F446160

General Info

Members Datasets Scaffolds Average Seq Length
448 267 894 184

Family's Representative Sequence

Representative Sequence 3300012475|Ga0157317_1002716|Ga0157317_10027162
Length 212
Sequence VVVAVMVPESRRFDTKRLAGPGRGAQDGGMAEHRAFFFVDPATDPREGGPTLRDEKGTLQEYLRAHRLTLELKCADLDAEQLARRSVPPSTMSLLGLVRHLAHVERVWFRIRCAQQDVPLLYQTPEDPDGDFNGAVADPAVVEEAWARWREEVAFAEQYVEGCADLSTTYTHTRTGELFSMRELLVHMIEEYARHNGHADFLRECVDGRVGM

Samples

Sample ID Description Type Environment
1 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
62 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
63 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
104 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
107 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
108 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
109 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
110 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
111 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
144 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
145 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
146 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
147 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
148 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
149 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
259 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
260 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
261 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
262 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
263 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
264 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
265 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
266 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
267 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0.67
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 9.15
Rhizosphere 88.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157317_1002716 3300012475 Bacteria 1062
2 JGI25153J46596_10028054 3300003215 Bacteria 1960
3 Ga0070683_100828762 3300005329 Bacteria 887
4 Ga0070680_100003824 3300005336 Bacteria 11258
5 Ga0070682_100062389 3300005337 Bacteria 2361
6 Ga0070682_100065839 3300005337 Bacteria 2304
7 Ga0068868_100550130 3300005338 Bacteria 1017
8 Ga0070660_100661517 3300005339 Bacteria 875
9 Ga0070689_100845820 3300005340 Bacteria 807
10 Ga0070691_10084317 3300005341 Bacteria 1560
11 Ga0070671_100223902 3300005355 Bacteria 1596
12 Ga0070674_100408741 3300005356 Bacteria 1111
13 Ga0070709_10111945 3300005434 Bacteria 1836
14 Ga0070709_10738168 3300005434 Bacteria 769
15 Ga0070714_100080574 3300005435 Bacteria 2833
16 Ga0070714_100450292 3300005435 Bacteria 1223
17 Ga0070714_100501301 3300005435 Bacteria 1158
18 Ga0070713_100003341 3300005436 Bacteria 10588
19 Ga0070713_100087190 3300005436 Bacteria 2677
20 Ga0070713_100123083 3300005436 Bacteria 2277
21 Ga0070710_10030321 3300005437 Bacteria 2909
22 Ga0070710_10051702 3300005437 Bacteria 2308
23 Ga0070701_10068452 3300005438 Bacteria 1891
24 Ga0070711_100005081 3300005439 Bacteria 7833
25 Ga0070711_100080273 3300005439 Bacteria 2322
26 Ga0070711_100125056 3300005439 Bacteria 1908
27 Ga0070711_100146878 3300005439 Bacteria 1774
28 Ga0070705_100033746 3300005440 Bacteria 2855
29 Ga0070705_100073648 3300005440 Bacteria 2073
30 Ga0070694_100772208 3300005444 Bacteria 786
31 Ga0070708_100025295 3300005445 Bacteria 5073
32 Ga0070678_100291390 3300005456 Bacteria 1384
33 Ga0070681_10421879 3300005458 Bacteria 1246
34 Ga0070681_11131082 3300005458 Bacteria 704
35 Ga0070706_100033833 3300005467 Bacteria 4718
36 Ga0070706_100071852 3300005467 Bacteria 3201
37 Ga0070706_100618933 3300005467 Bacteria 1006
38 Ga0070707_100031948 3300005468 Bacteria 5015
39 Ga0070707_100042724 3300005468 Bacteria 4340
40 Ga0070707_100097244 3300005468 Bacteria 2851
41 Ga0070707_100300603 3300005468 Bacteria 1559
42 Ga0070698_100001125 3300005471 Bacteria 29557
43 Ga0070698_100001131 3300005471 Bacteria 29508
44 Ga0070699_100348501 3300005518 Bacteria 1334
45 Ga0070684_100087845 3300005535 Bacteria 2761
46 Ga0070697_100404981 3300005536 Bacteria 1184
47 Ga0070696_100001964 3300005546 Bacteria 13509
48 Ga0070665_100125249 3300005548 Bacteria 2572
49 Ga0070665_100317562 3300005548 Bacteria 1562
50 Ga0070704_100294452 3300005549 Bacteria 1350
51 Ga0068855_100209817 3300005563 Bacteria 2189
52 Ga0070664_100837526 3300005564 Bacteria 861
53 Ga0068857_100137990 3300005577 Bacteria 2203
54 Ga0068856_100013755 3300005614 Bacteria 7823
55 Ga0068856_100026224 3300005614 Bacteria 5683
56 Ga0068856_100840949 3300005614 Bacteria 937
57 Ga0070702_100682145 3300005615 Bacteria 781
58 Ga0068864_100033549 3300005618 Bacteria 4364
59 Ga0068863_100052615 3300005841 Bacteria 3859
60 Ga0068863_100234954 3300005841 Bacteria 1769
61 Ga0068858_100010006 3300005842 Bacteria 9009
62 Ga0068860_100160438 3300005843 Bacteria 2168
63 Ga0081538_10007131 3300005981 Bacteria 9710
64 Ga0081540_1003252 3300005983 Bacteria 12918
65 Ga0081540_1184982 3300005983 Bacteria 775
66 Ga0070717_10121343 3300006028 Bacteria 2239
67 Ga0070717_10173844 3300006028 Bacteria 1874
68 Ga0070717_10566341 3300006028 Bacteria 1029
69 Ga0070715_10018585 3300006163 Bacteria 2651
70 Ga0070715_10300541 3300006163 Bacteria 858
71 Ga0070716_100200261 3300006173 Bacteria 1327
72 Ga0070716_100216188 3300006173 Bacteria 1284
73 Ga0070716_100358149 3300006173 Bacteria 1035
74 Ga0070712_100034458 3300006175 Bacteria 3431
75 Ga0070712_100063353 3300006175 Bacteria 2618
76 Ga0070712_100120704 3300006175 Bacteria 1972
77 Ga0070712_100391472 3300006175 Bacteria 1146
78 Ga0070712_100495520 3300006175 Bacteria 1023
79 Ga0097621_100614657 3300006237 Bacteria 994
80 Ga0068871_100036082 3300006358 Bacteria 3934
81 Ga0068871_100515803 3300006358 Bacteria 1079
82 Ga0075428_100630325 3300006844 Bacteria 1144
83 Ga0075433_10031006 3300006852 Bacteria 4566
84 Ga0075436_100219228 3300006914 Bacteria 1350
85 Ga0075435_100228829 3300007076 Bacteria 1579
86 Ga0075435_100533637 3300007076 Bacteria 1015
87 Ga0105240_10064136 3300009093 Bacteria 4566
88 Ga0105240_10515837 3300009093 Bacteria 1327
89 Ga0105245_10046910 3300009098 Bacteria 3861
90 Ga0105245_10116711 3300009098 Bacteria 2489
91 Ga0105245_10128410 3300009098 Bacteria 2375
92 Ga0105247_10040536 3300009101 Bacteria 2847
93 Ga0105247_10123377 3300009101 Bacteria 1681
94 Ga0114129_10137361 3300009147 Bacteria 3353
95 Ga0114129_10356554 3300009147 Bacteria 1936
96 Ga0114129_10537363 3300009147 Bacteria 1522
97 Ga0105241_10068108 3300009174 Bacteria 2757
98 Ga0105241_11022486 3300009174 Bacteria 774
99 Ga0105248_10115327 3300009177 Bacteria 3030
100 Ga0105248_10782717 3300009177 Bacteria 1077
101 Ga0105238_10680001 3300009551 Bacteria 1040
102 Ga0105238_10956467 3300009551 Bacteria 876
103 Ga0105239_10893780 3300010375 Bacteria 1019
104 Ga0105239_11135351 3300010375 Bacteria 900
105 Ga0157319_1007559 3300012497 Bacteria 810
106 Ga0157314_1007603 3300012500 Bacteria 877
107 Ga0157338_1021324 3300012515 Bacteria 757
108 Ga0157373_10412147 3300013100 Bacteria 969
109 Ga0157370_10294956 3300013104 Bacteria 1497
110 Ga0157369_10038014 3300013105 Bacteria 5265
111 Ga0157369_10479798 3300013105 Bacteria 1287
112 Ga0157374_10144956 3300013296 Bacteria 2307
113 Ga0163162_11813300 3300013306 Bacteria 698
114 Ga0157372_10000044 3300013307 Bacteria 152637
115 Ga0157372_10413763 3300013307 Bacteria 1571
116 Ga0157372_10443996 3300013307 Bacteria 1512
117 Ga0157375_10176723 3300013308 Bacteria 2285
118 Ga0163163_10010795 3300014325 Bacteria 8244
119 Ga0163163_11228538 3300014325 Bacteria 812
120 Ga0157379_10010568 3300014968 Bacteria 8049
121 Ga0157376_10156779 3300014969 Bacteria 2060
122 Ga0157376_10259581 3300014969 Bacteria 1627
123 Ga0157376_11082451 3300014969 Bacteria 827
124 Ga0206356_10412463 3300020070 Bacteria 1038
125 Ga0206353_10553803 3300020082 Bacteria 1026
126 Ga0206353_11842147 3300020082 Bacteria 1719
127 Ga0209758_1003155 3300025297 Bacteria 15485
128 Ga0207692_10363073 3300025898 Bacteria 895
129 Ga0207685_10004299 3300025905 Bacteria 3603
130 Ga0207685_10248581 3300025905 Bacteria 859
131 Ga0207699_10010526 3300025906 Bacteria 4646
132 Ga0207699_10014337 3300025906 Bacteria 4083
133 Ga0207684_10016302 3300025910 Bacteria 6380
134 Ga0207684_10114717 3300025910 Bacteria 2307
135 Ga0207695_10227398 3300025913 Bacteria 1771
136 Ga0207695_10350153 3300025913 Bacteria 1364
137 Ga0207671_10874566 3300025914 Bacteria 711
138 Ga0207693_10017098 3300025915 Bacteria 5788
139 Ga0207693_10046356 3300025915 Bacteria 3414
140 Ga0207663_10002342 3300025916 Bacteria 9098
141 Ga0207663_10012959 3300025916 Bacteria 4521
142 Ga0207663_10510193 3300025916 Bacteria 935
143 Ga0207657_10168559 3300025919 Bacteria 1775
144 Ga0207646_10021391 3300025922 Bacteria 5978
145 Ga0207646_10026300 3300025922 Bacteria 5313
146 Ga0207646_10028605 3300025922 Bacteria 5071
147 Ga0207646_10052109 3300025922 Bacteria 3662
148 Ga0207694_11124448 3300025924 Bacteria 665
149 Ga0207687_10315355 3300025927 Bacteria 1264
150 Ga0207700_10015813 3300025928 Bacteria 4991
151 Ga0207700_10019925 3300025928 Bacteria 4542
152 Ga0207700_10068574 3300025928 Bacteria 2719
153 Ga0207700_10095179 3300025928 Bacteria 2362
154 Ga0207700_10256426 3300025928 Bacteria 1496
155 Ga0207700_11233980 3300025928 Bacteria 667
156 Ga0207664_10028161 3300025929 Bacteria 4267
157 Ga0207664_10153995 3300025929 Bacteria 1955
158 Ga0207664_10472452 3300025929 Bacteria 1121
159 Ga0207709_10294540 3300025935 Bacteria 1204
160 Ga0207670_10578207 3300025936 Bacteria 920
161 Ga0207665_10011349 3300025939 Bacteria 5849
162 Ga0207665_10033298 3300025939 Bacteria 3414
163 Ga0207665_10229753 3300025939 Bacteria 1363
164 Ga0207665_10455924 3300025939 Bacteria 982
165 Ga0207711_10088600 3300025941 Bacteria 2718
166 Ga0207711_10616195 3300025941 Bacteria 1013
167 Ga0207661_10123648 3300025944 Bacteria 2207
168 Ga0207679_10675590 3300025945 Bacteria 936
169 Ga0207667_10177270 3300025949 Bacteria 2189
170 Ga0207702_10015816 3300026078 Bacteria 6246
171 Ga0207702_10385548 3300026078 Bacteria 1348
172 Ga0207702_10780007 3300026078 Bacteria 944
173 Ga0207641_10267365 3300026088 Bacteria 1603
174 Ga0207674_10028498 3300026116 Bacteria 5894
175 Ga0207698_10236303 3300026142 Bacteria 1662
176 Ga0268264_10104030 3300028381 Bacteria 2474
177 Ga0314311_1152003 3300030733 Bacteria 3608
178 Ga0307514_10225436 3300031649 Bacteria 1143
179 Ga0307416_101974932 3300032002 Bacteria 686
180 Ga0373930_0048117 3300034816 Bacteria 924
181 Ga0373948_0030017 3300034817 Bacteria 1091
182 Ga0373950_0019404 3300034818 Bacteria 1187
183 Ga0373958_0033495 3300034819 Bacteria 1019
184 Ga0373959_0028956 3300034820 Bacteria 1108
185 Ga0373938_0007302 3300034957 Bacteria 1940
186 Ga0373926_0018173 3300035083 Bacteria 2417
187 Ga0373928_0046189 3300035084 Bacteria 1015
188 Ga0373929_0022147 3300035085 Bacteria 1295
189 Ga0373940_0070720 3300035088 Bacteria 1015
190 Ga0373944_0015206 3300035089 Bacteria 2158
191 Ga0373949_0019602 3300035090 Bacteria 1542
192 Ga0373951_0032069 3300035091 Bacteria 1241
193 Ga0373923_0071272 3300035111 Bacteria 1492
194 Ga0373923_0314190 3300035111 Bacteria 743
195 Ga0373932_0061821 3300035112 Bacteria 1140
196 Ga0373945_0093188 3300035116 Bacteria 1169
197 Ga0373945_0221490 3300035116 Bacteria 791
198 Ga0373953_0066813 3300035117 Bacteria 1478
199 Ga0373954_0155956 3300035118 Bacteria 1116
200 Ga0373957_0196174 3300035120 Bacteria 840
201 Ga0373960_0125303 3300035121 Bacteria 856
202 Ga0373960_0162725 3300035121 Bacteria 769
203 Ga0373943_0009504 3300035170 Bacteria 4358
204 Ga0373943_0332220 3300035170 Bacteria 868
205 Ga0373943_0366569 3300035170 Bacteria 828
206 Ga0373946_0013166 3300035171 Bacteria 3105
207 Ga0373946_0185474 3300035171 Bacteria 989
208 Ga0373955_0128569 3300035172 Bacteria 1477
209 Ga0373942_0012985 3300035207 Bacteria 1997
210 Ga0373961_0075933 3300035241 Bacteria 1048
211 Ga0373962_0200321 3300035242 Bacteria 675
212 Ga0373962_0281691 3300035242 Bacteria 585
213 Ga0373924_0102350 3300035410 Bacteria 1233
214 Ga0373931_0046019 3300035691 Bacteria 2305
215 Ga0373935_0117105 3300035692 Bacteria 1775
216 Ga0373927_0270126 3300035695 Bacteria 1118
217 Ga0373947_0050787 3300035725 Bacteria 2493
218 Ga0373947_0059557 3300035725 Bacteria 2315
219 Ga0373925_0001671 3300037068 Bacteria 18678
220 Ga0373925_0153011 3300037068 Bacteria 1812
221 Ga0373925_0261601 3300037068 Bacteria 1390
222 Ga0373925_0464410 3300037068 Bacteria 1037
223 Ga0373925_0816965 3300037068 Bacteria 768
224 Ga0395899_0157594 3300037312 Bacteria 1606
225 Ga0395900_0612480 3300037418 Bacteria 1028
226 Ga0395898_0039291 3300037466 Bacteria 4684
227 Ga0395898_0160555 3300037466 Bacteria 2150
228 Ga0395898_1115833 3300037466 Bacteria 722
229 Ga0436364_0912176 3300037853 Bacteria 1517
230 Ga0395901_0036623 3300038443 Bacteria 5072
231 Ga0395901_0151467 3300038443 Bacteria 2437
232 Ga0395901_0185798 3300038443 Bacteria 2180
233 Ga0395901_0188642 3300038443 Bacteria 2162
234 Ga0439436_0011303 3300041404 Bacteria 2712
235 Ga0439439_0011733 3300041406 Bacteria 2112
236 Ga0439433_0002658 3300041999 Bacteria 3797
237 Ga0439442_011796 3300042002 Bacteria 1783
238 Ga0439457_000513 3300042014 Bacteria 11218
239 Ga0439462_0011416 3300042015 Bacteria 2261
240 Ga0450907_049596 3300042146 Bacteria 721
241 Ga0466969_0075255 3300044656 Bacteria 1618
242 Ga0466972_0112750 3300044658 Bacteria 1284
243 Ga0466972_0275299 3300044658 Bacteria 787
244 Ga0466966_0002577 3300044684 Bacteria 11879
245 Ga0466961_0045691 3300044693 Bacteria 2802
246 Ga0466961_0054274 3300044693 Bacteria 2556
247 Ga0466961_0086735 3300044693 Bacteria 1978
248 Ga0466961_0122403 3300044693 Bacteria 1633
249 Ga0466964_0005422 3300044706 Bacteria 4734
250 Ga0466957_0002626 3300044842 Bacteria 9697
251 Ga0466959_0004726 3300045049 Bacteria 9173
252 Ga0466958_0057160 3300045836 Bacteria 2371
253 Ga0466958_0062056 3300045836 Bacteria 2278
254 Ga0466958_0130605 3300045836 Bacteria 1577
255 Ga0466958_0292759 3300045836 Bacteria 1044
256 Ga0466967_0029475 3300045976 Bacteria 4593
257 Ga0466967_0141662 3300045976 Bacteria 2240
258 Ga0495592_0000865 3300046454 Bacteria 20959
259 Ga0495592_0474057 3300046454 Bacteria 781
260 Ga0495603_0016725 3300046455 Bacteria 4436
261 Ga0495603_0194059 3300046455 Bacteria 1174
262 Ga0495590_0210158 3300046457 Bacteria 717
263 Ga0495629_0019200 3300046459 Bacteria 4886
264 Ga0495629_0078827 3300046459 Bacteria 2299
265 Ga0495629_0193459 3300046459 Bacteria 1407
266 Ga0495641_0012901 3300046461 Bacteria 4635
267 Ga0495641_0125376 3300046461 Bacteria 1146
268 Ga0495651_0000438 3300046462 Bacteria 32068
269 Ga0495651_0196586 3300046462 Bacteria 1415
270 Ga0495651_0691141 3300046462 Bacteria 636
271 Ga0495653_0132171 3300046463 Bacteria 1765
272 Ga0495580_0411730 3300046472 Bacteria 910
273 Ga0495580_0657262 3300046472 Bacteria 689
274 Ga0495582_0210676 3300046473 Bacteria 1111
275 Ga0495639_0150918 3300046475 Bacteria 1121
276 Ga0495664_0042310 3300046477 Bacteria 2697
277 Ga0495664_0088415 3300046477 Bacteria 1862
278 Ga0495664_0535316 3300046477 Bacteria 698
279 Ga0495584_0447919 3300046491 Bacteria 657
280 Ga0495594_0001285 3300046499 Bacteria 13108
281 Ga0495594_0092266 3300046499 Bacteria 1698
282 Ga0495594_0128213 3300046499 Bacteria 1436
283 Ga0495583_0021581 3300046506 Bacteria 3309
284 Ga0495608_0259849 3300046511 Bacteria 1081
285 Ga0495608_0527481 3300046511 Bacteria 713
286 Ga0495608_0707065 3300046511 Bacteria 599
287 Ga0495618_0049603 3300046514 Bacteria 2651
288 Ga0495618_0145360 3300046514 Bacteria 1516
289 Ga0495620_0008341 3300046515 Bacteria 5567
290 Ga0495628_0023413 3300046516 Bacteria 5069
291 Ga0495628_0056238 3300046516 Bacteria 3098
292 Ga0495628_0914760 3300046516 Bacteria 608
293 Ga0495630_0018285 3300046517 Bacteria 5146
294 Ga0495630_0581905 3300046517 Bacteria 858
295 Ga0495630_0751072 3300046517 Bacteria 745
296 Ga0495643_0001849 3300046522 Bacteria 17967
297 Ga0495648_0122294 3300046524 Bacteria 1397
298 Ga0495666_0024017 3300046526 Bacteria 3015
299 Ga0495666_0050504 3300046526 Bacteria 1999
300 Ga0495652_0043747 3300046529 Bacteria 3857
301 Ga0495652_0138788 3300046529 Bacteria 1914
302 Ga0495665_0044782 3300046531 Bacteria 2350
303 Ga0495665_0113165 3300046531 Bacteria 1423
304 Ga0495665_0338383 3300046531 Bacteria 767
305 Ga0495640_0028780 3300046533 Bacteria 3996
306 Ga0495640_0068712 3300046533 Bacteria 2383
307 Ga0495586_0099327 3300046535 Bacteria 1614
308 Ga0495587_0008025 3300046536 Bacteria 6815
309 Ga0495645_0064800 3300046543 Bacteria 2643
310 Ga0495645_0077675 3300046543 Bacteria 2387
311 Ga0495622_0003768 3300046557 Bacteria 7091
312 Ga0495667_0021294 3300046559 Bacteria 4374
313 Ga0495667_0093694 3300046559 Bacteria 1945
314 Ga0495667_0205812 3300046559 Bacteria 1258
315 Ga0495668_0024163 3300046616 Bacteria 3458
316 Ga0495634_0053796 3300046642 Bacteria 2695
317 Ga0495634_0090258 3300046642 Bacteria 1991
318 Ga0495625_0065153 3300046660 Bacteria 2569
319 Ga0495588_0178444 3300046674 Bacteria 1122
320 Ga0495657_0024174 3300046675 Bacteria 4331
321 Ga0495657_0044556 3300046675 Bacteria 3017
322 Ga0495657_0364796 3300046675 Bacteria 853
323 Ga0495599_0005511 3300046678 Bacteria 7581
324 Ga0495623_0018599 3300046679 Bacteria 4487
325 Ga0495646_0000786 3300046680 Bacteria 17729
326 Ga0495646_0241796 3300046680 Bacteria 970
327 Ga0495647_0104558 3300046681 Bacteria 1175
328 Ga0495658_0313979 3300046683 Bacteria 993
329 Ga0495613_0044681 3300046689 Bacteria 3276
330 Ga0495613_0094019 3300046689 Bacteria 2169
331 Ga0495624_0024927 3300046690 Bacteria 3935
332 Ga0495624_0091552 3300046690 Bacteria 1876
333 Ga0495624_0831624 3300046690 Bacteria 545
334 Ga0495671_0417360 3300046692 Bacteria 642
335 Ga0495589_0011868 3300046794 Bacteria 4519
336 Ga0495600_0145543 3300046809 Bacteria 1536
337 Ga0495600_0211331 3300046809 Bacteria 1243
338 Ga0495660_0123489 3300046810 Bacteria 1307
339 Ga0495581_0055094 3300047315 Bacteria 2295
340 Ga0495604_0028201 3300047317 Bacteria 4465
341 Ga0495636_0436247 3300047318 Bacteria 628
342 Ga0495674_0071571 3300047319 Bacteria 2992
343 Ga0495674_0158940 3300047319 Bacteria 1891
344 Ga0495674_0995146 3300047319 Bacteria 643
345 Ga0495672_0153302 3300047320 Bacteria 1193
346 Ga0495676_0001143 3300047321 Bacteria 22539
347 Ga0495676_0082473 3300047321 Bacteria 2433
348 Ga0495676_0129536 3300047321 Bacteria 1824
349 Ga0495676_0138144 3300047321 Bacteria 1749
350 Ga0495680_0011180 3300047322 Bacteria 7970
351 Ga0495680_0320634 3300047322 Bacteria 1084
352 Ga0495683_0183765 3300047323 Bacteria 953
353 Ga0495675_0106467 3300047444 Bacteria 1752
354 Ga0495675_0535142 3300047444 Bacteria 670
355 Ga0495675_0542841 3300047444 Bacteria 664
356 Ga0495685_106181 3300047447 Bacteria 926
357 Ga0495684_0009270 3300047471 Bacteria 7598
358 Ga0495684_0016016 3300047471 Bacteria 5772
359 Ga0495684_0055878 3300047471 Bacteria 3010
360 Ga0495684_0138795 3300047471 Bacteria 1823
361 Ga0495593_0044529 3300047673 Bacteria 2373
362 Ga0495602_0040148 3300048088 Bacteria 4297
363 Ga0495602_0883618 3300048088 Bacteria 596
364 Ga0495614_0018796 3300048089 Bacteria 2993
365 Ga0495614_0058555 3300048089 Bacteria 1654
366 Ga0496100_0088379 3300048903 Bacteria 2109
367 Ga0496100_0091589 3300048903 Bacteria 2075
368 Ga0496100_0801286 3300048903 Bacteria 738
369 Ga0496101_0056930 3300048904 Bacteria 2826
370 Ga0496102_0100922 3300048905 Bacteria 2680
371 Ga0496102_0329083 3300048905 Bacteria 1439
372 Ga0496103_0019110 3300048906 Bacteria 4114
373 Ga0496103_0188325 3300048906 Bacteria 1327
374 Ga0496104_0002144 3300048907 Bacteria 17130
375 Ga0496104_0381343 3300048907 Bacteria 1322
376 Ga0496105_0003637 3300048908 Bacteria 11460
377 Ga0496105_0028035 3300048908 Bacteria 4605
378 Ga0496105_0163697 3300048908 Bacteria 1825
379 Ga0496105_0533707 3300048908 Bacteria 918
380 Ga0496106_0067030 3300048909 Bacteria 2735
381 Ga0496106_0433926 3300048909 Bacteria 1056
382 Ga0496106_0693998 3300048909 Bacteria 812
383 Ga0496107_0063651 3300048910 Bacteria 2673
384 Ga0496107_0162304 3300048910 Bacteria 1656
385 Ga0496108_0054232 3300048911 Bacteria 3364
386 Ga0496108_0097425 3300048911 Bacteria 2506
387 Ga0496108_0359587 3300048911 Bacteria 1270
388 Ga0496109_0153013 3300048912 Bacteria 2160
389 Ga0496109_0332091 3300048912 Bacteria 1435
390 Ga0496109_0345917 3300048912 Bacteria 1404
391 Ga0496110_0008965 3300048913 Bacteria 8069
392 Ga0496110_0019577 3300048913 Bacteria 5700
393 Ga0496111_0025641 3300048914 Bacteria 4160
394 Ga0496111_0454127 3300048914 Bacteria 945
395 Ga0496112_0037591 3300048915 Bacteria 4725
396 Ga0496112_0315394 3300048915 Bacteria 1508
397 Ga0496112_0343695 3300048915 Bacteria 1435
398 Ga0496113_0052902 3300048916 Bacteria 3034
399 Ga0496113_0121569 3300048916 Bacteria 2042
400 Ga0496113_0132143 3300048916 Bacteria 1959
401 Ga0496113_0196713 3300048916 Bacteria 1601
402 Ga0496114_0049326 3300048917 Bacteria 3502
403 Ga0496115_0183617 3300048918 Bacteria 1728
404 Ga0496115_0239901 3300048918 Bacteria 1494
405 Ga0496115_0839553 3300048918 Bacteria 712
406 Ga0501036_0678888 3300049572 Bacteria 852
407 Ga0501038_0373018 3300049574 Bacteria 1108
408 Ga0501039_0051523 3300049575 Bacteria 3185
409 Ga0501039_0095268 3300049575 Bacteria 2321
410 Ga0501040_0062024 3300049576 Bacteria 2572
411 Ga0501040_0916417 3300049576 Bacteria 635
412 Ga0501041_0277218 3300049577 Bacteria 1055
413 Ga0501067_0004493 3300049583 Bacteria 7694
414 Ga0501067_0012907 3300049583 Bacteria 4625
415 Ga0501067_0125156 3300049583 Bacteria 1430
416 Ga0501068_0105464 3300049584 Bacteria 1749
417 Ga0501068_0435389 3300049584 Bacteria 847
418 Ga0501069_0350166 3300049585 Bacteria 870
419 Ga0501070_0351697 3300049586 Bacteria 1196
420 Ga0501071_0068106 3300049587 Bacteria 2590
421 Ga0501074_0358232 3300049590 Bacteria 1035
422 Ga0501076_0042124 3300049592 Bacteria 3595
423 Ga0501077_0650503 3300049593 Bacteria 677
424 Ga0501080_0539776 3300049742 Bacteria 1039
425 Ga0501044_0665543 3300049823 Bacteria 929
426 Ga0501045_0047593 3300049824 Bacteria 3124
427 nmdc:mga05p37_1400319_c1 3300050507 Bacteria 704
428 nmdc:mga05p37_174982_c1 3300050507 Bacteria 2615
429 nmdc:mga05p37_402293_c1 3300050507 Bacteria 1598
430 nmdc:mga0n895_230143_c1 3300050512 Bacteria 1881
431 nmdc:mga08x19_395340_c1 3300050514 Bacteria 969
432 nmdc:mga08x19_732200_c1 3300050514 Bacteria 702
433 Ga0495601_0113349 3300053077 Bacteria 1757
434 Ga0495595_0059191 3300053084 Bacteria 1790
435 Ga0495619_0263887 3300053085 Bacteria 1193
436 Ga0495619_0271207 3300053085 Bacteria 1176
437 Ga0530510_0434078 3300061734 Bacteria 992
438 2643852058 2643221567 Bacteria 4163945
439 2644136509 2643221624 Bacteria 4384879
440 2738697071 2738541272 Bacteria 6848551
441 2739324239 2738543027 Bacteria 6409078
442 2753265278 2751185782 Bacteria 11227053
443 2760621150 2758568621 Bacteria 5967089
444 2912762882 2912757875 Bacteria 7940295
445 8054161560 8054160619 Bacteria 7783213
446 8056066156 8056060235 Bacteria 7259403
447 8056579966 8056579771 Bacteria 5840325
448 Ga0157317_1002716
449 JGI25153J46596_10028054
450 Ga0070683_100828762
451 Ga0070680_100003824
452 Ga0070682_100062389
453 Ga0070682_100065839
454 Ga0068868_100550130
455 Ga0070660_100661517
456 Ga0070689_100845820
457 Ga0070691_10084317
458 Ga0070671_100223902
459 Ga0070674_100408741
460 Ga0070709_10111945
461 Ga0070709_10738168
462 Ga0070714_100080574
463 Ga0070714_100450292
464 Ga0070714_100501301
465 Ga0070713_100003341
466 Ga0070713_100087190
467 Ga0070713_100123083
468 Ga0070710_10030321
469 Ga0070710_10051702
470 Ga0070701_10068452
471 Ga0070711_100005081
472 Ga0070711_100080273
473 Ga0070711_100125056
474 Ga0070711_100146878
475 Ga0070705_100033746
476 Ga0070705_100073648
477 Ga0070694_100772208
478 Ga0070708_100025295
479 Ga0070678_100291390
480 Ga0070681_10421879
481 Ga0070681_11131082
482 Ga0070706_100033833
483 Ga0070706_100071852
484 Ga0070706_100618933
485 Ga0070707_100031948
486 Ga0070707_100042724
487 Ga0070707_100097244
488 Ga0070707_100300603
489 Ga0070698_100001125
490 Ga0070698_100001131
491 Ga0070699_100348501
492 Ga0070684_100087845
493 Ga0070697_100404981
494 Ga0070696_100001964
495 Ga0070665_100125249
496 Ga0070665_100317562
497 Ga0070704_100294452
498 Ga0068855_100209817
499 Ga0070664_100837526
500 Ga0068857_100137990
501 Ga0068856_100013755
502 Ga0068856_100026224
503 Ga0068856_100840949
504 Ga0070702_100682145
505 Ga0068864_100033549
506 Ga0068863_100052615
507 Ga0068863_100234954
508 Ga0068858_100010006
509 Ga0068860_100160438
510 Ga0081538_10007131
511 Ga0081540_1003252
512 Ga0081540_1184982
513 Ga0070717_10121343
514 Ga0070717_10173844
515 Ga0070717_10566341
516 Ga0070715_10018585
517 Ga0070715_10300541
518 Ga0070716_100200261
519 Ga0070716_100216188
520 Ga0070716_100358149
521 Ga0070712_100034458
522 Ga0070712_100063353
523 Ga0070712_100120704
524 Ga0070712_100391472
525 Ga0070712_100495520
526 Ga0097621_100614657
527 Ga0068871_100036082
528 Ga0068871_100515803
529 Ga0075428_100630325
530 Ga0075433_10031006
531 Ga0075436_100219228
532 Ga0075435_100228829
533 Ga0075435_100533637
534 Ga0105240_10064136
535 Ga0105240_10515837
536 Ga0105245_10046910
537 Ga0105245_10116711
538 Ga0105245_10128410
539 Ga0105247_10040536
540 Ga0105247_10123377
541 Ga0114129_10137361
542 Ga0114129_10356554
543 Ga0114129_10537363
544 Ga0105241_10068108
545 Ga0105241_11022486
546 Ga0105248_10115327
547 Ga0105248_10782717
548 Ga0105238_10680001
549 Ga0105238_10956467
550 Ga0105239_10893780
551 Ga0105239_11135351
552 Ga0157319_1007559
553 Ga0157314_1007603
554 Ga0157338_1021324
555 Ga0157373_10412147
556 Ga0157370_10294956
557 Ga0157369_10038014
558 Ga0157369_10479798
559 Ga0157374_10144956
560 Ga0163162_11813300
561 Ga0157372_10000044
562 Ga0157372_10413763
563 Ga0157372_10443996
564 Ga0157375_10176723
565 Ga0163163_10010795
566 Ga0163163_11228538
567 Ga0157379_10010568
568 Ga0157376_10156779
569 Ga0157376_10259581
570 Ga0157376_11082451
571 Ga0206356_10412463
572 Ga0206353_10553803
573 Ga0206353_11842147
574 Ga0209758_1003155
575 Ga0207692_10363073
576 Ga0207685_10004299
577 Ga0207685_10248581
578 Ga0207699_10010526
579 Ga0207699_10014337
580 Ga0207684_10016302
581 Ga0207684_10114717
582 Ga0207695_10227398
583 Ga0207695_10350153
584 Ga0207671_10874566
585 Ga0207693_10017098
586 Ga0207693_10046356
587 Ga0207663_10002342
588 Ga0207663_10012959
589 Ga0207663_10510193
590 Ga0207657_10168559
591 Ga0207646_10021391
592 Ga0207646_10026300
593 Ga0207646_10028605
594 Ga0207646_10052109
595 Ga0207694_11124448
596 Ga0207687_10315355
597 Ga0207700_10015813
598 Ga0207700_10019925
599 Ga0207700_10068574
600 Ga0207700_10095179
601 Ga0207700_10256426
602 Ga0207700_11233980
603 Ga0207664_10028161
604 Ga0207664_10153995
605 Ga0207664_10472452
606 Ga0207709_10294540
607 Ga0207670_10578207
608 Ga0207665_10011349
609 Ga0207665_10033298
610 Ga0207665_10229753
611 Ga0207665_10455924
612 Ga0207711_10088600
613 Ga0207711_10616195
614 Ga0207661_10123648
615 Ga0207679_10675590
616 Ga0207667_10177270
617 Ga0207702_10015816
618 Ga0207702_10385548
619 Ga0207702_10780007
620 Ga0207641_10267365
621 Ga0207674_10028498
622 Ga0207698_10236303
623 Ga0268264_10104030
624 Ga0314311_1152003
625 Ga0307514_10225436
626 Ga0307416_101974932
627 Ga0373930_0048117
628 Ga0373948_0030017
629 Ga0373950_0019404
630 Ga0373958_0033495
631 Ga0373959_0028956
632 Ga0373938_0007302
633 Ga0373926_0018173
634 Ga0373928_0046189
635 Ga0373929_0022147
636 Ga0373940_0070720
637 Ga0373944_0015206
638 Ga0373949_0019602
639 Ga0373951_0032069
640 Ga0373923_0071272
641 Ga0373923_0314190
642 Ga0373932_0061821
643 Ga0373945_0093188
644 Ga0373945_0221490
645 Ga0373953_0066813
646 Ga0373954_0155956
647 Ga0373957_0196174
648 Ga0373960_0125303
649 Ga0373960_0162725
650 Ga0373943_0009504
651 Ga0373943_0332220
652 Ga0373943_0366569
653 Ga0373946_0013166
654 Ga0373946_0185474
655 Ga0373955_0128569
656 Ga0373942_0012985
657 Ga0373961_0075933
658 Ga0373962_0200321
659 Ga0373962_0281691
660 Ga0373924_0102350
661 Ga0373931_0046019
662 Ga0373935_0117105
663 Ga0373927_0270126
664 Ga0373947_0050787
665 Ga0373947_0059557
666 Ga0373925_0001671
667 Ga0373925_0153011
668 Ga0373925_0261601
669 Ga0373925_0464410
670 Ga0373925_0816965
671 Ga0395899_0157594
672 Ga0395900_0612480
673 Ga0395898_0039291
674 Ga0395898_0160555
675 Ga0395898_1115833
676 Ga0436364_0912176
677 Ga0395901_0036623
678 Ga0395901_0151467
679 Ga0395901_0185798
680 Ga0395901_0188642
681 Ga0439436_0011303
682 Ga0439439_0011733
683 Ga0439433_0002658
684 Ga0439442_011796
685 Ga0439457_000513
686 Ga0439462_0011416
687 Ga0450907_049596
688 Ga0466969_0075255
689 Ga0466972_0112750
690 Ga0466972_0275299
691 Ga0466966_0002577
692 Ga0466961_0045691
693 Ga0466961_0054274
694 Ga0466961_0086735
695 Ga0466961_0122403
696 Ga0466964_0005422
697 Ga0466957_0002626
698 Ga0466959_0004726
699 Ga0466958_0057160
700 Ga0466958_0062056
701 Ga0466958_0130605
702 Ga0466958_0292759
703 Ga0466967_0029475
704 Ga0466967_0141662
705 Ga0495592_0000865
706 Ga0495592_0474057
707 Ga0495603_0016725
708 Ga0495603_0194059
709 Ga0495590_0210158
710 Ga0495629_0019200
711 Ga0495629_0078827
712 Ga0495629_0193459
713 Ga0495641_0012901
714 Ga0495641_0125376
715 Ga0495651_0000438
716 Ga0495651_0196586
717 Ga0495651_0691141
718 Ga0495653_0132171
719 Ga0495580_0411730
720 Ga0495580_0657262
721 Ga0495582_0210676
722 Ga0495639_0150918
723 Ga0495664_0042310
724 Ga0495664_0088415
725 Ga0495664_0535316
726 Ga0495584_0447919
727 Ga0495594_0001285
728 Ga0495594_0092266
729 Ga0495594_0128213
730 Ga0495583_0021581
731 Ga0495608_0259849
732 Ga0495608_0527481
733 Ga0495608_0707065
734 Ga0495618_0049603
735 Ga0495618_0145360
736 Ga0495620_0008341
737 Ga0495628_0023413
738 Ga0495628_0056238
739 Ga0495628_0914760
740 Ga0495630_0018285
741 Ga0495630_0581905
742 Ga0495630_0751072
743 Ga0495643_0001849
744 Ga0495648_0122294
745 Ga0495666_0024017
746 Ga0495666_0050504
747 Ga0495652_0043747
748 Ga0495652_0138788
749 Ga0495665_0044782
750 Ga0495665_0113165
751 Ga0495665_0338383
752 Ga0495640_0028780
753 Ga0495640_0068712
754 Ga0495586_0099327
755 Ga0495587_0008025
756 Ga0495645_0064800
757 Ga0495645_0077675
758 Ga0495622_0003768
759 Ga0495667_0021294
760 Ga0495667_0093694
761 Ga0495667_0205812
762 Ga0495668_0024163
763 Ga0495634_0053796
764 Ga0495634_0090258
765 Ga0495625_0065153
766 Ga0495588_0178444
767 Ga0495657_0024174
768 Ga0495657_0044556
769 Ga0495657_0364796
770 Ga0495599_0005511
771 Ga0495623_0018599
772 Ga0495646_0000786
773 Ga0495646_0241796
774 Ga0495647_0104558
775 Ga0495658_0313979
776 Ga0495613_0044681
777 Ga0495613_0094019
778 Ga0495624_0024927
779 Ga0495624_0091552
780 Ga0495624_0831624
781 Ga0495671_0417360
782 Ga0495589_0011868
783 Ga0495600_0145543
784 Ga0495600_0211331
785 Ga0495660_0123489
786 Ga0495581_0055094
787 Ga0495604_0028201
788 Ga0495636_0436247
789 Ga0495674_0071571
790 Ga0495674_0158940
791 Ga0495674_0995146
792 Ga0495672_0153302
793 Ga0495676_0001143
794 Ga0495676_0082473
795 Ga0495676_0129536
796 Ga0495676_0138144
797 Ga0495680_0011180
798 Ga0495680_0320634
799 Ga0495683_0183765
800 Ga0495675_0106467
801 Ga0495675_0535142
802 Ga0495675_0542841
803 Ga0495685_106181
804 Ga0495684_0009270
805 Ga0495684_0016016
806 Ga0495684_0055878
807 Ga0495684_0138795
808 Ga0495593_0044529
809 Ga0495602_0040148
810 Ga0495602_0883618
811 Ga0495614_0018796
812 Ga0495614_0058555
813 Ga0496100_0088379
814 Ga0496100_0091589
815 Ga0496100_0801286
816 Ga0496101_0056930
817 Ga0496102_0100922
818 Ga0496102_0329083
819 Ga0496103_0019110
820 Ga0496103_0188325
821 Ga0496104_0002144
822 Ga0496104_0381343
823 Ga0496105_0003637
824 Ga0496105_0028035
825 Ga0496105_0163697
826 Ga0496105_0533707
827 Ga0496106_0067030
828 Ga0496106_0433926
829 Ga0496106_0693998
830 Ga0496107_0063651
831 Ga0496107_0162304
832 Ga0496108_0054232
833 Ga0496108_0097425
834 Ga0496108_0359587
835 Ga0496109_0153013
836 Ga0496109_0332091
837 Ga0496109_0345917
838 Ga0496110_0008965
839 Ga0496110_0019577
840 Ga0496111_0025641
841 Ga0496111_0454127
842 Ga0496112_0037591
843 Ga0496112_0315394
844 Ga0496112_0343695
845 Ga0496113_0052902
846 Ga0496113_0121569
847 Ga0496113_0132143
848 Ga0496113_0196713
849 Ga0496114_0049326
850 Ga0496115_0183617
851 Ga0496115_0239901
852 Ga0496115_0839553
853 Ga0501036_0678888
854 Ga0501038_0373018
855 Ga0501039_0051523
856 Ga0501039_0095268
857 Ga0501040_0062024
858 Ga0501040_0916417
859 Ga0501041_0277218
860 Ga0501067_0004493
861 Ga0501067_0012907
862 Ga0501067_0125156
863 Ga0501068_0105464
864 Ga0501068_0435389
865 Ga0501069_0350166
866 Ga0501070_0351697
867 Ga0501071_0068106
868 Ga0501074_0358232
869 Ga0501076_0042124
870 Ga0501077_0650503
871 Ga0501080_0539776
872 Ga0501044_0665543
873 Ga0501045_0047593
874 nmdc:mga05p37_1400319_c1
875 nmdc:mga05p37_174982_c1
876 nmdc:mga05p37_402293_c1
877 nmdc:mga0n895_230143_c1
878 nmdc:mga08x19_395340_c1
879 nmdc:mga08x19_732200_c1
880 Ga0495601_0113349
881 Ga0495595_0059191
882 Ga0495619_0263887
883 Ga0495619_0271207
884 Ga0530510_0434078
885 2643852058
886 2644136509
887 2738697071
888 2739324239
889 2753265278
890 2760621150
891 2912762882
892 8054161560
893 8056066156
894 8056579966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

58

208

0.97

PF05163

DinB

DinB family

51

203

0.79

PF12867

DinB_2

DinB superfamily

41

199

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qnl-assembly1.cif.gz_A-2 crystal structure of a putative dna damage-inducible protein (chu_0679) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution 0.7526 19 163
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7474 18 159
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7207 18 159
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.7201 19 166
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7088 21 173
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7326 19 166 1.20.120.450
2qnlA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7304 19 163 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.669 22 173 1.20.120.450
2qnlA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6687 19 163 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6603 25 160 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7H5K9S7-F1-model_v4 deleted 0.986 1 173
AF-A0A327VIF9-F1-model_v4 Putative damage-inducible protein DinB 0.9854 1 173
AF-A0A428X0R0-F1-model_v4 Mini-circle protein 0.9849 45 173
AF-A0A1I4SBV8-F1-model_v4 DinB superfamily protein 0.9847 2 173
AF-A0A0M8SHC2-F1-model_v4 deleted 0.9843 1 153

Map