F446024

General Info

Members Datasets Scaffolds Average Seq Length
447 197 414 282

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0000641|Ga0495649_0000641_12210_13115
Length 301
Sequence MLRFIDIHPHVISDDETRYPPAPLFGKRSDWSQERPCVVETLIAAMDEAGVAQAAVVHSSTTYGFDNSYVVDSCNRYPDRLIAVGSVDVRAPDAVETIRAWTDRGLAGLRIFTGGSTKDFDPTELEDERAYPAWELLGELGLTMCIQTGPVGLPQVRSLAERFPRVPIILDHLGRPDVADGPPYAKAQSLFDLADVPSIYLKLTPRIMGDSVSGAATPDTFFPKLVEVFGANRLAWGSNFPTSPGALTEIKATAVERLASLSSDDQDWIFNKTARALYPALDAKEDNALGGVSDRIQSAGR

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
6 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
7 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
8 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
9 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
10 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
11 2738541297 Duganella sp. GV083 Isolate Unclassified
12 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
13 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
14 2738541357 Duganella sp. GV053 Isolate Unclassified
15 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
16 2738543003 Duganella sp. GV066 Isolate Unclassified
17 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
18 2738543012 Acidovorax sp. CF301 Isolate Unclassified
19 2738543026 Duganella sp. GV089 Isolate Unclassified
20 2738543029 Duganella sp. GV039 Isolate Unclassified
21 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
22 2842711865 Duganella sp. R-73148 Isolate Unclassified
23 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
24 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
25 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
26 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
66 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
77 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
93 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
152 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
183 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
184 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
185 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
188 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
189 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
193 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
196 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
197 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.06
Metatranscriptomes 0
Isolates 6.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.08
Nodule 1.34
Rhizoplane 1.79
Rhizosphere 75.62
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001009 3300001979 Bacteria 12587
2 JGI24739J22299_10000717 3300001989 Bacteria 12015
3 JGI24738J21930_10001937 3300002075 Bacteria 5577
4 JGI25160J50197_1000017 3300003354 Bacteria 246175
5 JGI25160J50197_1000031 3300003354 Bacteria 175708
6 Ga0055525_1000249 3300003759 Bacteria 53433
7 Ga0055526_1009564 3300003771 Bacteria 4641
8 Ga0055537_1000408 3300003773 Bacteria 28156
9 Ga0055537_1000501 3300003773 Bacteria 23658
10 Ga0055524_1000833 3300003775 Bacteria 20237
11 Ga0055528_1004240 3300003790 Bacteria 6947
12 Ga0055530_10000139 3300003791 Bacteria 64639
13 Ga0055540_1000013 3300003792 Bacteria 262274
14 Ga0055531_10004230 3300003794 Bacteria 8832
15 Ga0065165_1000075 3300005262 Bacteria 164281
16 Ga0065165_1000975 3300005262 Bacteria 35655
17 Ga0065165_1007054 3300005262 Bacteria 5652
18 Ga0065704_10074519 3300005289 Bacteria 6215
19 Ga0070660_100037066 3300005339 Bacteria 3696
20 Ga0070673_100210383 3300005364 Bacteria 1679
21 Ga0075370_10060836 3300006353 Bacteria 2152
22 Ga0075433_10023871 3300006852 Bacteria 5153
23 Ga0105251_10000044 3300009011 Bacteria 113730
24 Ga0105250_10060329 3300009092 Bacteria 1524
25 Ga0105240_10196444 3300009093 Bacteria 2368
26 Ga0105245_10161618 3300009098 Bacteria 2126
27 Ga0157369_10026172 3300013105 Bacteria 6473
28 Ga0209563_100013 3300025230 Bacteria 941463
29 Ga0209565_1000079 3300025263 Bacteria 159565
30 Ga0209565_1000126 3300025263 Bacteria 110355
31 Ga0209673_1002303 3300025273 Bacteria 13576
32 Ga0209673_1027859 3300025273 Bacteria 1830
33 Ga0209130_1006431 3300025284 Bacteria 3819
34 Ga0209675_1002743 3300025291 Bacteria 8807
35 Ga0209675_1011542 3300025291 Bacteria 2923
36 Ga0209025_1001497 3300025294 Bacteria 30199
37 Ga0209564_1000624 3300025295 Bacteria 53918
38 Ga0209564_1027764 3300025295 Bacteria 1829
39 Ga0209758_1000487 3300025297 Bacteria 64794
40 Ga0209758_1010729 3300025297 Bacteria 5430
41 Ga0209050_1000340 3300025298 Bacteria 92794
42 Ga0209256_1000190 3300025299 Bacteria 117775
43 Ga0209256_1006685 3300025299 Bacteria 5991
44 Ga0209256_1013292 3300025299 Bacteria 3064
45 Ga0207426_1000107 3300025302 Bacteria 242623
46 Ga0207426_1000158 3300025302 Bacteria 177323
47 Ga0209051_1000022 3300025303 Bacteria 474879
48 Ga0209257_1000030 3300025304 Bacteria 689812
49 Ga0207713_1000113 3300025735 Bacteria 132424
50 Ga0207647_10006004 3300025904 Bacteria 8848
51 Ga0307517_10059774 3300028786 Bacteria 3643
52 Ga0307515_10011366 3300028794 Bacteria 16899
53 Ga0307515_10124483 3300028794 Bacteria 2892
54 Ga0307515_10181858 3300028794 Bacteria 2049
55 Ga0307508_10000458 3300031616 Bacteria 49077
56 Ga0307412_10000066 3300031911 Bacteria 119317
57 Ga0307510_10078627 3300033180 Bacteria 3224
58 Ga0395905_0000029 3300037471 Bacteria 293016
59 Ga0466972_0001714 3300044658 Bacteria 10753
60 Ga0466966_0001188 3300044684 Bacteria 16715
61 Ga0466970_0073235 3300044765 Bacteria 1843
62 Ga0466957_0399213 3300044842 Bacteria 940
63 Ga0466958_0105902 3300045836 Bacteria 1753
64 Ga0495617_000011 3300046452 Bacteria 301936
65 Ga0495627_034522 3300046453 Bacteria 1580
66 Ga0495592_0006264 3300046454 Bacteria 8853
67 Ga0495592_0022002 3300046454 Bacteria 4851
68 Ga0495592_0056212 3300046454 Bacteria 2909
69 Ga0495603_0049109 3300046455 Bacteria 2512
70 Ga0495591_001189 3300046458 Bacteria 16992
71 Ga0495591_001345 3300046458 Bacteria 15434
72 Ga0495591_001502 3300046458 Bacteria 14387
73 Ga0495629_0001087 3300046459 Bacteria 21570
74 Ga0495629_0002700 3300046459 Bacteria 13590
75 Ga0495629_0005594 3300046459 Bacteria 9383
76 Ga0495629_0160501 3300046459 Bacteria 1562
77 Ga0495629_0168996 3300046459 Bacteria 1518
78 Ga0495638_0006622 3300046460 Bacteria 8414
79 Ga0495638_0017705 3300046460 Bacteria 4744
80 Ga0495638_0251682 3300046460 Bacteria 973
81 Ga0495651_0003170 3300046462 Bacteria 12641
82 Ga0495651_0010929 3300046462 Bacteria 6983
83 Ga0495651_0013083 3300046462 Bacteria 6412
84 Ga0495653_0003432 3300046463 Bacteria 12743
85 Ga0495653_0013234 3300046463 Bacteria 6726
86 Ga0495653_0028380 3300046463 Bacteria 4473
87 Ga0495653_0040458 3300046463 Bacteria 3642
88 Ga0495650_0000599 3300046471 Bacteria 49494
89 Ga0495650_0000951 3300046471 Bacteria 33494
90 Ga0495650_0000982 3300046471 Bacteria 32564
91 Ga0495650_0007946 3300046471 Bacteria 6284
92 Ga0495650_0024786 3300046471 Bacteria 2827
93 Ga0495580_0000450 3300046472 Bacteria 34026
94 Ga0495580_0025435 3300046472 Bacteria 4325
95 Ga0495580_0109435 3300046472 Bacteria 1918
96 Ga0495582_0027287 3300046473 Bacteria 3129
97 Ga0495582_0055710 3300046473 Bacteria 2179
98 Ga0495582_0108920 3300046473 Bacteria 1555
99 Ga0495605_0000116 3300046474 Bacteria 103357
100 Ga0495605_0002969 3300046474 Bacteria 10265
101 Ga0495605_0044619 3300046474 Bacteria 2191
102 Ga0495662_0036862 3300046476 Bacteria 2360
103 Ga0495662_0079002 3300046476 Bacteria 1599
104 Ga0495664_0107565 3300046477 Bacteria 1682
105 Ga0495664_0151236 3300046477 Bacteria 1408
106 Ga0495664_0207515 3300046477 Bacteria 1187
107 Ga0495584_0041065 3300046491 Bacteria 2336
108 Ga0495585_0009964 3300046492 Bacteria 5678
109 Ga0495585_0050087 3300046492 Bacteria 2317
110 Ga0495596_0000403 3300046500 Bacteria 27580
111 Ga0495596_0000684 3300046500 Bacteria 21087
112 Ga0495596_0000726 3300046500 Bacteria 20313
113 Ga0495596_0000764 3300046500 Bacteria 19642
114 Ga0495596_0003466 3300046500 Bacteria 7969
115 Ga0495596_0013034 3300046500 Bacteria 3541
116 Ga0495596_0013752 3300046500 Bacteria 3423
117 Ga0495596_0027559 3300046500 Bacteria 2284
118 Ga0495607_0000057 3300046501 Bacteria 110023
119 Ga0495607_0017153 3300046501 Bacteria 4658
120 Ga0495607_0021836 3300046501 Bacteria 4025
121 Ga0495607_0090664 3300046501 Bacteria 1656
122 Ga0495583_0000412 3300046506 Bacteria 64931
123 Ga0495583_0000546 3300046506 Bacteria 52832
124 Ga0495583_0006174 3300046506 Bacteria 7888
125 Ga0495583_0032999 3300046506 Bacteria 2493
126 Ga0495606_0003743 3300046507 Bacteria 15844
127 Ga0495606_0005101 3300046507 Bacteria 12762
128 Ga0495606_0005336 3300046507 Bacteria 12356
129 Ga0495606_0018417 3300046507 Bacteria 5235
130 Ga0495606_0018704 3300046507 Bacteria 5184
131 Ga0495606_0028087 3300046507 Bacteria 3974
132 Ga0495608_0002151 3300046511 Bacteria 14215
133 Ga0495608_0004424 3300046511 Bacteria 10063
134 Ga0495608_0007581 3300046511 Bacteria 7651
135 Ga0495608_0037280 3300046511 Bacteria 3269
136 Ga0495610_0000007 3300046512 Bacteria 820919
137 Ga0495610_0000246 3300046512 Bacteria 56850
138 Ga0495610_0006078 3300046512 Bacteria 8428
139 Ga0495610_0022886 3300046512 Bacteria 3406
140 Ga0495616_0004655 3300046513 Bacteria 8610
141 Ga0495616_0022742 3300046513 Bacteria 3381
142 Ga0495616_0144275 3300046513 Bacteria 1081
143 Ga0495618_0002216 3300046514 Bacteria 12676
144 Ga0495618_0002936 3300046514 Bacteria 10803
145 Ga0495618_0009613 3300046514 Bacteria 5839
146 Ga0495618_0243671 3300046514 Bacteria 1129
147 Ga0495620_0005498 3300046515 Bacteria 7064
148 Ga0495628_0017173 3300046516 Bacteria 6027
149 Ga0495628_0028800 3300046516 Bacteria 4510
150 Ga0495628_0041228 3300046516 Bacteria 3685
151 Ga0495630_0002971 3300046517 Bacteria 11770
152 Ga0495630_0013446 3300046517 Bacteria 5953
153 Ga0495632_0000038 3300046519 Bacteria 155743
154 Ga0495632_0002942 3300046519 Bacteria 12500
155 Ga0495632_0016297 3300046519 Bacteria 4139
156 Ga0495632_0045143 3300046519 Bacteria 2196
157 Ga0495637_0000061 3300046520 Bacteria 95460
158 Ga0495637_0003200 3300046520 Bacteria 8738
159 Ga0495643_0000088 3300046522 Bacteria 155458
160 Ga0495643_0000130 3300046522 Bacteria 121749
161 Ga0495643_0000347 3300046522 Bacteria 62970
162 Ga0495643_0000513 3300046522 Bacteria 48301
163 Ga0495643_0012675 3300046522 Bacteria 5077
164 Ga0495643_0040614 3300046522 Bacteria 2540
165 Ga0495643_0124017 3300046522 Bacteria 1302
166 Ga0495643_0155509 3300046522 Bacteria 1129
167 Ga0495648_0011040 3300046524 Bacteria 6843
168 Ga0495648_0014780 3300046524 Bacteria 5688
169 Ga0495648_0034678 3300046524 Bacteria 3281
170 Ga0495648_0040328 3300046524 Bacteria 2961
171 Ga0495648_0069427 3300046524 Bacteria 2050
172 Ga0495648_0179952 3300046524 Bacteria 1075
173 Ga0495663_0000013 3300046525 Bacteria 155493
174 Ga0495666_0003186 3300046526 Bacteria 8253
175 Ga0495666_0006342 3300046526 Bacteria 5953
176 Ga0495666_0034160 3300046526 Bacteria 2481
177 Ga0495642_0000337 3300046528 Bacteria 25576
178 Ga0495642_0001005 3300046528 Bacteria 13089
179 Ga0495642_0004832 3300046528 Bacteria 5206
180 Ga0495642_0055419 3300046528 Bacteria 1636
181 Ga0495652_0012531 3300046529 Bacteria 7645
182 Ga0495652_0040368 3300046529 Bacteria 4034
183 Ga0495652_0079460 3300046529 Bacteria 2711
184 Ga0495652_0161428 3300046529 Bacteria 1739
185 Ga0495654_0003312 3300046530 Bacteria 9919
186 Ga0495654_0039424 3300046530 Bacteria 2358
187 Ga0495665_0002542 3300046531 Bacteria 9837
188 Ga0495665_0005754 3300046531 Bacteria 6691
189 Ga0495665_0010181 3300046531 Bacteria 5096
190 Ga0495665_0013799 3300046531 Bacteria 4364
191 Ga0495665_0013903 3300046531 Bacteria 4347
192 Ga0495640_0001067 3300046533 Bacteria 21313
193 Ga0495640_0027826 3300046533 Bacteria 4073
194 Ga0495640_0081316 3300046533 Bacteria 2153
195 Ga0495586_0098013 3300046535 Bacteria 1625
196 Ga0495586_0158757 3300046535 Bacteria 1275
197 Ga0495587_0001662 3300046536 Bacteria 14848
198 Ga0495587_0003266 3300046536 Bacteria 10830
199 Ga0495587_0020825 3300046536 Bacteria 4045
200 Ga0495609_0016032 3300046538 Bacteria 3497
201 Ga0495609_0152506 3300046538 Bacteria 982
202 Ga0495597_0000100 3300046542 Bacteria 77861
203 Ga0495597_0000762 3300046542 Bacteria 25455
204 Ga0495622_0018459 3300046557 Bacteria 3248
205 Ga0495622_0064224 3300046557 Bacteria 1698
206 Ga0495633_0000166 3300046558 Bacteria 86835
207 Ga0495633_0000212 3300046558 Bacteria 73041
208 Ga0495633_0000694 3300046558 Bacteria 30761
209 Ga0495633_0001062 3300046558 Bacteria 22286
210 Ga0495633_0001120 3300046558 Bacteria 21505
211 Ga0495633_0004578 3300046558 Bacteria 8721
212 Ga0495633_0022974 3300046558 Bacteria 3093
213 Ga0495656_0004397 3300046615 Bacteria 4825
214 Ga0495668_0000135 3300046616 Bacteria 111827
215 Ga0495668_0004055 3300046616 Bacteria 10649
216 Ga0495634_0009477 3300046642 Bacteria 7180
217 Ga0495634_0020799 3300046642 Bacteria 4648
218 Ga0495634_0024136 3300046642 Bacteria 4269
219 Ga0495611_0029496 3300046648 Bacteria 2406
220 Ga0495611_0057958 3300046648 Bacteria 1756
221 Ga0495625_0000011 3300046660 Bacteria 377120
222 Ga0495625_0000189 3300046660 Bacteria 97637
223 Ga0495625_0000286 3300046660 Bacteria 78029
224 Ga0495625_0001087 3300046660 Bacteria 35283
225 Ga0495625_0016496 3300046660 Bacteria 5810
226 Ga0495625_0019411 3300046660 Bacteria 5273
227 Ga0495625_0302332 3300046660 Bacteria 1023
228 Ga0495635_0004083 3300046663 Bacteria 10129
229 Ga0495635_0018931 3300046663 Bacteria 4806
230 Ga0495661_0000221 3300046665 Bacteria 65361
231 Ga0495661_0007136 3300046665 Bacteria 7800
232 Ga0495661_0011755 3300046665 Bacteria 5930
233 Ga0495661_0012090 3300046665 Bacteria 5837
234 Ga0495661_0022806 3300046665 Bacteria 4069
235 Ga0495661_0067015 3300046665 Bacteria 2110
236 Ga0495661_0122764 3300046665 Bacteria 1432
237 Ga0495661_0183404 3300046665 Bacteria 1107
238 Ga0495588_0015123 3300046674 Bacteria 3708
239 Ga0495588_0133748 3300046674 Bacteria 1309
240 Ga0495588_0184116 3300046674 Bacteria 1104
241 Ga0495657_0147807 3300046675 Bacteria 1461
242 Ga0495599_0019274 3300046678 Bacteria 4254
243 Ga0495599_0057308 3300046678 Bacteria 2438
244 Ga0495623_0004964 3300046679 Bacteria 8728
245 Ga0495646_0004203 3300046680 Bacteria 9052
246 Ga0495646_0006016 3300046680 Bacteria 7692
247 Ga0495646_0025567 3300046680 Bacteria 3713
248 Ga0495646_0047016 3300046680 Bacteria 2628
249 Ga0495646_0066703 3300046680 Bacteria 2128
250 Ga0495669_0001150 3300046684 Bacteria 10977
251 Ga0495669_0002601 3300046684 Bacteria 7385
252 Ga0495669_0010188 3300046684 Bacteria 3970
253 Ga0495669_0043727 3300046684 Bacteria 1995
254 Ga0495613_0004193 3300046689 Bacteria 10787
255 Ga0495613_0005899 3300046689 Bacteria 9169
256 Ga0495613_0009055 3300046689 Bacteria 7387
257 Ga0495624_0000453 3300046690 Bacteria 32316
258 Ga0495624_0006324 3300046690 Bacteria 8417
259 Ga0495624_0006661 3300046690 Bacteria 8169
260 Ga0495670_0004224 3300046691 Bacteria 7037
261 Ga0495670_0176841 3300046691 Bacteria 1125
262 Ga0495671_0000033 3300046692 Bacteria 197509
263 Ga0495671_0000048 3300046692 Bacteria 155712
264 Ga0495671_0000173 3300046692 Bacteria 57337
265 Ga0495671_0024237 3300046692 Bacteria 3162
266 Ga0495671_0030727 3300046692 Bacteria 2749
267 Ga0495671_0054358 3300046692 Bacteria 1985
268 Ga0495671_0057878 3300046692 Bacteria 1918
269 Ga0495649_0000205 3300046694 Bacteria 52102
270 Ga0495649_0000270 3300046694 Bacteria 46170
271 Ga0495649_0000641 3300046694 Bacteria 28449
272 Ga0495649_0003939 3300046694 Bacteria 9809
273 Ga0495649_0030307 3300046694 Bacteria 2988
274 Ga0495649_0123903 3300046694 Bacteria 1365
275 Ga0495649_0195082 3300046694 Bacteria 1053
276 Ga0495589_0000022 3300046794 Bacteria 196021
277 Ga0495589_0001337 3300046794 Bacteria 14446
278 Ga0495589_0002556 3300046794 Bacteria 10118
279 Ga0495589_0002731 3300046794 Bacteria 9765
280 Ga0495589_0010558 3300046794 Bacteria 4802
281 Ga0495589_0016169 3300046794 Bacteria 3834
282 Ga0495600_0001878 3300046809 Bacteria 11789
283 Ga0495600_0003055 3300046809 Bacteria 9774
284 Ga0495600_0016457 3300046809 Bacteria 4693
285 Ga0495660_0000044 3300046810 Bacteria 150926
286 Ga0495660_0007391 3300046810 Bacteria 6451
287 Ga0495660_0063542 3300046810 Bacteria 1976
288 Ga0495660_0114885 3300046810 Bacteria 1369
289 Ga0495604_0001575 3300047317 Bacteria 18785
290 Ga0495604_0002234 3300047317 Bacteria 15512
291 Ga0495604_0003412 3300047317 Bacteria 12666
292 Ga0495604_0072077 3300047317 Bacteria 2611
293 Ga0495674_0000823 3300047319 Bacteria 29619
294 Ga0495674_0050443 3300047319 Bacteria 3671
295 Ga0495674_0066431 3300047319 Bacteria 3128
296 Ga0495674_0118478 3300047319 Bacteria 2238
297 Ga0495674_0218675 3300047319 Bacteria 1575
298 Ga0495672_0000469 3300047320 Bacteria 47756
299 Ga0495672_0004016 3300047320 Bacteria 12305
300 Ga0495672_0005224 3300047320 Bacteria 10340
301 Ga0495672_0179548 3300047320 Bacteria 1073
302 Ga0495676_0042249 3300047321 Bacteria 3744
303 Ga0495680_0002905 3300047322 Bacteria 17212
304 Ga0495680_0034434 3300047322 Bacteria 4089
305 Ga0495680_0042715 3300047322 Bacteria 3594
306 Ga0495680_0104218 3300047322 Bacteria 2110
307 Ga0495683_0000966 3300047323 Bacteria 20103
308 Ga0495683_0002124 3300047323 Bacteria 12234
309 Ga0495683_0002193 3300047323 Bacteria 11979
310 Ga0495683_0002693 3300047323 Bacteria 10605
311 Ga0495683_0009759 3300047323 Bacteria 5102
312 Ga0495683_0039521 3300047323 Bacteria 2384
313 Ga0495683_0058810 3300047323 Bacteria 1908
314 Ga0495683_0059018 3300047323 Bacteria 1904
315 Ga0495683_0105135 3300047323 Bacteria 1353
316 Ga0495687_000044 3300047443 Bacteria 215400
317 Ga0495687_000099 3300047443 Bacteria 132139
318 Ga0495687_014699 3300047443 Bacteria 4014
319 Ga0495675_0001360 3300047444 Bacteria 14807
320 Ga0495675_0001567 3300047444 Bacteria 13815
321 Ga0495675_0002387 3300047444 Bacteria 11227
322 Ga0495677_0000256 3300047445 Bacteria 23351
323 Ga0495677_0004940 3300047445 Bacteria 5084
324 Ga0495677_0006276 3300047445 Bacteria 4491
325 Ga0495677_0018233 3300047445 Bacteria 2544
326 Ga0495677_0031780 3300047445 Bacteria 1921
327 Ga0495677_0034297 3300047445 Bacteria 1851
328 Ga0495677_0066524 3300047445 Bacteria 1340
329 Ga0495679_000023 3300047446 Bacteria 209366
330 Ga0495679_001620 3300047446 Bacteria 12548
331 Ga0495679_010101 3300047446 Bacteria 3729
332 Ga0495679_010181 3300047446 Bacteria 3710
333 Ga0495679_016815 3300047446 Bacteria 2635
334 Ga0495679_023187 3300047446 Bacteria 2109
335 Ga0495673_0000166 3300047469 Bacteria 112730
336 Ga0495673_0000359 3300047469 Bacteria 55990
337 Ga0495673_0004136 3300047469 Bacteria 9181
338 Ga0495681_0000451 3300047470 Bacteria 31452
339 Ga0495684_0071219 3300047471 Bacteria 2642
340 Ga0495686_0020061 3300047472 Bacteria 4459
341 Ga0495686_0038132 3300047472 Bacteria 3075
342 Ga0495686_0044489 3300047472 Bacteria 2811
343 Ga0495593_0000697 3300047673 Bacteria 19383
344 Ga0495593_0000717 3300047673 Bacteria 19212
345 Ga0495593_0001630 3300047673 Bacteria 13294
346 Ga0495593_0003728 3300047673 Bacteria 9095
347 Ga0495593_0025887 3300047673 Bacteria 3246
348 Ga0495593_0041545 3300047673 Bacteria 2472
349 Ga0495602_0005749 3300048088 Bacteria 13014
350 Ga0495602_0046936 3300048088 Bacteria 3896
351 Ga0495602_0118708 3300048088 Bacteria 2132
352 Ga0495602_0160306 3300048088 Bacteria 1757
353 Ga0495614_0000847 3300048089 Bacteria 12943
354 Ga0495614_0014568 3300048089 Bacteria 3439
355 Ga0495614_0083930 3300048089 Bacteria 1382
356 Ga0495615_0000019 3300048090 Bacteria 54462
357 Ga0495626_0000021 3300048091 Bacteria 217213
358 Ga0495626_0000412 3300048091 Bacteria 43929
359 Ga0495626_0008005 3300048091 Bacteria 5839
360 Ga0495626_0009572 3300048091 Bacteria 5232
361 Ga0495626_0047637 3300048091 Bacteria 1991
362 Ga0495626_0062209 3300048091 Bacteria 1695
363 Ga0496102_0004894 3300048905 Bacteria 11341
364 Ga0496102_0008511 3300048905 Bacteria 8797
365 Ga0496102_0273330 3300048905 Bacteria 1593
366 Ga0496103_0003875 3300048906 Bacteria 9103
367 Ga0496103_0008057 3300048906 Bacteria 6257
368 Ga0496104_0203968 3300048907 Bacteria 1889
369 Ga0496114_0207379 3300048917 Bacteria 1718
370 Ga0496116_0000719 3300048919 Bacteria 42440
371 Ga0496116_0077510 3300048919 Bacteria 2076
372 Ga0496117_0002742 3300048920 Bacteria 21606
373 Ga0496117_0003493 3300048920 Bacteria 18230
374 Ga0496117_0021582 3300048920 Bacteria 5202
375 Ga0496118_0000583 3300048921 Bacteria 60281
376 Ga0496118_0001400 3300048921 Bacteria 36364
377 Ga0496118_0037058 3300048921 Bacteria 3931
378 Ga0496120_0017842 3300048923 Bacteria 4587
379 Ga0496121_0013695 3300048924 Bacteria 8694
380 Ga0496122_0001256 3300048925 Bacteria 42520
381 Ga0496122_0018853 3300048925 Bacteria 6342
382 Ga0496122_0038993 3300048925 Bacteria 3795
383 Ga0496123_0001025 3300048926 Bacteria 42520
384 Ga0496123_0003887 3300048926 Bacteria 16249
385 Ga0496125_0005812 3300048928 Bacteria 13549
386 Ga0496126_0007815 3300048929 Bacteria 11658
387 Ga0496126_0013663 3300048929 Bacteria 8243
388 Ga0496126_0118298 3300048929 Bacteria 2301
389 Ga0495678_000087 3300049459 Bacteria 115641
390 Ga0495678_056139 3300049459 Bacteria 1499
391 Ga0495682_0013214 3300049460 Bacteria 3147
392 Ga0501037_0047169 3300049573 Bacteria 3158
393 Ga0501035_0038907 3300049822 Bacteria 4306
394 Ga0501044_0002760 3300049823 Bacteria 19993
395 nmdc:mga0k408_88078_c1 3300050493 Bacteria 1823
396 nmdc:mga07m45_16217_c1 3300050496 Bacteria 3988
397 nmdc:mga0qj67_234985_c1 3300050509 Bacteria 1487
398 Ga0500644_0000483 3300053088 Bacteria 17533
399 Ga0500583_0289885 3300053092 Unclassified 802
400 Ga0500651_0298950 3300053093 Bacteria 924
401 Ga0500593_005684 3300053117 Bacteria 4937
402 Ga0500595_000855 3300053119 Bacteria 17388
403 Ga0500595_002870 3300053119 Bacteria 8265
404 Ga0500618_000108 3300053125 Bacteria 67640
405 Ga0500618_000164 3300053125 Bacteria 55503
406 Ga0500618_010535 3300053125 Bacteria 2478
407 Ga0500652_030509 3300053131 Bacteria 2109
408 Ga0500586_000689 3300053145 Bacteria 6910
409 Ga0500586_011405 3300053145 Bacteria 2544
410 Ga0500616_0000371 3300053153 Bacteria 63051
411 Ga0500622_0103898 3300053156 Bacteria 1395
412 Ga0500636_0000430 3300053177 Bacteria 23119
413 Ga0500611_008395 3300053727 Bacteria 1595
414 Ga0466962_0040730 3300061719 Bacteria 2223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053092 Ga0500583_0289885 Ga0500583_0289885_14_739 232
2 3300006852 Ga0075433_10023871 Ga0075433_100238715 246
3 3300046535 Ga0495586_0158757 Ga0495586_0158757_11_790 259
4 3300046692 Ga0495671_0054358 Ga0495671_0054358_1187_1969 259
5 3300053131 Ga0500652_030509 Ga0500652_030509_1279_2097 271
6 iso_pu_bacteria 2508501125 2509128603 277
7 iso_pu_bacteria 2513237151 2513958171 277
8 iso_pu_bacteria 2515154189 2516018133 277
9 iso_pu_bacteria 2738543012 2739246647 277
10 iso_pu_bacteria 2751185846 2753569347 277
11 iso_pu_bacteria 2857357740 2857357877 277
12 iso_pu_bacteria 2883087390 2883090464 277
13 iso_pu_bacteria 2921643360 2921643484 277
14 iso_pu_bacteria 2582581293 2585199349 278
15 iso_pu_bacteria 2738541297 2738827830 278
16 iso_pu_bacteria 2738541357 2739151626 278
17 iso_pu_bacteria 2738543003 2739193546 278
18 iso_pu_bacteria 2738543026 2739320022 278
19 iso_pu_bacteria 2738543029 2739338263 278
20 iso_pu_bacteria 2842711865 2842712946 278
21 iso_pu_bacteria 8039098773 8039100510 278
22 3300053119 Ga0500595_002870 Ga0500595_002870_714_1556 279
23 iso_pu_bacteria 2501025502 2501084272 279
24 iso_pu_bacteria 2510065045 2510247845 279
25 iso_pu_bacteria 2510917013 2511088644 279
26 iso_pu_bacteria 2513237151 2513958164 279
27 iso_pu_bacteria 2718217991 2719643722 279
28 iso_pu_bacteria 2738541296 2738821176 279
29 iso_pu_bacteria 2738541298 2738833659 279
30 iso_pu_bacteria 2738541306 2738877065 279
31 iso_pu_bacteria 2738543002 2739186815 279
32 iso_pu_bacteria 2738543008 2739223659 279
33 iso_pu_bacteria 2945934425 2945939471 279
34 iso_pu_bacteria 641736151 642424735 279
35 iso_pu_bacteria 8047673197 8047678391 279
36 iso_pu_bacteria 8047673197 8047678432 279
37 3300003354 JGI25160J50197_1000031 JGI25160J50197_100003135 281
38 3300003759 Ga0055525_1000249 Ga0055525_100024912 281
39 3300003791 Ga0055530_10000139 Ga0055530_1000013945 281
40 3300003792 Ga0055540_1000013 Ga0055540_100001345 281
41 3300005262 Ga0065165_1000075 Ga0065165_100007536 281
42 3300005289 Ga0065704_10074519 Ga0065704_100745192 281
43 3300006353 Ga0075370_10060836 Ga0075370_100608362 281
44 3300009011 Ga0105251_10000044 Ga0105251_1000004464 281
45 3300009092 Ga0105250_10060329 Ga0105250_100603292 281
46 3300025230 Ga0209563_100013 Ga0209563_100013830 281
47 3300025298 Ga0209050_1000340 Ga0209050_100034038 281
48 3300025302 Ga0207426_1000158 Ga0207426_1000158118 281
49 3300025303 Ga0209051_1000022 Ga0209051_1000022222 281
50 3300025304 Ga0209257_1000030 Ga0209257_1000030420 281
51 3300025735 Ga0207713_1000113 Ga0207713_100011344 281
52 3300037471 Ga0395905_0000029 Ga0395905_0000029_250179_251024 281
53 3300046454 Ga0495592_0006264 Ga0495592_0006264_4667_5512 281
54 3300046458 Ga0495591_001345 Ga0495591_001345_3564_4409 281
55 3300046459 Ga0495629_0001087 Ga0495629_0001087_5674_6519 281
56 3300046459 Ga0495629_0005594 Ga0495629_0005594_8180_9028 281
57 3300046459 Ga0495629_0160501 Ga0495629_0160501_305_1150 281
58 3300046462 Ga0495651_0003170 Ga0495651_0003170_8990_9835 281
59 3300046462 Ga0495651_0010929 Ga0495651_0010929_6028_6876 281
60 3300046463 Ga0495653_0003432 Ga0495653_0003432_6111_6959 281
61 3300046463 Ga0495653_0013234 Ga0495653_0013234_291_1136 281
62 3300046463 Ga0495653_0028380 Ga0495653_0028380_217_1062 281
63 3300046471 Ga0495650_0024786 Ga0495650_0024786_218_1063 281
64 3300046472 Ga0495580_0000450 Ga0495580_0000450_28510_29355 281
65 3300046472 Ga0495580_0109435 Ga0495580_0109435_787_1635 281
66 3300046473 Ga0495582_0027287 Ga0495582_0027287_1453_2301 281
67 3300046473 Ga0495582_0108920 Ga0495582_0108920_433_1278 281
68 3300046476 Ga0495662_0036862 Ga0495662_0036862_465_1313 281
69 3300046476 Ga0495662_0079002 Ga0495662_0079002_505_1350 281
70 3300046477 Ga0495664_0151236 Ga0495664_0151236_352_1197 281
71 3300046491 Ga0495584_0041065 Ga0495584_0041065_843_1694 281
72 3300046500 Ga0495596_0000684 Ga0495596_0000684_4840_5685 281
73 3300046500 Ga0495596_0003466 Ga0495596_0003466_2260_3108 281
74 3300046506 Ga0495583_0000546 Ga0495583_0000546_22168_23013 281
75 3300046507 Ga0495606_0005101 Ga0495606_0005101_11879_12724 281
76 3300046507 Ga0495606_0005336 Ga0495606_0005336_7056_7901 281
77 3300046507 Ga0495606_0018704 Ga0495606_0018704_2296_3141 281
78 3300046511 Ga0495608_0004424 Ga0495608_0004424_6176_7021 281
79 3300046511 Ga0495608_0037280 Ga0495608_0037280_1390_2238 281
80 3300046514 Ga0495618_0002216 Ga0495618_0002216_9130_9975 281
81 3300046514 Ga0495618_0243671 Ga0495618_0243671_14_862 281
82 3300046516 Ga0495628_0028800 Ga0495628_0028800_35_880 281
83 3300046516 Ga0495628_0041228 Ga0495628_0041228_888_1736 281
84 3300046517 Ga0495630_0002971 Ga0495630_0002971_4867_5712 281
85 3300046517 Ga0495630_0013446 Ga0495630_0013446_2694_3542 281
86 3300046519 Ga0495632_0000038 Ga0495632_0000038_97323_98171 281
87 3300046520 Ga0495637_0000061 Ga0495637_0000061_25427_26275 281
88 3300046522 Ga0495643_0000088 Ga0495643_0000088_57133_57981 281
89 3300046522 Ga0495643_0000130 Ga0495643_0000130_93970_94815 281
90 3300046524 Ga0495648_0011040 Ga0495648_0011040_1366_2214 281
91 3300046524 Ga0495648_0069427 Ga0495648_0069427_33_881 281
92 3300046525 Ga0495663_0000013 Ga0495663_0000013_57466_58314 281
93 3300046526 Ga0495666_0003186 Ga0495666_0003186_4787_5632 281
94 3300046526 Ga0495666_0006342 Ga0495666_0006342_2801_3649 281
95 3300046529 Ga0495652_0012531 Ga0495652_0012531_4057_4902 281
96 3300046529 Ga0495652_0079460 Ga0495652_0079460_1170_2018 281
97 3300046530 Ga0495654_0039424 Ga0495654_0039424_674_1525 281
98 3300046531 Ga0495665_0002542 Ga0495665_0002542_1082_1930 281
99 3300046531 Ga0495665_0010181 Ga0495665_0010181_801_1646 281
100 3300046531 Ga0495665_0013799 Ga0495665_0013799_666_1511 281
101 3300046533 Ga0495640_0001067 Ga0495640_0001067_1500_2345 281
102 3300046533 Ga0495640_0081316 Ga0495640_0081316_119_967 281
103 3300046536 Ga0495587_0003266 Ga0495587_0003266_9824_10669 281
104 3300046536 Ga0495587_0020825 Ga0495587_0020825_2143_2991 281
105 3300046542 Ga0495597_0000100 Ga0495597_0000100_9931_10776 281
106 3300046557 Ga0495622_0064224 Ga0495622_0064224_351_1196 281
107 3300046558 Ga0495633_0000166 Ga0495633_0000166_26177_27025 281
108 3300046558 Ga0495633_0000212 Ga0495633_0000212_57593_58441 281
109 3300046642 Ga0495634_0009477 Ga0495634_0009477_3304_4149 281
110 3300046642 Ga0495634_0020799 Ga0495634_0020799_1767_2615 281
111 3300046663 Ga0495635_0018931 Ga0495635_0018931_162_1007 281
112 3300046665 Ga0495661_0007136 Ga0495661_0007136_1882_2727 281
113 3300046665 Ga0495661_0183404 Ga0495661_0183404_161_1009 281
114 3300046675 Ga0495657_0147807 Ga0495657_0147807_577_1425 281
115 3300046678 Ga0495599_0019274 Ga0495599_0019274_1828_2673 281
116 3300046678 Ga0495599_0057308 Ga0495599_0057308_222_1070 281
117 3300046679 Ga0495623_0004964 Ga0495623_0004964_6590_7438 281
118 3300046680 Ga0495646_0006016 Ga0495646_0006016_2769_3614 281
119 3300046680 Ga0495646_0047016 Ga0495646_0047016_611_1459 281
120 3300046684 Ga0495669_0010188 Ga0495669_0010188_1141_1986 281
121 3300046689 Ga0495613_0004193 Ga0495613_0004193_5660_6505 281
122 3300046689 Ga0495613_0005899 Ga0495613_0005899_5627_6475 281
123 3300046690 Ga0495624_0006324 Ga0495624_0006324_7383_8231 281
124 3300046690 Ga0495624_0006661 Ga0495624_0006661_4668_5513 281
125 3300046692 Ga0495671_0000048 Ga0495671_0000048_57260_58108 281
126 3300046692 Ga0495671_0000173 Ga0495671_0000173_29655_30500 281
127 3300046692 Ga0495671_0024237 Ga0495671_0024237_228_1073 281
128 3300046694 Ga0495649_0000270 Ga0495649_0000270_29803_30648 281
129 3300046794 Ga0495589_0001337 Ga0495589_0001337_7956_8801 281
130 3300046794 Ga0495589_0002731 Ga0495589_0002731_2325_3173 281
131 3300046794 Ga0495589_0016169 Ga0495589_0016169_494_1339 281
132 3300046809 Ga0495600_0016457 Ga0495600_0016457_3625_4470 281
133 3300046810 Ga0495660_0114885 Ga0495660_0114885_126_971 281
134 3300047317 Ga0495604_0002234 Ga0495604_0002234_5729_6574 281
135 3300047317 Ga0495604_0072077 Ga0495604_0072077_694_1542 281
136 3300047319 Ga0495674_0050443 Ga0495674_0050443_353_1198 281
137 3300047319 Ga0495674_0066431 Ga0495674_0066431_694_1542 281
138 3300047319 Ga0495674_0218675 Ga0495674_0218675_197_1042 281
139 3300047321 Ga0495676_0042249 Ga0495676_0042249_1850_2698 281
140 3300047322 Ga0495680_0034434 Ga0495680_0034434_2548_3396 281
141 3300047322 Ga0495680_0042715 Ga0495680_0042715_1352_2197 281
142 3300047323 Ga0495683_0002124 Ga0495683_0002124_5550_6395 281
143 3300047323 Ga0495683_0002693 Ga0495683_0002693_389_1237 281
144 3300047323 Ga0495683_0039521 Ga0495683_0039521_1444_2289 281
145 3300047323 Ga0495683_0058810 Ga0495683_0058810_854_1699 281
146 3300047444 Ga0495675_0001360 Ga0495675_0001360_4015_4860 281
147 3300047446 Ga0495679_001620 Ga0495679_001620_4204_5052 281
148 3300047446 Ga0495679_010101 Ga0495679_010101_1882_2727 281
149 3300047469 Ga0495673_0000359 Ga0495673_0000359_29487_30332 281
150 3300047469 Ga0495673_0004136 Ga0495673_0004136_4893_5738 281
151 3300047470 Ga0495681_0000451 Ga0495681_0000451_26057_26905 281
152 3300047471 Ga0495684_0071219 Ga0495684_0071219_1317_2162 281
153 3300047472 Ga0495686_0044489 Ga0495686_0044489_981_1829 281
154 3300047673 Ga0495593_0000697 Ga0495593_0000697_7532_8377 281
155 3300047673 Ga0495593_0003728 Ga0495593_0003728_7216_8064 281
156 3300047673 Ga0495593_0025887 Ga0495593_0025887_154_999 281
157 3300047673 Ga0495593_0041545 Ga0495593_0041545_1343_2188 281
158 3300048088 Ga0495602_0046936 Ga0495602_0046936_1170_2015 281
159 3300048088 Ga0495602_0160306 Ga0495602_0160306_241_1086 281
160 3300048089 Ga0495614_0014568 Ga0495614_0014568_1369_2217 281
161 3300048089 Ga0495614_0083930 Ga0495614_0083930_286_1131 281
162 3300048905 Ga0496102_0004894 Ga0496102_0004894_8401_9246 281
163 3300048905 Ga0496102_0008511 Ga0496102_0008511_2969_3817 281
164 3300048905 Ga0496102_0273330 Ga0496102_0273330_510_1355 281
165 3300048906 Ga0496103_0003875 Ga0496103_0003875_7821_8669 281
166 3300048906 Ga0496103_0008057 Ga0496103_0008057_4297_5142 281
167 3300048907 Ga0496104_0203968 Ga0496104_0203968_629_1474 281
168 3300048917 Ga0496114_0207379 Ga0496114_0207379_486_1331 281
169 3300048920 Ga0496117_0002742 Ga0496117_0002742_13321_14169 281
170 3300048920 Ga0496117_0003493 Ga0496117_0003493_8653_9498 281
171 3300048921 Ga0496118_0000583 Ga0496118_0000583_37245_38090 281
172 3300048921 Ga0496118_0001400 Ga0496118_0001400_13141_13989 281
173 3300048929 Ga0496126_0007815 Ga0496126_0007815_1678_2523 281
174 3300049573 Ga0501037_0047169 Ga0501037_0047169_1067_1912 281
175 3300050493 nmdc:mga0k408_88078_c1 nmdc:mga0k408_88078_c1_278_1123 281
176 3300050496 nmdc:mga07m45_16217_c1 nmdc:mga07m45_16217_c1_2204_3049 281
177 3300053117 Ga0500593_005684 Ga0500593_005684_3542_4387 281
178 3300053125 Ga0500618_000108 Ga0500618_000108_11392_12237 281
179 3300003354 JGI25160J50197_1000017 JGI25160J50197_100001788 282
180 3300005262 Ga0065165_1000975 Ga0065165_100097513 282
181 3300025284 Ga0209130_1006431 Ga0209130_10064312 282
182 3300025299 Ga0209256_1006685 Ga0209256_10066856 282
183 3300025302 Ga0207426_1000107 Ga0207426_100010789 282
184 3300028786 Ga0307517_10059774 Ga0307517_100597742 282
185 3300028794 Ga0307515_10011366 Ga0307515_1001136610 282
186 3300031616 Ga0307508_10000458 Ga0307508_1000045834 282
187 3300033180 Ga0307510_10078627 Ga0307510_100786273 282
188 3300044658 Ga0466972_0001714 Ga0466972_0001714_7695_8543 282
189 3300044765 Ga0466970_0073235 Ga0466970_0073235_111_959 282
190 3300044842 Ga0466957_0399213 Ga0466957_0399213_79_927 282
191 3300045836 Ga0466958_0105902 Ga0466958_0105902_647_1495 282
192 3300046452 Ga0495617_000011 Ga0495617_000011_174819_175667 282
193 3300046453 Ga0495627_034522 Ga0495627_034522_528_1376 282
194 3300046454 Ga0495592_0056212 Ga0495592_0056212_1735_2583 282
195 3300046458 Ga0495591_001502 Ga0495591_001502_3446_4294 282
196 3300046459 Ga0495629_0002700 Ga0495629_0002700_8965_9813 282
197 3300046459 Ga0495629_0168996 Ga0495629_0168996_298_1149 282
198 3300046460 Ga0495638_0006622 Ga0495638_0006622_1372_2220 282
199 3300046460 Ga0495638_0017705 Ga0495638_0017705_1975_2823 282
200 3300046462 Ga0495651_0013083 Ga0495651_0013083_4431_5279 282
201 3300046463 Ga0495653_0040458 Ga0495653_0040458_1797_2645 282
202 3300046471 Ga0495650_0000599 Ga0495650_0000599_24345_25193 282
203 3300046471 Ga0495650_0000951 Ga0495650_0000951_22998_23849 282
204 3300046471 Ga0495650_0000982 Ga0495650_0000982_22551_23399 282
205 3300046471 Ga0495650_0007946 Ga0495650_0007946_1556_2404 282
206 3300046472 Ga0495580_0025435 Ga0495580_0025435_3364_4212 282
207 3300046473 Ga0495582_0055710 Ga0495582_0055710_77_925 282
208 3300046474 Ga0495605_0002969 Ga0495605_0002969_8657_9505 282
209 3300046477 Ga0495664_0107565 Ga0495664_0107565_613_1461 282
210 3300046477 Ga0495664_0207515 Ga0495664_0207515_265_1113 282
211 3300046492 Ga0495585_0009964 Ga0495585_0009964_1900_2748 282
212 3300046500 Ga0495596_0000403 Ga0495596_0000403_21577_22425 282
213 3300046500 Ga0495596_0027559 Ga0495596_0027559_131_979 282
214 3300046501 Ga0495607_0017153 Ga0495607_0017153_1874_2722 282
215 3300046506 Ga0495583_0000412 Ga0495583_0000412_54405_55256 282
216 3300046506 Ga0495583_0006174 Ga0495583_0006174_1346_2197 282
217 3300046506 Ga0495583_0032999 Ga0495583_0032999_790_1638 282
218 3300046507 Ga0495606_0003743 Ga0495606_0003743_4350_5198 282
219 3300046507 Ga0495606_0028087 Ga0495606_0028087_703_1551 282
220 3300046511 Ga0495608_0002151 Ga0495608_0002151_9060_9908 282
221 3300046512 Ga0495610_0000007 Ga0495610_0000007_691531_692379 282
222 3300046512 Ga0495610_0006078 Ga0495610_0006078_1264_2112 282
223 3300046512 Ga0495610_0022886 Ga0495610_0022886_1228_2076 282
224 3300046514 Ga0495618_0002936 Ga0495618_0002936_1925_2773 282
225 3300046515 Ga0495620_0005498 Ga0495620_0005498_3907_4755 282
226 3300046516 Ga0495628_0017173 Ga0495628_0017173_3405_4253 282
227 3300046522 Ga0495643_0000513 Ga0495643_0000513_30156_31004 282
228 3300046524 Ga0495648_0034678 Ga0495648_0034678_1398_2246 282
229 3300046524 Ga0495648_0040328 Ga0495648_0040328_1925_2773 282
230 3300046524 Ga0495648_0179952 Ga0495648_0179952_114_962 282
231 3300046526 Ga0495666_0034160 Ga0495666_0034160_1583_2431 282
232 3300046529 Ga0495652_0040368 Ga0495652_0040368_1247_2095 282
233 3300046530 Ga0495654_0003312 Ga0495654_0003312_5842_6690 282
234 3300046531 Ga0495665_0005754 Ga0495665_0005754_251_1099 282
235 3300046531 Ga0495665_0013903 Ga0495665_0013903_2932_3780 282
236 3300046533 Ga0495640_0027826 Ga0495640_0027826_1270_2118 282
237 3300046535 Ga0495586_0098013 Ga0495586_0098013_147_995 282
238 3300046536 Ga0495587_0001662 Ga0495587_0001662_13180_14028 282
239 3300046538 Ga0495609_0016032 Ga0495609_0016032_1145_1993 282
240 3300046538 Ga0495609_0152506 Ga0495609_0152506_115_963 282
241 3300046542 Ga0495597_0000762 Ga0495597_0000762_15627_16475 282
242 3300046557 Ga0495622_0018459 Ga0495622_0018459_818_1669 282
243 3300046558 Ga0495633_0000694 Ga0495633_0000694_11157_12014 282
244 3300046558 Ga0495633_0001120 Ga0495633_0001120_15064_15912 282
245 3300046558 Ga0495633_0022974 Ga0495633_0022974_866_1714 282
246 3300046616 Ga0495668_0000135 Ga0495668_0000135_88375_89223 282
247 3300046616 Ga0495668_0004055 Ga0495668_0004055_3431_4279 282
248 3300046642 Ga0495634_0024136 Ga0495634_0024136_3105_3953 282
249 3300046648 Ga0495611_0029496 Ga0495611_0029496_1267_2115 282
250 3300046648 Ga0495611_0057958 Ga0495611_0057958_570_1421 282
251 3300046660 Ga0495625_0000189 Ga0495625_0000189_86155_87006 282
252 3300046660 Ga0495625_0001087 Ga0495625_0001087_9999_10847 282
253 3300046660 Ga0495625_0016496 Ga0495625_0016496_3374_4222 282
254 3300046660 Ga0495625_0019411 Ga0495625_0019411_2867_3715 282
255 3300046660 Ga0495625_0302332 Ga0495625_0302332_74_925 282
256 3300046663 Ga0495635_0004083 Ga0495635_0004083_5088_5936 282
257 3300046665 Ga0495661_0022806 Ga0495661_0022806_1925_2773 282
258 3300046680 Ga0495646_0004203 Ga0495646_0004203_1797_2645 282
259 3300046680 Ga0495646_0066703 Ga0495646_0066703_721_1569 282
260 3300046689 Ga0495613_0009055 Ga0495613_0009055_2333_3181 282
261 3300046690 Ga0495624_0000453 Ga0495624_0000453_21158_22006 282
262 3300046692 Ga0495671_0000033 Ga0495671_0000033_26993_27841 282
263 3300046692 Ga0495671_0030727 Ga0495671_0030727_1562_2410 282
264 3300046692 Ga0495671_0057878 Ga0495671_0057878_37_885 282
265 3300046694 Ga0495649_0000641 Ga0495649_0000641_12210_13115 282
266 3300046694 Ga0495649_0003939 Ga0495649_0003939_6671_7519 282
267 3300046794 Ga0495589_0002556 Ga0495589_0002556_5365_6213 282
268 3300046809 Ga0495600_0001878 Ga0495600_0001878_5935_6786 282
269 3300046809 Ga0495600_0003055 Ga0495600_0003055_3831_4679 282
270 3300046810 Ga0495660_0007391 Ga0495660_0007391_453_1301 282
271 3300047317 Ga0495604_0003412 Ga0495604_0003412_7674_8522 282
272 3300047319 Ga0495674_0000823 Ga0495674_0000823_18461_19309 282
273 3300047320 Ga0495672_0000469 Ga0495672_0000469_30155_31003 282
274 3300047320 Ga0495672_0005224 Ga0495672_0005224_7850_8698 282
275 3300047320 Ga0495672_0179548 Ga0495672_0179548_81_929 282
276 3300047322 Ga0495680_0002905 Ga0495680_0002905_7356_8204 282
277 3300047323 Ga0495683_0000966 Ga0495683_0000966_13033_13881 282
278 3300047323 Ga0495683_0002193 Ga0495683_0002193_7354_8202 282
279 3300047323 Ga0495683_0105135 Ga0495683_0105135_186_1034 282
280 3300047443 Ga0495687_000044 Ga0495687_000044_134711_135562 282
281 3300047444 Ga0495675_0002387 Ga0495675_0002387_2296_3144 282
282 3300047446 Ga0495679_000023 Ga0495679_000023_31333_32181 282
283 3300047446 Ga0495679_010181 Ga0495679_010181_1856_2704 282
284 3300047446 Ga0495679_016815 Ga0495679_016815_431_1279 282
285 3300047469 Ga0495673_0000166 Ga0495673_0000166_90098_90946 282
286 3300047472 Ga0495686_0038132 Ga0495686_0038132_1052_1900 282
287 3300047673 Ga0495593_0000717 Ga0495593_0000717_5441_6289 282
288 3300047673 Ga0495593_0001630 Ga0495593_0001630_8709_9557 282
289 3300048088 Ga0495602_0005749 Ga0495602_0005749_5452_6300 282
290 3300048089 Ga0495614_0000847 Ga0495614_0000847_8911_9759 282
291 3300048091 Ga0495626_0008005 Ga0495626_0008005_1156_2004 282
292 3300048919 Ga0496116_0077510 Ga0496116_0077510_282_1130 282
293 3300048921 Ga0496118_0037058 Ga0496118_0037058_2248_3096 282
294 3300048923 Ga0496120_0017842 Ga0496120_0017842_3515_4363 282
295 3300048924 Ga0496121_0013695 Ga0496121_0013695_6529_7377 282
296 3300048925 Ga0496122_0018853 Ga0496122_0018853_50_898 282
297 3300048925 Ga0496122_0038993 Ga0496122_0038993_810_1658 282
298 3300048926 Ga0496123_0003887 Ga0496123_0003887_9020_9868 282
299 3300048929 Ga0496126_0013663 Ga0496126_0013663_6478_7326 282
300 3300048929 Ga0496126_0118298 Ga0496126_0118298_1377_2225 282
301 3300049459 Ga0495678_000087 Ga0495678_000087_30129_30977 282
302 3300049459 Ga0495678_056139 Ga0495678_056139_630_1478 282
303 3300049460 Ga0495682_0013214 Ga0495682_0013214_76_924 282
304 3300053119 Ga0500595_000855 Ga0500595_000855_7047_7898 282
305 3300053145 Ga0500586_000689 Ga0500586_000689_1749_2597 282
306 3300053145 Ga0500586_011405 Ga0500586_011405_861_1718 282
307 3300053177 Ga0500636_0000430 Ga0500636_0000430_9679_10530 282
308 3300061719 Ga0466962_0040730 Ga0466962_0040730_197_1045 282
309 iso_pu_bacteria 2512564014 2512644656 282
310 3300001979 JGI24740J21852_10001009 JGI24740J21852_100010094 283
311 3300001989 JGI24739J22299_10000717 JGI24739J22299_100007179 283
312 3300002075 JGI24738J21930_10001937 JGI24738J21930_100019373 283
313 3300003771 Ga0055526_1009564 Ga0055526_10095643 283
314 3300003773 Ga0055537_1000408 Ga0055537_100040816 283
315 3300003773 Ga0055537_1000501 Ga0055537_100050111 283
316 3300003775 Ga0055524_1000833 Ga0055524_100083313 283
317 3300003790 Ga0055528_1004240 Ga0055528_10042406 283
318 3300003794 Ga0055531_10004230 Ga0055531_100042307 283
319 3300005262 Ga0065165_1007054 Ga0065165_10070544 283
320 3300005339 Ga0070660_100037066 Ga0070660_1000370664 283
321 3300005364 Ga0070673_100210383 Ga0070673_1002103832 283
322 3300009093 Ga0105240_10196444 Ga0105240_101964442 283
323 3300009098 Ga0105245_10161618 Ga0105245_101616182 283
324 3300013105 Ga0157369_10026172 Ga0157369_100261725 283
325 3300025263 Ga0209565_1000079 Ga0209565_100007981 283
326 3300025263 Ga0209565_1000126 Ga0209565_100012634 283
327 3300025273 Ga0209673_1002303 Ga0209673_10023036 283
328 3300025273 Ga0209673_1027859 Ga0209673_10278592 283
329 3300025291 Ga0209675_1002743 Ga0209675_10027433 283
330 3300025291 Ga0209675_1011542 Ga0209675_10115423 283
331 3300025294 Ga0209025_1001497 Ga0209025_100149712 283
332 3300025295 Ga0209564_1000624 Ga0209564_100062433 283
333 3300025295 Ga0209564_1027764 Ga0209564_10277642 283
334 3300025297 Ga0209758_1000487 Ga0209758_100048721 283
335 3300025297 Ga0209758_1010729 Ga0209758_10107294 283
336 3300025299 Ga0209256_1000190 Ga0209256_100019013 283
337 3300025299 Ga0209256_1013292 Ga0209256_10132923 283
338 3300025904 Ga0207647_10006004 Ga0207647_100060049 283
339 3300028794 Ga0307515_10124483 Ga0307515_101244833 283
340 3300028794 Ga0307515_10181858 Ga0307515_101818582 283
341 3300031911 Ga0307412_10000066 Ga0307412_100000667 283
342 3300044684 Ga0466966_0001188 Ga0466966_0001188_12067_12918 283
343 3300046454 Ga0495592_0022002 Ga0495592_0022002_3761_4615 283
344 3300046455 Ga0495603_0049109 Ga0495603_0049109_542_1396 283
345 3300046458 Ga0495591_001189 Ga0495591_001189_6154_7008 283
346 3300046460 Ga0495638_0251682 Ga0495638_0251682_61_915 283
347 3300046474 Ga0495605_0000116 Ga0495605_0000116_101535_102386 283
348 3300046474 Ga0495605_0044619 Ga0495605_0044619_595_1446 283
349 3300046492 Ga0495585_0050087 Ga0495585_0050087_705_1577 283
350 3300046500 Ga0495596_0000726 Ga0495596_0000726_9071_9943 283
351 3300046500 Ga0495596_0000764 Ga0495596_0000764_13242_14096 283
352 3300046500 Ga0495596_0013034 Ga0495596_0013034_251_1102 283
353 3300046500 Ga0495596_0013752 Ga0495596_0013752_1344_2198 283
354 3300046501 Ga0495607_0000057 Ga0495607_0000057_96561_97412 283
355 3300046501 Ga0495607_0021836 Ga0495607_0021836_2963_3814 283
356 3300046501 Ga0495607_0090664 Ga0495607_0090664_633_1484 283
357 3300046507 Ga0495606_0018417 Ga0495606_0018417_1134_1985 283
358 3300046511 Ga0495608_0007581 Ga0495608_0007581_3106_3960 283
359 3300046512 Ga0495610_0000246 Ga0495610_0000246_44375_45226 283
360 3300046513 Ga0495616_0004655 Ga0495616_0004655_773_1624 283
361 3300046513 Ga0495616_0022742 Ga0495616_0022742_2083_2955 283
362 3300046513 Ga0495616_0144275 Ga0495616_0144275_153_1004 283
363 3300046514 Ga0495618_0009613 Ga0495618_0009613_1344_2198 283
364 3300046519 Ga0495632_0002942 Ga0495632_0002942_11356_12207 283
365 3300046519 Ga0495632_0016297 Ga0495632_0016297_164_1015 283
366 3300046519 Ga0495632_0045143 Ga0495632_0045143_158_1009 283
367 3300046520 Ga0495637_0003200 Ga0495637_0003200_6574_7425 283
368 3300046522 Ga0495643_0000347 Ga0495643_0000347_16515_17366 283
369 3300046522 Ga0495643_0012675 Ga0495643_0012675_733_1584 283
370 3300046522 Ga0495643_0040614 Ga0495643_0040614_597_1448 283
371 3300046522 Ga0495643_0124017 Ga0495643_0124017_276_1127 283
372 3300046522 Ga0495643_0155509 Ga0495643_0155509_23_874 283
373 3300046524 Ga0495648_0014780 Ga0495648_0014780_807_1661 283
374 3300046528 Ga0495642_0000337 Ga0495642_0000337_24453_25304 283
375 3300046528 Ga0495642_0001005 Ga0495642_0001005_2629_3480 283
376 3300046528 Ga0495642_0004832 Ga0495642_0004832_3542_4393 283
377 3300046528 Ga0495642_0055419 Ga0495642_0055419_379_1230 283
378 3300046529 Ga0495652_0161428 Ga0495652_0161428_578_1432 283
379 3300046558 Ga0495633_0001062 Ga0495633_0001062_5275_6126 283
380 3300046558 Ga0495633_0004578 Ga0495633_0004578_1031_1885 283
381 3300046615 Ga0495656_0004397 Ga0495656_0004397_3880_4731 283
382 3300046660 Ga0495625_0000011 Ga0495625_0000011_298395_299246 283
383 3300046660 Ga0495625_0000286 Ga0495625_0000286_59013_59867 283
384 3300046665 Ga0495661_0000221 Ga0495661_0000221_52202_53053 283
385 3300046665 Ga0495661_0011755 Ga0495661_0011755_653_1504 283
386 3300046665 Ga0495661_0012090 Ga0495661_0012090_1384_2235 283
387 3300046665 Ga0495661_0067015 Ga0495661_0067015_480_1331 283
388 3300046665 Ga0495661_0122764 Ga0495661_0122764_356_1207 283
389 3300046674 Ga0495588_0015123 Ga0495588_0015123_2182_3033 283
390 3300046674 Ga0495588_0133748 Ga0495588_0133748_256_1110 283
391 3300046674 Ga0495588_0184116 Ga0495588_0184116_127_978 283
392 3300046680 Ga0495646_0025567 Ga0495646_0025567_25_879 283
393 3300046684 Ga0495669_0001150 Ga0495669_0001150_9833_10684 283
394 3300046684 Ga0495669_0002601 Ga0495669_0002601_4070_4942 283
395 3300046684 Ga0495669_0043727 Ga0495669_0043727_472_1323 283
396 3300046691 Ga0495670_0004224 Ga0495670_0004224_4523_5374 283
397 3300046691 Ga0495670_0176841 Ga0495670_0176841_148_999 283
398 3300046694 Ga0495649_0000205 Ga0495649_0000205_1317_2168 283
399 3300046694 Ga0495649_0030307 Ga0495649_0030307_178_1029 283
400 3300046694 Ga0495649_0123903 Ga0495649_0123903_34_885 283
401 3300046694 Ga0495649_0195082 Ga0495649_0195082_14_865 283
402 3300046794 Ga0495589_0000022 Ga0495589_0000022_165188_166039 283
403 3300046794 Ga0495589_0010558 Ga0495589_0010558_1280_2131 283
404 3300046810 Ga0495660_0000044 Ga0495660_0000044_133563_134414 283
405 3300046810 Ga0495660_0063542 Ga0495660_0063542_969_1820 283
406 3300047317 Ga0495604_0001575 Ga0495604_0001575_17147_18001 283
407 3300047319 Ga0495674_0118478 Ga0495674_0118478_807_1661 283
408 3300047320 Ga0495672_0004016 Ga0495672_0004016_4653_5504 283
409 3300047322 Ga0495680_0104218 Ga0495680_0104218_578_1432 283
410 3300047323 Ga0495683_0002693 Ga0495683_0002693_7087_7941 283
411 3300047323 Ga0495683_0009759 Ga0495683_0009759_3415_4266 283
412 3300047323 Ga0495683_0059018 Ga0495683_0059018_368_1219 283
413 3300047443 Ga0495687_000099 Ga0495687_000099_123789_124640 283
414 3300047443 Ga0495687_014699 Ga0495687_014699_1050_1901 283
415 3300047444 Ga0495675_0001567 Ga0495675_0001567_6457_7311 283
416 3300047445 Ga0495677_0000256 Ga0495677_0000256_6861_7712 283
417 3300047445 Ga0495677_0004940 Ga0495677_0004940_3125_3976 283
418 3300047445 Ga0495677_0006276 Ga0495677_0006276_2802_3653 283
419 3300047445 Ga0495677_0018233 Ga0495677_0018233_443_1294 283
420 3300047445 Ga0495677_0031780 Ga0495677_0031780_150_1022 283
421 3300047445 Ga0495677_0034297 Ga0495677_0034297_829_1680 283
422 3300047445 Ga0495677_0066524 Ga0495677_0066524_400_1251 283
423 3300047446 Ga0495679_001620 Ga0495679_001620_10902_11756 283
424 3300047446 Ga0495679_023187 Ga0495679_023187_461_1321 283
425 3300047472 Ga0495686_0020061 Ga0495686_0020061_1674_2528 283
426 3300048088 Ga0495602_0118708 Ga0495602_0118708_180_1034 283
427 3300048090 Ga0495615_0000019 Ga0495615_0000019_22684_23538 283
428 3300048091 Ga0495626_0000021 Ga0495626_0000021_47617_48468 283
429 3300048091 Ga0495626_0000412 Ga0495626_0000412_184_1035 283
430 3300048091 Ga0495626_0009572 Ga0495626_0009572_884_1735 283
431 3300048091 Ga0495626_0047637 Ga0495626_0047637_944_1795 283
432 3300048091 Ga0495626_0062209 Ga0495626_0062209_45_896 283
433 3300048919 Ga0496116_0000719 Ga0496116_0000719_23161_24015 283
434 3300048920 Ga0496117_0021582 Ga0496117_0021582_3707_4558 283
435 3300048925 Ga0496122_0001256 Ga0496122_0001256_18505_19359 283
436 3300048926 Ga0496123_0001025 Ga0496123_0001025_23162_24016 283
437 3300048928 Ga0496125_0005812 Ga0496125_0005812_681_1535 283
438 3300049822 Ga0501035_0038907 Ga0501035_0038907_1210_2061 283
439 3300049823 Ga0501044_0002760 Ga0501044_0002760_6855_7706 283
440 3300050509 nmdc:mga0qj67_234985_c1 nmdc:mga0qj67_234985_c1_14_913 283
441 3300053088 Ga0500644_0000483 Ga0500644_0000483_3510_4367 283
442 3300053093 Ga0500651_0298950 Ga0500651_0298950_18_875 283
443 3300053125 Ga0500618_000164 Ga0500618_000164_5642_6502 283
444 3300053125 Ga0500618_010535 Ga0500618_010535_157_1008 283
445 3300053153 Ga0500616_0000371 Ga0500616_0000371_53271_54128 283
446 3300053156 Ga0500622_0103898 Ga0500622_0103898_469_1320 283
447 3300053727 Ga0500611_008395 Ga0500611_008395_709_1563 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

5

280

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.8314 4 280
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.8228 4 280
4dia-assembly1.cif.gz_A crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 0.8064 4 281
2ffi-assembly2.cif.gz_B crystal structure of putative 2-pyrone-4,6-dicarboxylic acid hydrolase from pseudomonas putida, northeast structural genomics target ppr23. 0.7978 1 283
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.7949 5 280
ID Description Score Start End Superfamily
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8314 4 280 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8278 2 278 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8228 4 280 3.20.20.140
4d95A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8202 4 281 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8087 2 278 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A132EVY6-F1-model_v4 Amidohydrolase 0.9947 2 283 GO:0016787
GO:0016831
AF-A0A132EVY6-F1-model_v4 Amidohydrolase 0.9912 2 283 GO:0016787
GO:0016831
AF-A0A2V8H4U9-F1-model_v4 Amidohydrolase 0.9905 44 283 GO:0016787
GO:0016831
AF-J2L7I0-F1-model_v4 Putative TIM-barrel fold metal-dependent hydrolase 0.9887 182 282 GO:0016787
AF-A0A1F3ZV58-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9885 88 283 GO:0016787

Feature Viewer

pLDDT pTM Quality
93.64 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map