 Ga0207678_10282882 3300026067 Bacteria 1424
304 Ga0207678_10622727 3300026067 Bacteria 947
305 Ga0207702_10007190 3300026078 Bacteria 9527
306 Ga0207702_10034760 3300026078 Bacteria 4215
307 Ga0207702_10238351 3300026078 Bacteria 1703
308 Ga0207641_10182696 3300026088 Bacteria 1922
309 Ga0207641_10421406 3300026088 Bacteria 1285
310 Ga0207648_10144959 3300026089 Bacteria 2094
311 Ga0207648_10577045 3300026089 Bacteria 1035
312 Ga0207676_10002742 3300026095 Bacteria 12541
313 Ga0207674_10006650 3300026116 Bacteria 13580
314 Ga0207674_10017192 3300026116 Bacteria 7893
315 Ga0207674_10032929 3300026116 Bacteria 5432
316 Ga0207675_100087359 3300026118 Bacteria 2928
317 Ga0207683_10004762 3300026121 Bacteria 11684
318 Ga0207683_10019975 3300026121 Bacteria 5723
319 Ga0207683_10334952 3300026121 Bacteria 1387
320 Ga0207698_10001626 3300026142 Bacteria 13084
321 Ga0207698_10055084 3300026142 Bacteria 3062
322 Ga0207698_10083958 3300026142 Bacteria 2580
323 Ga0207698_10117903 3300026142 Bacteria 2240
324 Ga0207698_10580944 3300026142 Bacteria 1102
325 Ga0268266_10000002 3300028379 Bacteria 3059047
326 Ga0268266_10000055 3300028379 Bacteria 291630
327 Ga0268266_10001357 3300028379 Bacteria 29539
328 Ga0268266_10025308 3300028379 Bacteria 5049
329 Ga0268266_10060172 3300028379 Bacteria 3274
330 Ga0268264_10001374 3300028381 Bacteria 22774
331 Ga0268264_10297655 3300028381 Bacteria 1518
332 Ga0307517_10013727 3300028786 Bacteria 10972
333 Ga0307517_10014263 3300028786 Bacteria 10697
334 Ga0307408_100323218 3300031548 Bacteria 1300
335 Ga0307413_10724669 3300031824 Bacteria 829
336 Ga0307410_10089059 3300031852 Bacteria 2186
337 Ga0307410_10434281 3300031852 Bacteria 1068
338 Ga0307410_11030581 3300031852 Bacteria 711
339 Ga0307409_100436109 3300031995 Bacteria 1261
340 Ga0307416_100053751 3300032002 Bacteria 3233
341 Ga0307416_102446469 3300032002 Bacteria 621
342 Ga0307411_10114703 3300032005 Bacteria 1936
343 Ga0307415_100062716 3300032126 Bacteria 2579
344 Ga0307415_100096046 3300032126 Bacteria 2159
345 Ga0307415_100097534 3300032126 Bacteria 2146
346 Ga0373937_0759291 3300036401 Bacteria 917
347 Ga0395899_0002128 3300037312 Bacteria 16274
348 Ga0395899_0028050 3300037312 Bacteria 4240
349 Ga0395899_0039174 3300037312 Bacteria 3549
350 Ga0395900_0000136 3300037418 Bacteria 123664
351 Ga0395900_0160070 3300037418 Bacteria 2296
352 Ga0395900_0203065 3300037418 Bacteria 2004
353 Ga0395900_0611277 3300037418 Bacteria 1030
354 Ga0395900_1185067 3300037418 Bacteria 679
355 Ga0395900_1480587 3300037418 Bacteria 591
356 Ga0395898_0114959 3300037466 Bacteria 2578
357 Ga0395905_0055292 3300037471 Bacteria 3715
358 Ga0395905_0081052 3300037471 Bacteria 3041
359 Ga0395905_0219755 3300037471 Bacteria 1778
360 Ga0395905_0278545 3300037471 Bacteria 1558
361 Ga0395905_0294705 3300037471 Bacteria 1509
362 Ga0395905_0808634 3300037471 Bacteria 840
363 Ga0436364_1182596 3300037853 Bacteria 26080
364 Ga0395901_0000108 3300038443 Bacteria 113046
365 Ga0395901_0170937 3300038443 Bacteria 2280
366 Ga0395901_0237027 3300038443 Bacteria 1904
367 Ga0395901_0350477 3300038443 Bacteria 1523
368 Ga0395901_0483071 3300038443 Bacteria 1263
369 Ga0436365_0904559 3300039437 Bacteria 6510
370 Ga0436363_0985695 3300039450 Bacteria 1476
371 Ga0436362_0511555 3300039453 Bacteria 691
372 Ga0439436_0048151 3300041404 Bacteria 1210
373 Ga0451791_0210941 3300041451 Bacteria 569
374 Ga0451807_2701616 3300041486 Bacteria 1343
375 Ga0451845_0229754 3300041501 Bacteria 562
376 Ga0451849_0931423 3300041505 Bacteria 519
377 Ga0466972_0327081 3300044658 Bacteria 717
378 Ga0466966_0069967 3300044684 Bacteria 2200
379 Ga0466966_0334758 3300044684 Bacteria 910
380 Ga0466966_0335768 3300044684 Bacteria 908
381 Ga0466961_0239926 3300044693 Bacteria 1114
382 Ga0466961_0334993 3300044693 Bacteria 922
383 Ga0466963_0148695 3300044694 Bacteria 1626
384 Ga0466963_0395705 3300044694 Bacteria 974
385 Ga0466963_0962051 3300044694 Bacteria 601
386 Ga0466971_0017104 3300044719 Bacteria 3204
387 Ga0466971_0054448 3300044719 Bacteria 1803
388 Ga0466970_0248836 3300044765 Bacteria 995
389 Ga0466970_0371753 3300044765 Unclassified 813
390 Ga0466970_0657754 3300044765 Bacteria 610
391 Ga0466957_0022292 3300044842 Bacteria 3735
392 Ga0466957_0317056 3300044842 Bacteria 1051
393 Ga0466957_0549235 3300044842 Bacteria 805
394 Ga0466957_0863612 3300044842 Bacteria 645
395 Ga0466959_0169395 3300045049 Bacteria 1532
396 Ga0466959_0296455 3300045049 Bacteria 1108
397 Ga0466958_0115482 3300045836 Bacteria 1677
398 Ga0466967_0197459 3300045976 Bacteria 1904
399 Ga0466967_0574511 3300045976 Bacteria 1111
400 Ga0466967_0696146 3300045976 Bacteria 1006
401 Ga0466967_0802729 3300045976 Bacteria 934
402 Ga0495617_069095 3300046452 Bacteria 1162
403 Ga0495650_0000629 3300046471 Bacteria 47390
404 Ga0495639_0355702 3300046475 Bacteria 736
405 Ga0495583_0000420 3300046506 Bacteria 64084
406 Ga0495632_0508651 3300046519 Bacteria 519
407 Ga0495621_0029908 3300046539 Bacteria 1859
408 Ga0495633_0158769 3300046558 Bacteria 1043
409 Ga0495647_0185036 3300046681 Bacteria 908
410 Ga0495669_0009628 3300046684 Bacteria 4077
411 Ga0495669_0082539 3300046684 Bacteria 1477
412 Ga0495687_072917 3300047443 Bacteria 1370
413 Ga0495677_0189936 3300047445 Bacteria 797
414 Ga0496100_0519909 3300048903 Bacteria 918
415 Ga0496101_0005873 3300048904 Bacteria 7860
416 Ga0496101_0125213 3300048904 Bacteria 1947
417 Ga0496101_0467800 3300048904 Bacteria 995
418 Ga0496107_0030888 3300048910 Bacteria 3820
419 Ga0496107_0099520 3300048910 Bacteria 2131
420 Ga0496108_0015293 3300048911 Bacteria 6261
421 Ga0496108_0155520 3300048911 Bacteria 1974
422 Ga0496109_0022342 3300048912 Bacteria 5602
423 Ga0496110_0006431 3300048913 Bacteria 9303
424 Ga0496111_0011626 3300048914 Bacteria 5938
425 Ga0496112_0028190 3300048915 Bacteria 5417
426 Ga0496112_0515631 3300048915 Bacteria 1130
427 Ga0496113_0017479 3300048916 Bacteria 4979
428 Ga0496113_0186171 3300048916 Bacteria 1647
429 Ga0496114_0064650 3300048917 Bacteria 3064
430 Ga0496115_0071443 3300048918 Bacteria 2815
431 Ga0496121_0037372 3300048924 Bacteria 4313
432 Ga0496123_0515390 3300048926 Bacteria 520
433 Ga0501034_0802269 3300049571 Bacteria 834
434 Ga0501047_1074671 3300049581 Bacteria 618
435 nmdc:mga0k408_304869_c1 3300050493 Bacteria 950
436 nmdc:mga0n895_24275_c1 3300050512 Bacteria 5711
437 Ga0500643_006988 3300053087 Bacteria 4630
438 Ga0500658_0177573 3300053134 Bacteria 969
439 Ga0500568_0000942 3300053139 Bacteria 20047
440 Ga0500604_0000043 3300053151 Bacteria 48703
441 Ga0500616_0000293 3300053153 Bacteria 72597
442 Ga0500636_0000413 3300053177 Bacteria 23522
443 Ga0500596_000823 3300053735 Bacteria 6138
444 Ga0587088_017665 3300059508 Bacteria 1151
445 Ga0466962_0026858 3300061719 Bacteria 2764
446 Ga0466962_0049730 3300061719 Bacteria 2004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100000155 Ga0070665_10000015512 144
2 3300028379 Ga0268266_10000002 Ga0268266_100000021492 144
3 3300053087 Ga0500643_006988 Ga0500643_006988_2681_3142 144
4 3300049571 Ga0501034_0802269 Ga0501034_0802269_342_806 145
5 3300049581 Ga0501047_1074671 Ga0501047_1074671_143_607 145
6 3300044694 Ga0466963_0395705 Ga0466963_0395705_404_895 146
7 3300044842 Ga0466957_0549235 Ga0466957_0549235_278_769 146
8 iso_pu_bacteria 2739367664 2739650786 148
9 iso_pu_bacteria 2739367865 2740029259 148
10 3300005338 Ga0068868_100040920 Ga0068868_1000409204 149
11 3300028786 Ga0307517_10014263 Ga0307517_100142639 149
12 3300038443 Ga0395901_0483071 Ga0395901_0483071_31_507 149
13 3300044694 Ga0466963_0962051 Ga0466963_0962051_11_499 149
14 3300059508 Ga0587088_017665 Ga0587088_017665_247_723 149
15 3300005367 Ga0070667_101174893 Ga0070667_1011748932 151
16 3300005563 Ga0068855_101958046 Ga0068855_1019580461 151
17 3300009553 Ga0105249_10078026 Ga0105249_100780265 151
18 3300028786 Ga0307517_10013727 Ga0307517_100137275 151
19 3300041501 Ga0451845_0229754 Ga0451845_0229754_96_551 151
20 3300003322 rootL2_10123961 rootL2_101239612 152
21 3300005262 Ga0065165_1001921 Ga0065165_100192115 152
22 3300005339 Ga0070660_100036808 Ga0070660_1000368082 152
23 3300005344 Ga0070661_100044664 Ga0070661_1000446643 152
24 3300005539 Ga0068853_100370587 Ga0068853_1003705872 152
25 3300013104 Ga0157370_10461209 Ga0157370_104612092 152
26 3300013105 Ga0157369_10008490 Ga0157369_100084904 152
27 3300025909 Ga0207705_10026804 Ga0207705_100268044 152
28 3300025919 Ga0207657_10008938 Ga0207657_1000893814 152
29 3300025920 Ga0207649_10166874 Ga0207649_101668742 152
30 3300025932 Ga0207690_10184377 Ga0207690_101843772 152
31 3300025949 Ga0207667_10471395 Ga0207667_104713953 152
32 3300026067 Ga0207678_10039236 Ga0207678_100392362 152
33 3300031824 Ga0307413_10724669 Ga0307413_107246691 152
34 3300031852 Ga0307410_10434281 Ga0307410_104342812 152
35 3300032002 Ga0307416_102446469 Ga0307416_1024464691 152
36 3300032126 Ga0307415_100096046 Ga0307415_1000960463 152
37 3300032126 Ga0307415_100097534 Ga0307415_1000975342 152
38 3300041486 Ga0451807_2701616 Ga0451807_2701616_40_498 152
39 3300044842 Ga0466957_0317056 Ga0466957_0317056_447_905 152
40 3300046558 Ga0495633_0158769 Ga0495633_0158769_381_848 152
41 3300048926 Ga0496123_0515390 Ga0496123_0515390_33_500 152
42 3300061719 Ga0466962_0049730 Ga0466962_0049730_345_803 152
43 3300001989 JGI24739J22299_10064366 JGI24739J22299_100643661 153
44 3300005335 Ga0070666_11341649 Ga0070666_113416491 153
45 3300005347 Ga0070668_100276052 Ga0070668_1002760522 153
46 3300005354 Ga0070675_100013986 Ga0070675_1000139864 153
47 3300005355 Ga0070671_100121534 Ga0070671_1001215343 153
48 3300005364 Ga0070673_100664441 Ga0070673_1006644412 153
49 3300005366 Ga0070659_100000034 Ga0070659_10000003418 153
50 3300005367 Ga0070667_100279128 Ga0070667_1002791282 153
51 3300005436 Ga0070713_100078826 Ga0070713_1000788263 153
52 3300005456 Ga0070678_100424803 Ga0070678_1004248031 153
53 3300005456 Ga0070678_100564541 Ga0070678_1005645412 153
54 3300005457 Ga0070662_100006322 Ga0070662_1000063223 153
55 3300005458 Ga0070681_10402016 Ga0070681_104020162 153
56 3300005539 Ga0068853_100510600 Ga0068853_1005106002 153
57 3300005544 Ga0070686_100000140 Ga0070686_10000014034 153
58 3300005548 Ga0070665_100005893 Ga0070665_10000589310 153
59 3300005616 Ga0068852_100371451 Ga0068852_1003714512 153
60 3300005616 Ga0068852_100585612 Ga0068852_1005856122 153
61 3300005617 Ga0068859_100037542 Ga0068859_1000375427 153
62 3300005617 Ga0068859_101683006 Ga0068859_1016830062 153
63 3300005841 Ga0068863_100033328 Ga0068863_1000333284 153
64 3300005843 Ga0068860_100051361 Ga0068860_1000513615 153
65 3300006846 Ga0075430_100645589 Ga0075430_1006455892 153
66 3300006871 Ga0075434_100299844 Ga0075434_1002998443 153
67 3300006881 Ga0068865_100083711 Ga0068865_1000837112 153
68 3300006931 Ga0097620_100037542 Ga0097620_1000375427 153
69 3300006931 Ga0097620_101682938 Ga0097620_1016829382 153
70 3300007076 Ga0075435_101486991 Ga0075435_1014869911 153
71 3300009098 Ga0105245_10418496 Ga0105245_104184962 153
72 3300009174 Ga0105241_11581925 Ga0105241_115819251 153
73 3300009177 Ga0105248_10992173 Ga0105248_109921732 153
74 3300009551 Ga0105238_10151906 Ga0105238_101519063 153
75 3300010375 Ga0105239_12709369 Ga0105239_127093691 153
76 3300013105 Ga0157369_10015109 Ga0157369_100151095 153
77 3300013105 Ga0157369_10246020 Ga0157369_102460202 153
78 3300013105 Ga0157369_11886304 Ga0157369_118863041 153
79 3300013308 Ga0157375_12504379 Ga0157375_125043791 153
80 3300020070 Ga0206356_11863626 Ga0206356_118636263 153
81 3300025903 Ga0207680_10671798 Ga0207680_106717982 153
82 3300025907 Ga0207645_10096203 Ga0207645_100962032 153
83 3300025919 Ga0207657_10001472 Ga0207657_1000147213 153
84 3300025920 Ga0207649_10705919 Ga0207649_107059192 153
85 3300025925 Ga0207650_10463340 Ga0207650_104633402 153
86 3300025926 Ga0207659_10010954 Ga0207659_100109544 153
87 3300025927 Ga0207687_10106570 Ga0207687_101065701 153
88 3300025931 Ga0207644_10417773 Ga0207644_104177732 153
89 3300025932 Ga0207690_10000005 Ga0207690_10000005227 153
90 3300025932 Ga0207690_10818042 Ga0207690_108180421 153
91 3300025933 Ga0207706_10008102 Ga0207706_100081027 153
92 3300025972 Ga0207668_10206272 Ga0207668_102062722 153
93 3300025986 Ga0207658_10405482 Ga0207658_104054821 153
94 3300026023 Ga0207677_10000029 Ga0207677_10000029119 153
95 3300026067 Ga0207678_10622727 Ga0207678_106227271 153
96 3300026088 Ga0207641_10421406 Ga0207641_104214063 153
97 3300026121 Ga0207683_10334952 Ga0207683_103349523 153
98 3300028379 Ga0268266_10001357 Ga0268266_1000135722 153
99 3300028381 Ga0268264_10297655 Ga0268264_102976552 153
100 3300031852 Ga0307410_11030581 Ga0307410_110305811 153
101 3300031995 Ga0307409_100436109 Ga0307409_1004361092 153
102 3300036401 Ga0373937_0759291 Ga0373937_0759291_288_749 153
103 3300037471 Ga0395905_0808634 Ga0395905_0808634_61_522 153
104 3300039437 Ga0436365_0904559 Ga0436365_0904559_1230_1691 153
105 3300039450 Ga0436363_0985695 Ga0436363_0985695_840_1301 153
106 3300039453 Ga0436362_0511555 Ga0436362_0511555_175_636 153
107 3300046519 Ga0495632_0508651 Ga0495632_0508651_37_498 153
108 3300046539 Ga0495621_0029908 Ga0495621_0029908_336_797 153
109 3300046684 Ga0495669_0009628 Ga0495669_0009628_784_1251 153
110 3300047445 Ga0495677_0189936 Ga0495677_0189936_273_740 153
111 3300048911 Ga0496108_0155520 Ga0496108_0155520_304_789 153
112 3300050512 nmdc:mga0n895_24275_c1 nmdc:mga0n895_24275_c1_911_1372 153
113 3300053134 Ga0500658_0177573 Ga0500658_0177573_443_904 153
114 3300053139 Ga0500568_0000942 Ga0500568_0000942_15898_16359 153
115 3300053151 Ga0500604_0000043 Ga0500604_0000043_8686_9147 153
116 3300053153 Ga0500616_0000293 Ga0500616_0000293_35385_35846 153
117 3300002239 JGI24034J26672_10059551 JGI24034J26672_100595512 154
118 3300005290 Ga0065712_10094237 Ga0065712_100942375 154
119 3300005327 Ga0070658_10615509 Ga0070658_106155092 154
120 3300005328 Ga0070676_10019824 Ga0070676_100198243 154
121 3300005331 Ga0070670_100001034 Ga0070670_10000103418 154
122 3300005335 Ga0070666_10175324 Ga0070666_101753242 154
123 3300005335 Ga0070666_10188818 Ga0070666_101888183 154
124 3300005338 Ga0068868_100158504 Ga0068868_1001585042 154
125 3300005339 Ga0070660_100019247 Ga0070660_1000192478 154
126 3300005339 Ga0070660_100113511 Ga0070660_1001135112 154
127 3300005344 Ga0070661_100013982 Ga0070661_1000139829 154
128 3300005344 Ga0070661_100060656 Ga0070661_1000606562 154
129 3300005353 Ga0070669_100195425 Ga0070669_1001954251 154
130 3300005354 Ga0070675_100036496 Ga0070675_1000364968 154
131 3300005355 Ga0070671_100023793 Ga0070671_1000237937 154
132 3300005356 Ga0070674_100155714 Ga0070674_1001557142 154
133 3300005356 Ga0070674_100407773 Ga0070674_1004077731 154
134 3300005356 Ga0070674_100853039 Ga0070674_1008530391 154
135 3300005364 Ga0070673_100002512 Ga0070673_10000251212 154
136 3300005364 Ga0070673_100024928 Ga0070673_1000249288 154
137 3300005364 Ga0070673_100052467 Ga0070673_1000524672 154
138 3300005367 Ga0070667_100005333 Ga0070667_10000533314 154
139 3300005435 Ga0070714_100098392 Ga0070714_1000983922 154
140 3300005436 Ga0070713_100005994 Ga0070713_1000059946 154
141 3300005436 Ga0070713_101697878 Ga0070713_1016978781 154
142 3300005455 Ga0070663_100766216 Ga0070663_1007662161 154
143 3300005456 Ga0070678_100032582 Ga0070678_1000325822 154
144 3300005457 Ga0070662_100001652 Ga0070662_10000165211 154
145 3300005457 Ga0070662_100014307 Ga0070662_1000143072 154
146 3300005457 Ga0070662_100197714 Ga0070662_1001977142 154
147 3300005459 Ga0068867_100187656 Ga0068867_1001876562 154
148 3300005466 Ga0070685_10309034 Ga0070685_103090342 154
149 3300005539 Ga0068853_100099668 Ga0068853_1000996682 154
150 3300005543 Ga0070672_100022888 Ga0070672_1000228882 154
151 3300005548 Ga0070665_100000105 Ga0070665_10000010520 154
152 3300005548 Ga0070665_100044781 Ga0070665_1000447812 154
153 3300005548 Ga0070665_100167811 Ga0070665_1001678113 154
154 3300005548 Ga0070665_101515203 Ga0070665_1015152032 154
155 3300005549 Ga0070704_100628374 Ga0070704_1006283742 154
156 3300005564 Ga0070664_100014497 Ga0070664_1000144972 154
157 3300005564 Ga0070664_100311923 Ga0070664_1003119232 154
158 3300005578 Ga0068854_100311205 Ga0068854_1003112053 154
159 3300005616 Ga0068852_100316603 Ga0068852_1003166032 154
160 3300005617 Ga0068859_100078102 Ga0068859_1000781025 154
161 3300005719 Ga0068861_100013143 Ga0068861_1000131432 154
162 3300005840 Ga0068870_10400966 Ga0068870_104009662 154
163 3300005841 Ga0068863_100025159 Ga0068863_1000251591 154
164 3300005842 Ga0068858_100003225 Ga0068858_10000322512 154
165 3300005842 Ga0068858_100162227 Ga0068858_1001622272 154
166 3300005843 Ga0068860_100004562 Ga0068860_10000456213 154
167 3300005844 Ga0068862_100284718 Ga0068862_1002847183 154
168 3300006028 Ga0070717_10470975 Ga0070717_104709752 154
169 3300006237 Ga0097621_100307297 Ga0097621_1003072973 154
170 3300006358 Ga0068871_100238088 Ga0068871_1002380882 154
171 3300006931 Ga0097620_100078099 Ga0097620_1000780995 154
172 3300009148 Ga0105243_12150079 Ga0105243_121500791 154
173 3300009176 Ga0105242_10514128 Ga0105242_105141282 154
174 3300009177 Ga0105248_10004580 Ga0105248_1000458013 154
175 3300009177 Ga0105248_10122482 Ga0105248_101224821 154
176 3300009177 Ga0105248_12154195 Ga0105248_121541951 154
177 3300013105 Ga0157369_10969075 Ga0157369_109690751 154
178 3300013296 Ga0157374_10006143 Ga0157374_100061433 154
179 3300013296 Ga0157374_10040625 Ga0157374_100406252 154
180 3300013297 Ga0157378_10088921 Ga0157378_100889215 154
181 3300013297 Ga0157378_10255971 Ga0157378_102559713 154
182 3300013297 Ga0157378_10729739 Ga0157378_107297392 154
183 3300013306 Ga0163162_10003899 Ga0163162_100038999 154
184 3300013306 Ga0163162_10060325 Ga0163162_100603256 154
185 3300013306 Ga0163162_10920801 Ga0163162_109208012 154
186 3300013307 Ga0157372_10210265 Ga0157372_102102652 154
187 3300013308 Ga0157375_10003022 Ga0157375_1000302217 154
188 3300013308 Ga0157375_10083253 Ga0157375_100832533 154
189 3300013308 Ga0157375_10351342 Ga0157375_103513423 154
190 3300013308 Ga0157375_11129690 Ga0157375_111296902 154
191 3300014325 Ga0163163_10006110 Ga0163163_1000611011 154
192 3300014326 Ga0157380_11003545 Ga0157380_110035452 154
193 3300014969 Ga0157376_10250455 Ga0157376_102504553 154
194 3300025315 Ga0207697_10201253 Ga0207697_102012532 154
195 3300025901 Ga0207688_10085286 Ga0207688_100852861 154
196 3300025903 Ga0207680_10008260 Ga0207680_100082602 154
197 3300025903 Ga0207680_10070333 Ga0207680_100703332 154
198 3300025907 Ga0207645_10023748 Ga0207645_100237483 154
199 3300025908 Ga0207643_10280556 Ga0207643_102805562 154
200 3300025916 Ga0207663_11683638 Ga0207663_116836381 154
201 3300025919 Ga0207657_10023326 Ga0207657_100233267 154
202 3300025919 Ga0207657_10350145 Ga0207657_103501453 154
203 3300025920 Ga0207649_10006175 Ga0207649_100061754 154
204 3300025923 Ga0207681_10182144 Ga0207681_101821443 154
205 3300025923 Ga0207681_10563855 Ga0207681_105638552 154
206 3300025925 Ga0207650_10014857 Ga0207650_100148572 154
207 3300025925 Ga0207650_10126560 Ga0207650_101265602 154
208 3300025926 Ga0207659_10054843 Ga0207659_100548432 154
209 3300025926 Ga0207659_10106311 Ga0207659_101063111 154
210 3300025931 Ga0207644_10008480 Ga0207644_1000848010 154
211 3300025931 Ga0207644_10022518 Ga0207644_100225182 154
212 3300025933 Ga0207706_10004731 Ga0207706_1000473113 154
213 3300025933 Ga0207706_10042070 Ga0207706_100420705 154
214 3300025933 Ga0207706_10325113 Ga0207706_103251132 154
215 3300025934 Ga0207686_10608442 Ga0207686_106084422 154
216 3300025937 Ga0207669_10132330 Ga0207669_101323303 154
217 3300025937 Ga0207669_11201930 Ga0207669_112019301 154
218 3300025939 Ga0207665_10181708 Ga0207665_101817083 154
219 3300025940 Ga0207691_10017864 Ga0207691_100178648 154
220 3300025940 Ga0207691_10535897 Ga0207691_105358971 154
221 3300025941 Ga0207711_10029264 Ga0207711_100292641 154
222 3300025941 Ga0207711_10092092 Ga0207711_100920925 154
223 3300025941 Ga0207711_10252837 Ga0207711_102528373 154
224 3300025945 Ga0207679_10069227 Ga0207679_100692272 154
225 3300025945 Ga0207679_10303797 Ga0207679_103037972 154
226 3300025960 Ga0207651_10003994 Ga0207651_100039944 154
227 3300025960 Ga0207651_10105317 Ga0207651_101053172 154
228 3300025981 Ga0207640_10554571 Ga0207640_105545711 154
229 3300025986 Ga0207658_10006970 Ga0207658_100069701 154
230 3300026023 Ga0207677_10099949 Ga0207677_100999493 154
231 3300026023 Ga0207677_10357908 Ga0207677_103579081 154
232 3300026035 Ga0207703_10055508 Ga0207703_100555081 154
233 3300026035 Ga0207703_10084841 Ga0207703_100848412 154
234 3300026035 Ga0207703_10229687 Ga0207703_102296872 154
235 3300026041 Ga0207639_10104336 Ga0207639_101043362 154
236 3300026067 Ga0207678_10110665 Ga0207678_101106652 154
237 3300026078 Ga0207702_10238351 Ga0207702_102383513 154
238 3300026088 Ga0207641_10182696 Ga0207641_101826962 154
239 3300026089 Ga0207648_10144959 Ga0207648_101449592 154
240 3300026089 Ga0207648_10577045 Ga0207648_105770451 154
241 3300026095 Ga0207676_10002742 Ga0207676_100027424 154
242 3300026118 Ga0207675_100087359 Ga0207675_1000873593 154
243 3300026121 Ga0207683_10004762 Ga0207683_100047623 154
244 3300026121 Ga0207683_10019975 Ga0207683_100199755 154
245 3300026142 Ga0207698_10055084 Ga0207698_100550843 154
246 3300026142 Ga0207698_10083958 Ga0207698_100839582 154
247 3300028379 Ga0268266_10000055 Ga0268266_10000055223 154
248 3300028379 Ga0268266_10025308 Ga0268266_100253082 154
249 3300028379 Ga0268266_10060172 Ga0268266_100601722 154
250 3300028381 Ga0268264_10001374 Ga0268264_100013747 154
251 3300037312 Ga0395899_0028050 Ga0395899_0028050_3455_3919 154
252 3300037418 Ga0395900_0203065 Ga0395900_0203065_1499_1963 154
253 3300037471 Ga0395905_0055292 Ga0395905_0055292_1005_1469 154
254 3300037471 Ga0395905_0219755 Ga0395905_0219755_436_900 154
255 3300041404 Ga0439436_0048151 Ga0439436_0048151_392_856 154
256 3300041451 Ga0451791_0210941 Ga0451791_0210941_25_489 154
257 3300041505 Ga0451849_0931423 Ga0451849_0931423_14_478 154
258 3300044684 Ga0466966_0069967 Ga0466966_0069967_1379_1843 154
259 3300044684 Ga0466966_0334758 Ga0466966_0334758_190_654 154
260 3300044693 Ga0466961_0239926 Ga0466961_0239926_103_567 154
261 3300044693 Ga0466961_0334993 Ga0466961_0334993_82_546 154
262 3300044694 Ga0466963_0148695 Ga0466963_0148695_46_510 154
263 3300044719 Ga0466971_0017104 Ga0466971_0017104_1512_1976 154
264 3300044765 Ga0466970_0248836 Ga0466970_0248836_379_843 154
265 3300044765 Ga0466970_0371753 Ga0466970_0371753_252_716 154
266 3300044765 Ga0466970_0657754 Ga0466970_0657754_29_493 154
267 3300044842 Ga0466957_0022292 Ga0466957_0022292_1685_2149 154
268 3300045049 Ga0466959_0169395 Ga0466959_0169395_572_1036 154
269 3300045836 Ga0466958_0115482 Ga0466958_0115482_581_1045 154
270 3300045976 Ga0466967_0574511 Ga0466967_0574511_205_669 154
271 3300045976 Ga0466967_0696146 Ga0466967_0696146_448_912 154
272 3300045976 Ga0466967_0802729 Ga0466967_0802729_319_783 154
273 3300046475 Ga0495639_0355702 Ga0495639_0355702_11_475 154
274 3300046681 Ga0495647_0185036 Ga0495647_0185036_227_691 154
275 3300046684 Ga0495669_0082539 Ga0495669_0082539_74_586 154
276 3300047443 Ga0495687_072917 Ga0495687_072917_618_1082 154
277 3300048903 Ga0496100_0519909 Ga0496100_0519909_308_781 154
278 3300048904 Ga0496101_0005873 Ga0496101_0005873_6431_6904 154
279 3300048904 Ga0496101_0125213 Ga0496101_0125213_1419_1892 154
280 3300048904 Ga0496101_0467800 Ga0496101_0467800_469_933 154
281 3300048910 Ga0496107_0030888 Ga0496107_0030888_2368_2841 154
282 3300048910 Ga0496107_0099520 Ga0496107_0099520_667_1131 154
283 3300048911 Ga0496108_0015293 Ga0496108_0015293_2355_2828 154
284 3300048912 Ga0496109_0022342 Ga0496109_0022342_4058_4531 154
285 3300048913 Ga0496110_0006431 Ga0496110_0006431_4143_4616 154
286 3300048914 Ga0496111_0011626 Ga0496111_0011626_4270_4743 154
287 3300048915 Ga0496112_0028190 Ga0496112_0028190_3140_3613 154
288 3300048915 Ga0496112_0515631 Ga0496112_0515631_254_718 154
289 3300048916 Ga0496113_0017479 Ga0496113_0017479_269_742 154
290 3300048916 Ga0496113_0186171 Ga0496113_0186171_271_735 154
291 3300048917 Ga0496114_0064650 Ga0496114_0064650_1618_2091 154
292 3300048918 Ga0496115_0071443 Ga0496115_0071443_1838_2311 154
293 3300050493 nmdc:mga0k408_304869_c1 nmdc:mga0k408_304869_c1_461_925 154
294 3300061719 Ga0466962_0026858 Ga0466962_0026858_789_1253 154
295 3300001979 JGI24740J21852_10008605 JGI24740J21852_100086053 155
296 3300001989 JGI24739J22299_10090181 JGI24739J22299_100901812 155
297 3300002067 JGI24735J21928_10059666 JGI24735J21928_100596662 155
298 3300002067 JGI24735J21928_10072222 JGI24735J21928_100722222 155
299 3300005327 Ga0070658_10048736 Ga0070658_100487362 155
300 3300005327 Ga0070658_10289540 Ga0070658_102895402 155
301 3300005327 Ga0070658_11154646 Ga0070658_111546461 155
302 3300005329 Ga0070683_100059595 Ga0070683_1000595952 155
303 3300005336 Ga0070680_100017636 Ga0070680_10001763610 155
304 3300005336 Ga0070680_100222129 Ga0070680_1002221292 155
305 3300005337 Ga0070682_100053399 Ga0070682_1000533992 155
306 3300005337 Ga0070682_100412958 Ga0070682_1004129582 155
307 3300005339 Ga0070660_100000493 Ga0070660_10000049316 155
308 3300005339 Ga0070660_100007352 Ga0070660_10000735210 155
309 3300005339 Ga0070660_100352866 Ga0070660_1003528662 155
310 3300005339 Ga0070660_100515296 Ga0070660_1005152962 155
311 3300005341 Ga0070691_10006375 Ga0070691_100063757 155
312 3300005344 Ga0070661_100116348 Ga0070661_1001163483 155
313 3300005344 Ga0070661_100365665 Ga0070661_1003656652 155
314 3300005345 Ga0070692_10019550 Ga0070692_100195502 155
315 3300005345 Ga0070692_10031674 Ga0070692_100316742 155
316 3300005366 Ga0070659_100065110 Ga0070659_1000651103 155
317 3300005366 Ga0070659_100317045 Ga0070659_1003170452 155
318 3300005435 Ga0070714_100010037 Ga0070714_1000100372 155
319 3300005455 Ga0070663_100029451 Ga0070663_1000294513 155
320 3300005455 Ga0070663_100084574 Ga0070663_1000845744 155
321 3300005455 Ga0070663_100161809 Ga0070663_1001618093 155
322 3300005457 Ga0070662_100076316 Ga0070662_1000763162 155
323 3300005457 Ga0070662_100154175 Ga0070662_1001541752 155
324 3300005458 Ga0070681_10093694 Ga0070681_100936942 155
325 3300005530 Ga0070679_100334993 Ga0070679_1003349932 155
326 3300005535 Ga0070684_100007275 Ga0070684_10000727511 155
327 3300005535 Ga0070684_100057990 Ga0070684_1000579903 155
328 3300005535 Ga0070684_100549818 Ga0070684_1005498182 155
329 3300005539 Ga0068853_100011622 Ga0068853_1000116222 155
330 3300005539 Ga0068853_100733794 Ga0068853_1007337942 155
331 3300005564 Ga0070664_100060424 Ga0070664_1000604242 155
332 3300005564 Ga0070664_100329228 Ga0070664_1003292282 155
333 3300005577 Ga0068857_100028109 Ga0068857_1000281092 155
334 3300005577 Ga0068857_100078813 Ga0068857_1000788133 155
335 3300005577 Ga0068857_100623649 Ga0068857_1006236492 155
336 3300005578 Ga0068854_100043828 Ga0068854_1000438282 155
337 3300005578 Ga0068854_100065463 Ga0068854_1000654632 155
338 3300005578 Ga0068854_100071352 Ga0068854_1000713522 155
339 3300005578 Ga0068854_100541639 Ga0068854_1005416392 155
340 3300005614 Ga0068856_100321116 Ga0068856_1003211163 155
341 3300005616 Ga0068852_100217235 Ga0068852_1002172352 155
342 3300005616 Ga0068852_100651850 Ga0068852_1006518502 155
343 3300005834 Ga0068851_10046728 Ga0068851_100467282 155
344 3300009093 Ga0105240_10071890 Ga0105240_100718902 155
345 3300009093 Ga0105240_10119591 Ga0105240_101195914 155
346 3300009545 Ga0105237_10059044 Ga0105237_100590447 155
347 3300009551 Ga0105238_10150477 Ga0105238_101504771 155
348 3300009551 Ga0105238_10174177 Ga0105238_101741772 155
349 3300013100 Ga0157373_10027783 Ga0157373_100277832 155
350 3300013100 Ga0157373_10121285 Ga0157373_101212852 155
351 3300013100 Ga0157373_10168088 Ga0157373_101680883 155
352 3300013102 Ga0157371_10022019 Ga0157371_100220198 155
353 3300013102 Ga0157371_10048250 Ga0157371_100482505 155
354 3300013102 Ga0157371_10207819 Ga0157371_102078192 155
355 3300013102 Ga0157371_10591895 Ga0157371_105918951 155
356 3300013104 Ga0157370_10021937 Ga0157370_100219378 155
357 3300013104 Ga0157370_10064826 Ga0157370_100648266 155
358 3300013104 Ga0157370_10217817 Ga0157370_102178173 155
359 3300013104 Ga0157370_10695236 Ga0157370_106952361 155
360 3300013105 Ga0157369_10062341 Ga0157369_100623412 155
361 3300013105 Ga0157369_11869372 Ga0157369_118693721 155
362 3300013307 Ga0157372_10176333 Ga0157372_101763331 155
363 3300020081 Ga0206354_10364096 Ga0206354_103640961 155
364 3300020082 Ga0206353_10501187 Ga0206353_105011872 155
365 3300025904 Ga0207647_10006225 Ga0207647_1000622511 155
366 3300025904 Ga0207647_10098727 Ga0207647_100987272 155
367 3300025904 Ga0207647_10222360 Ga0207647_102223602 155
368 3300025909 Ga0207705_10005516 Ga0207705_100055166 155
369 3300025909 Ga0207705_10019599 Ga0207705_100195992 155
370 3300025909 Ga0207705_10023281 Ga0207705_100232812 155
371 3300025911 Ga0207654_10029437 Ga0207654_100294372 155
372 3300025912 Ga0207707_10159519 Ga0207707_101595193 155
373 3300025913 Ga0207695_10011178 Ga0207695_1001117811 155
374 3300025914 Ga0207671_10234042 Ga0207671_102340422 155
375 3300025917 Ga0207660_10033761 Ga0207660_100337616 155
376 3300025919 Ga0207657_10000020 Ga0207657_1000002062 155
377 3300025919 Ga0207657_10000956 Ga0207657_1000095631 155
378 3300025919 Ga0207657_10016201 Ga0207657_100162019 155
379 3300025919 Ga0207657_10040377 Ga0207657_100403775 155
380 3300025919 Ga0207657_10123942 Ga0207657_101239423 155
381 3300025919 Ga0207657_10218127 Ga0207657_102181272 155
382 3300025920 Ga0207649_10006974 Ga0207649_100069742 155
383 3300025920 Ga0207649_10040996 Ga0207649_100409963 155
384 3300025920 Ga0207649_10085951 Ga0207649_100859512 155
385 3300025920 Ga0207649_10298133 Ga0207649_102981332 155
386 3300025924 Ga0207694_10012584 Ga0207694_100125842 155
387 3300025929 Ga0207664_10048259 Ga0207664_100482592 155
388 3300025932 Ga0207690_10006514 Ga0207690_100065144 155
389 3300025932 Ga0207690_10035807 Ga0207690_100358072 155
390 3300025933 Ga0207706_10048797 Ga0207706_100487973 155
391 3300025933 Ga0207706_10128318 Ga0207706_101283182 155
392 3300025933 Ga0207706_10190921 Ga0207706_101909212 155
393 3300025944 Ga0207661_10001385 Ga0207661_1000138517 155
394 3300025944 Ga0207661_10016355 Ga0207661_100163552 155
395 3300025944 Ga0207661_10119172 Ga0207661_101191723 155
396 3300025944 Ga0207661_10664410 Ga0207661_106644102 155
397 3300025945 Ga0207679_10155549 Ga0207679_101555493 155
398 3300025945 Ga0207679_10422249 Ga0207679_104222492 155
399 3300025949 Ga0207667_10013474 Ga0207667_100134742 155
400 3300025949 Ga0207667_10016897 Ga0207667_100168976 155
401 3300025981 Ga0207640_10009988 Ga0207640_100099887 155
402 3300026041 Ga0207639_10015722 Ga0207639_100157229 155
403 3300026041 Ga0207639_10084223 Ga0207639_100842232 155
404 3300026041 Ga0207639_11575717 Ga0207639_115757171 155
405 3300026067 Ga0207678_10001839 Ga0207678_1000183915 155
406 3300026067 Ga0207678_10049333 Ga0207678_100493337 155
407 3300026067 Ga0207678_10282882 Ga0207678_102828822 155
408 3300026078 Ga0207702_10007190 Ga0207702_100071904 155
409 3300026078 Ga0207702_10034760 Ga0207702_100347602 155
410 3300026116 Ga0207674_10006650 Ga0207674_100066504 155
411 3300026116 Ga0207674_10017192 Ga0207674_100171925 155
412 3300026116 Ga0207674_10032929 Ga0207674_100329293 155
413 3300026142 Ga0207698_10001626 Ga0207698_1000162611 155
414 3300026142 Ga0207698_10117903 Ga0207698_101179031 155
415 3300026142 Ga0207698_10580944 Ga0207698_105809442 155
416 3300031548 Ga0307408_100323218 Ga0307408_1003232182 155
417 3300031852 Ga0307410_10089059 Ga0307410_100890592 155
418 3300032002 Ga0307416_100053751 Ga0307416_1000537513 155
419 3300032005 Ga0307411_10114703 Ga0307411_101147032 155
420 3300032126 Ga0307415_100062716 Ga0307415_1000627164 155
421 3300037312 Ga0395899_0002128 Ga0395899_0002128_5167_5634 155
422 3300037312 Ga0395899_0039174 Ga0395899_0039174_2440_2907 155
423 3300037418 Ga0395900_0000136 Ga0395900_0000136_119524_119991 155
424 3300037418 Ga0395900_0160070 Ga0395900_0160070_1486_1953 155
425 3300037418 Ga0395900_0611277 Ga0395900_0611277_279_746 155
426 3300037418 Ga0395900_1185067 Ga0395900_1185067_110_577 155
427 3300037418 Ga0395900_1480587 Ga0395900_1480587_20_526 155
428 3300037466 Ga0395898_0114959 Ga0395898_0114959_574_1041 155
429 3300037471 Ga0395905_0081052 Ga0395905_0081052_2381_2848 155
430 3300037471 Ga0395905_0278545 Ga0395905_0278545_224_691 155
431 3300037471 Ga0395905_0294705 Ga0395905_0294705_512_979 155
432 3300037853 Ga0436364_1182596 Ga0436364_1182596_24296_24781 155
433 3300038443 Ga0395901_0000108 Ga0395901_0000108_94087_94554 155
434 3300038443 Ga0395901_0170937 Ga0395901_0170937_468_935 155
435 3300038443 Ga0395901_0237027 Ga0395901_0237027_800_1306 155
436 3300038443 Ga0395901_0350477 Ga0395901_0350477_352_822 155
437 3300044658 Ga0466972_0327081 Ga0466972_0327081_134_601 155
438 3300044684 Ga0466966_0335768 Ga0466966_0335768_280_747 155
439 3300044719 Ga0466971_0054448 Ga0466971_0054448_359_826 155
440 3300044842 Ga0466957_0863612 Ga0466957_0863612_46_513 155
441 3300045049 Ga0466959_0296455 Ga0466959_0296455_80_547 155
442 3300045976 Ga0466967_0197459 Ga0466967_0197459_792_1265 155
443 3300046452 Ga0495617_069095 Ga0495617_069095_366_842 155
444 3300046471 Ga0495650_0000629 Ga0495650_0000629_26686_27174 155
445 3300046506 Ga0495583_0000420 Ga0495583_0000420_27998_28474 155
446 3300048924 Ga0496121_0037372 Ga0496121_0037372_835_1308 155
447 3300053177 Ga0500636_0000413 Ga0500636_0000413_11343_11819 155
448 3300053735 Ga0500596_000823 Ga0500596_000823_1803_2291 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01475

FUR

Ferric uptake regulator family

33

146

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y6i-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa hmgr 0.9082 32 96
4mtd-assembly1.cif.gz_B zinc uptake regulator complexed with zinc and dna 0.8616 12 154
7dh8-assembly1.cif.gz_A-2 crystal structure of holo xczur 0.8381 11 153
6qua-assembly1.cif.gz_A the complex structure of hsrosr-sg (vng0258/rosr-sg) 0.8299 27 97
7dh8-assembly1.cif.gz_A-2 crystal structure of holo xczur 0.8279 11 153
ID Description Score Start End Superfamily
4mteC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9145 12 94 1.10.10.10
4mtdB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9121 12 94 1.10.10.10
2xroF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9116 32 94 1.10.10.10
af_Q2FY73_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9084 11 94 1.10.10.10
4mteD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8903 7 94 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A258BNZ9-F1-model_v4 Transcriptional repressor 0.9705 1 108 GO:0003700
AF-A0A1G3JD87-F1-model_v4 Fur family transcriptional regulator 0.9652 1 152 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900376
AF-A0A5E7ZI02-F1-model_v4 Fur family transcriptional regulator 0.9612 2 153 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900376
AF-A0A2W6S2S8-F1-model_v4 Ferric uptake regulation protein 0.961 1 149 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900376
AF-A0A3N2QP22-F1-model_v4 deleted 0.9602 1 150

Feature Viewer

pLDDT pTM Quality
83.25 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map