F446006

General Info

Members Datasets Scaffolds Average Seq Length
447 233 894 217

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0197348|Ga0466958_0197348_536_1252
Length 238
Sequence MLLLDKRRHAQGSMRVLVVEDERRLADAIARGLRREGMAVDLAGDGSDALVKSRVVRYDVLVLDRDLPEVHGDDVCRTVRAERPETAIIMLTAASELEDLVEGLSLGADDYLSKPFRFAELVARIRALGRRSTPSRPPVLRHGNLELDPARRSVTRDGRPIDLARKELAVLEALMAADGATVSAEELLERVWDEHTDPFTNVVRMTIMTLRRKLGEPPVVETVIGVGYRLAASEANVG

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
230 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
231 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
232 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
233 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 6.49
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0197348 3300045836 Bacteria 1280
2 Ga0070658_10273618 3300005327 Bacteria 1437
3 Ga0070683_100022659 3300005329 Bacteria 5616
4 Ga0070683_100104499 3300005329 Bacteria 2670
5 Ga0070682_100107406 3300005337 Bacteria 1854
6 Ga0068868_100139852 3300005338 Bacteria 1987
7 Ga0070689_100198201 3300005340 Bacteria 1638
8 Ga0070661_100756726 3300005344 Bacteria 795
9 Ga0070668_100210613 3300005347 Bacteria 1599
10 Ga0070659_100239900 3300005366 Bacteria 1500
11 Ga0070667_100101802 3300005367 Bacteria 2482
12 Ga0070709_10014309 3300005434 Bacteria 4485
13 Ga0070709_10035913 3300005434 Bacteria 3014
14 Ga0070714_100023646 3300005435 Bacteria 5052
15 Ga0070714_100091093 3300005435 Bacteria 2671
16 Ga0070714_100098798 3300005435 Bacteria 2568
17 Ga0070714_100414746 3300005435 Bacteria 1275
18 Ga0070713_100054534 3300005436 Bacteria 3317
19 Ga0070713_100072609 3300005436 Bacteria 2911
20 Ga0070713_100600611 3300005436 Bacteria 1045
21 Ga0070710_10007967 3300005437 Bacteria 5150
22 Ga0070710_10044966 3300005437 Bacteria 2452
23 Ga0070711_100027813 3300005439 Bacteria 3715
24 Ga0070711_100385825 3300005439 Bacteria 1134
25 Ga0070700_100187245 3300005441 Bacteria 1445
26 Ga0070663_100559968 3300005455 Bacteria 956
27 Ga0070663_100706933 3300005455 Bacteria 857
28 Ga0070685_10075440 3300005466 Bacteria 2009
29 Ga0070706_100064032 3300005467 Bacteria 3398
30 Ga0070707_100291154 3300005468 Bacteria 1587
31 Ga0070698_100130787 3300005471 Bacteria 2465
32 Ga0070699_100515370 3300005518 Bacteria 1087
33 Ga0070684_100041836 3300005535 Bacteria 3952
34 Ga0070684_100268353 3300005535 Bacteria 1562
35 Ga0070684_100852012 3300005535 Bacteria 853
36 Ga0070665_100001102 3300005548 Bacteria 33324
37 Ga0070664_100209322 3300005564 Bacteria 1742
38 Ga0070664_100225815 3300005564 Bacteria 1677
39 Ga0068856_100033907 3300005614 Bacteria 4999
40 Ga0068856_100134927 3300005614 Bacteria 2473
41 Ga0068856_100807505 3300005614 Bacteria 958
42 Ga0070702_100085291 3300005615 Bacteria 1902
43 Ga0068852_100192820 3300005616 Bacteria 1924
44 Ga0068859_100372396 3300005617 Bacteria 1524
45 Ga0068864_100328631 3300005618 Bacteria 1438
46 Ga0068866_10188813 3300005718 Bacteria 1223
47 Ga0068861_100572604 3300005719 Bacteria 1032
48 Ga0068851_10200583 3300005834 Bacteria 1113
49 Ga0068860_100051663 3300005843 Bacteria 3910
50 Ga0081455_10002885 3300005937 Bacteria 20211
51 Ga0081538_10063627 3300005981 Bacteria 2093
52 Ga0081539_10004899 3300005985 Bacteria 14274
53 Ga0081539_10011407 3300005985 Bacteria 7028
54 Ga0081539_10060256 3300005985 Bacteria 2085
55 Ga0081539_10163414 3300005985 Bacteria 1059
56 Ga0070717_10012405 3300006028 Bacteria 6498
57 Ga0070717_10014227 3300006028 Bacteria 6117
58 Ga0070717_10110558 3300006028 Bacteria 2344
59 Ga0070717_10154628 3300006028 Bacteria 1986
60 Ga0070717_10208186 3300006028 Bacteria 1715
61 Ga0070717_10231879 3300006028 Bacteria 1626
62 Ga0070717_10463518 3300006028 Bacteria 1143
63 Ga0070717_10594283 3300006028 Bacteria 1004
64 Ga0070716_100077087 3300006173 Bacteria 1977
65 Ga0070712_100002695 3300006175 Bacteria 10963
66 Ga0070712_100011848 3300006175 Bacteria 5540
67 Ga0075428_100152342 3300006844 Bacteria 2511
68 Ga0075431_100025630 3300006847 Bacteria 6045
69 Ga0075431_100174849 3300006847 Bacteria 2206
70 Ga0075431_100366645 3300006847 Bacteria 1446
71 Ga0075433_10031046 3300006852 Bacteria 4564
72 Ga0075434_100034391 3300006871 Bacteria 5004
73 Ga0075436_100014843 3300006914 Bacteria 5338
74 Ga0075436_100479905 3300006914 Bacteria 908
75 Ga0097620_100372409 3300006931 Bacteria 1524
76 Ga0075435_100088208 3300007076 Bacteria 2557
77 Ga0111539_10051902 3300009094 Bacteria 4882
78 Ga0111539_10059883 3300009094 Bacteria 4514
79 Ga0111539_10204189 3300009094 Bacteria 2304
80 Ga0111539_10944393 3300009094 Bacteria 1003
81 Ga0105245_10140285 3300009098 Bacteria 2275
82 Ga0105247_10265790 3300009101 Bacteria 1178
83 Ga0114129_10052732 3300009147 Bacteria 5708
84 Ga0105243_10102611 3300009148 Bacteria 2377
85 Ga0105243_10707597 3300009148 Bacteria 983
86 Ga0105248_10635384 3300009177 Bacteria 1204
87 Ga0105249_10022136 3300009553 Bacteria 5692
88 Ga0105246_10295131 3300011119 Bacteria 1306
89 Ga0157369_10688807 3300013105 Bacteria 1053
90 Ga0157378_10302817 3300013297 Bacteria 1548
91 Ga0163162_10121629 3300013306 Unclassified 2715
92 Ga0163163_10691971 3300014325 Bacteria 1083
93 Ga0157380_10526875 3300014326 Bacteria 1154
94 Ga0157380_11299645 3300014326 Bacteria 775
95 Ga0157379_11039924 3300014968 Bacteria 782
96 Ga0213874_10004419 3300021377 Bacteria 3208
97 Ga0213874_10022406 3300021377 Bacteria 1753
98 Ga0213876_10095235 3300021384 Bacteria 1577
99 Ga0213876_10210525 3300021384 Bacteria 1034
100 Ga0213875_10015588 3300021388 Bacteria 3697
101 Ga0213875_10018472 3300021388 Bacteria 3359
102 Ga0213875_10035522 3300021388 Bacteria 2351
103 Ga0213875_10035753 3300021388 Bacteria 2343
104 Ga0213875_10072730 3300021388 Bacteria 1604
105 Ga0207692_10012385 3300025898 Bacteria 3662
106 Ga0207692_10047594 3300025898 Bacteria 2154
107 Ga0207642_10065084 3300025899 Bacteria 1711
108 Ga0207688_10055117 3300025901 Bacteria 2231
109 Ga0207699_10011410 3300025906 Bacteria 4487
110 Ga0207699_10135766 3300025906 Bacteria 1611
111 Ga0207705_10380185 3300025909 Bacteria 1091
112 Ga0207705_10496993 3300025909 Bacteria 947
113 Ga0207684_10037247 3300025910 Bacteria 4127
114 Ga0207707_10140689 3300025912 Bacteria 2110
115 Ga0207693_10004920 3300025915 Bacteria 11224
116 Ga0207693_10009336 3300025915 Bacteria 7998
117 Ga0207693_10094901 3300025915 Bacteria 2338
118 Ga0207663_10011071 3300025916 Bacteria 4827
119 Ga0207663_10034510 3300025916 Bacteria 3026
120 Ga0207663_10035354 3300025916 Bacteria 2996
121 Ga0207663_10541462 3300025916 Bacteria 909
122 Ga0207663_10647362 3300025916 Bacteria 834
123 Ga0207657_10098683 3300025919 Bacteria 2427
124 Ga0207657_10332244 3300025919 Bacteria 1200
125 Ga0207646_10165814 3300025922 Bacteria 1994
126 Ga0207650_10442987 3300025925 Bacteria 1080
127 Ga0207687_10360706 3300025927 Bacteria 1186
128 Ga0207700_10040731 3300025928 Bacteria 3393
129 Ga0207700_10228308 3300025928 Bacteria 1581
130 Ga0207664_10025964 3300025929 Bacteria 4421
131 Ga0207664_10026818 3300025929 Bacteria 4359
132 Ga0207664_10032387 3300025929 Bacteria 4005
133 Ga0207664_10042134 3300025929 Bacteria 3562
134 Ga0207664_10124495 3300025929 Bacteria 2162
135 Ga0207664_10215227 3300025929 Bacteria 1664
136 Ga0207664_10427102 3300025929 Bacteria 1181
137 Ga0207664_10648304 3300025929 Bacteria 949
138 Ga0207664_10699809 3300025929 Bacteria 911
139 Ga0207690_10117001 3300025932 Bacteria 1929
140 Ga0207706_10320994 3300025933 Bacteria 1348
141 Ga0207665_10018368 3300025939 Bacteria 4596
142 Ga0207661_10412494 3300025944 Bacteria 1226
143 Ga0207679_10037796 3300025945 Bacteria 3435
144 Ga0207679_10157236 3300025945 Bacteria 1857
145 Ga0207712_11001182 3300025961 Bacteria 741
146 Ga0207658_10115158 3300025986 Bacteria 2133
147 Ga0207677_10199132 3300026023 Bacteria 1590
148 Ga0207677_10294218 3300026023 Bacteria 1339
149 Ga0207678_10105639 3300026067 Bacteria 2403
150 Ga0207708_10346536 3300026075 Bacteria 1218
151 Ga0207702_10027029 3300026078 Bacteria 4765
152 Ga0207702_10291759 3300026078 Bacteria 1545
153 Ga0207676_10287351 3300026095 Bacteria 1496
154 Ga0207675_100178833 3300026118 Bacteria 2031
155 Ga0207675_100234472 3300026118 Bacteria 1771
156 Ga0207683_10455882 3300026121 Bacteria 1179
157 Ga0207698_10096860 3300026142 Bacteria 2433
158 Ga0207428_10021716 3300027907 Bacteria 5430
159 Ga0268266_10027911 3300028379 Bacteria 4800
160 Ga0268266_10049653 3300028379 Unclassified 3598
161 Ga0268264_10010030 3300028381 Bacteria 7841
162 Ga0307515_10091610 3300028794 Bacteria 3796
163 Ga0307509_10285635 3300031507 Bacteria 1408
164 Ga0307408_100377572 3300031548 Bacteria 1211
165 Ga0307508_10396066 3300031616 Bacteria 972
166 Ga0307405_10021457 3300031731 Bacteria 3631
167 Ga0307413_10702727 3300031824 Bacteria 840
168 Ga0307406_10076376 3300031901 Bacteria 2213
169 Ga0307406_10089110 3300031901 Bacteria 2072
170 Ga0307409_100477692 3300031995 Bacteria 1209
171 Ga0307416_100032222 3300032002 Bacteria 3957
172 Ga0307416_100487459 3300032002 Bacteria 1294
173 Ga0307416_101105097 3300032002 Bacteria 897
174 Ga0307411_10635958 3300032005 Bacteria 922
175 Ga0307415_100000771 3300032126 Bacteria 14476
176 Ga0307415_100586157 3300032126 Bacteria 990
177 Ga0373944_0004931 3300035089 Bacteria 3498
178 Ga0373923_0016448 3300035111 Bacteria 2811
179 Ga0373936_0005513 3300035113 Bacteria 4775
180 Ga0373936_0036689 3300035113 Bacteria 1955
181 Ga0373945_0042724 3300035116 Bacteria 1643
182 Ga0373953_0041018 3300035117 Bacteria 1841
183 Ga0373954_0015803 3300035118 Bacteria 3375
184 Ga0373956_0001992 3300035119 Bacteria 8462
185 Ga0373956_0114695 3300035119 Bacteria 1256
186 Ga0373957_0008451 3300035120 Bacteria 3334
187 Ga0373957_0061219 3300035120 Bacteria 1458
188 Ga0373943_0008809 3300035170 Bacteria 4522
189 Ga0373946_0007674 3300035171 Bacteria 3952
190 Ga0373955_0189242 3300035172 Bacteria 1223
191 Ga0373924_0003088 3300035410 Bacteria 5683
192 Ga0373924_0019446 3300035410 Bacteria 2631
193 Ga0373924_0072594 3300035410 Bacteria 1454
194 Ga0373931_0095503 3300035691 Bacteria 1664
195 Ga0373935_0005175 3300035692 Bacteria 7678
196 Ga0373935_0038523 3300035692 Bacteria 2993
197 Ga0373935_0094032 3300035692 Bacteria 1966
198 Ga0373927_0026010 3300035695 Bacteria 3825
199 Ga0373933_0014646 3300035724 Bacteria 4366
200 Ga0373933_0035213 3300035724 Bacteria 2922
201 Ga0373933_0080836 3300035724 Bacteria 1993
202 Ga0373933_0180225 3300035724 Bacteria 1347
203 Ga0373933_0349367 3300035724 Bacteria 960
204 Ga0373947_0019117 3300035725 Bacteria 3948
205 Ga0373947_0066688 3300035725 Bacteria 2197
206 Ga0373937_0100438 3300036401 Bacteria 2685
207 Ga0373937_0776861 3300036401 Bacteria 905
208 Ga0373925_0058659 3300037068 Bacteria 2886
209 Ga0373925_0194479 3300037068 Bacteria 1610
210 Ga0395900_0001878 3300037418 Bacteria 23883
211 Ga0395898_0004969 3300037466 Bacteria 14430
212 Ga0436364_0313968 3300037853 Bacteria 2477
213 Ga0436364_0369788 3300037853 Bacteria 17230
214 Ga0436364_0390966 3300037853 Bacteria 4739
215 Ga0436364_0541733 3300037853 Bacteria 3872
216 Ga0436364_0729730 3300037853 Bacteria 4546
217 Ga0436364_1008667 3300037853 Bacteria 1226
218 Ga0436364_1232571 3300037853 Bacteria 2745
219 Ga0436365_0007367 3300039437 Bacteria 3449
220 Ga0436365_0259986 3300039437 Bacteria 3084
221 Ga0436365_0621914 3300039437 Bacteria 3514
222 Ga0436365_0872734 3300039437 Bacteria 1410
223 Ga0436365_1186547 3300039437 Bacteria 3782
224 Ga0436365_1216533 3300039437 Bacteria 3674
225 Ga0436365_1342420 3300039437 Bacteria 1622
226 Ga0436365_1421205 3300039437 Bacteria 2557
227 Ga0436365_1612919 3300039437 Bacteria 3056
228 Ga0436365_1691212 3300039437 Bacteria 5902
229 Ga0436360_0202294 3300039438 Bacteria 1454
230 Ga0436360_0546653 3300039438 Bacteria 820
231 Ga0436361_0776560 3300039447 Bacteria 783
232 Ga0436361_1162437 3300039447 Bacteria 1501
233 Ga0436363_0258507 3300039450 Bacteria 1000
234 Ga0436363_0342616 3300039450 Bacteria 715
235 Ga0436363_0498093 3300039450 Bacteria 2138
236 Ga0436363_0501877 3300039450 Bacteria 3217
237 Ga0436363_0869304 3300039450 Bacteria 1181
238 Ga0436363_0928390 3300039450 Bacteria 15558
239 Ga0436363_0952078 3300039450 Bacteria 1749
240 Ga0436363_1265842 3300039450 Bacteria 1268
241 Ga0436363_1714932 3300039450 Bacteria 2398
242 Ga0436362_0208969 3300039453 Bacteria 2998
243 Ga0436362_0295887 3300039453 Bacteria 2819
244 Ga0436362_0313005 3300039453 Bacteria 829
245 Ga0436362_0565950 3300039453 Bacteria 1073
246 Ga0436362_0785100 3300039453 Bacteria 4348
247 Ga0436362_0819636 3300039453 Bacteria 978
248 Ga0436362_0918273 3300039453 Bacteria 2979
249 Ga0436362_1242770 3300039453 Bacteria 2724
250 Ga0451839_0189701 3300041496 Bacteria 814
251 Ga0439449_0030943 3300042007 Bacteria 1995
252 Ga0450904_000410 3300042139 Bacteria 8749
253 Ga0466969_0001191 3300044656 Bacteria 14062
254 Ga0466969_0026165 3300044656 Bacteria 2994
255 Ga0466969_0112620 3300044656 Bacteria 1272
256 Ga0466966_0094237 3300044684 Bacteria 1856
257 Ga0466966_0412613 3300044684 Bacteria 811
258 Ga0466966_0634446 3300044684 Bacteria 643
259 Ga0466961_0046205 3300044693 Bacteria 2785
260 Ga0466961_0088156 3300044693 Bacteria 1960
261 Ga0466961_0364060 3300044693 Bacteria 879
262 Ga0466961_0592547 3300044693 Bacteria 667
263 Ga0466963_0000510 3300044694 Bacteria 18138
264 Ga0466963_0005861 3300044694 Bacteria 7240
265 Ga0466963_0028448 3300044694 Bacteria 3588
266 Ga0466963_0047583 3300044694 Bacteria 2831
267 Ga0466963_0100546 3300044694 Bacteria 1979
268 Ga0466964_0455476 3300044706 Bacteria 679
269 Ga0466971_0033839 3300044719 Bacteria 2290
270 Ga0466971_0060043 3300044719 Bacteria 1718
271 Ga0466971_0064879 3300044719 Bacteria 1653
272 Ga0466971_0216399 3300044719 Bacteria 907
273 Ga0466968_0010323 3300044735 Bacteria 3619
274 Ga0466968_0013206 3300044735 Bacteria 3245
275 Ga0466968_0088269 3300044735 Bacteria 1370
276 Ga0466970_0106593 3300044765 Bacteria 1529
277 Ga0466970_0231306 3300044765 Bacteria 1033
278 Ga0466957_0151750 3300044842 Bacteria 1499
279 Ga0466957_0208105 3300044842 Bacteria 1287
280 Ga0466957_0482533 3300044842 Bacteria 857
281 Ga0466960_0042958 3300044901 Bacteria 2148
282 Ga0466959_0009424 3300045049 Bacteria 6946
283 Ga0466959_0009641 3300045049 Bacteria 6871
284 Ga0466959_0028418 3300045049 Bacteria 4147
285 Ga0466959_0087959 3300045049 Bacteria 2234
286 Ga0466959_0137199 3300045049 Bacteria 1731
287 Ga0466959_0193282 3300045049 Bacteria 1419
288 Ga0466959_0203753 3300045049 Bacteria 1377
289 Ga0466959_0267341 3300045049 Bacteria 1176
290 Ga0466959_0290205 3300045049 Bacteria 1121
291 Ga0466959_0453655 3300045049 Bacteria 869
292 Ga0466959_0518767 3300045049 Bacteria 805
293 Ga0466959_0533411 3300045049 Bacteria 792
294 Ga0466958_0013922 3300045836 Bacteria 4587
295 Ga0466958_0036723 3300045836 Bacteria 2934
296 Ga0466958_0058484 3300045836 Bacteria 2344
297 Ga0466958_0088619 3300045836 Bacteria 1912
298 Ga0466958_0094015 3300045836 Bacteria 1857
299 Ga0466958_0101940 3300045836 Bacteria 1785
300 Ga0466958_0333860 3300045836 Bacteria 975
301 Ga0466967_0000478 3300045976 Bacteria 19384
302 Ga0466967_0051741 3300045976 Bacteria 3601
303 Ga0466967_0090422 3300045976 Bacteria 2781
304 Ga0466967_0174203 3300045976 Bacteria 2026
305 Ga0466967_0274930 3300045976 Bacteria 1615
306 Ga0466967_0791530 3300045976 Bacteria 941
307 Ga0466967_1333493 3300045976 Bacteria 715
308 Ga0495592_0028464 3300046454 Bacteria 4232
309 Ga0495592_0037460 3300046454 Bacteria 3651
310 Ga0495592_0143915 3300046454 Bacteria 1655
311 Ga0495629_0008763 3300046459 Bacteria 7436
312 Ga0495629_0050650 3300046459 Bacteria 2908
313 Ga0495641_0030029 3300046461 Bacteria 2612
314 Ga0495641_0079469 3300046461 Bacteria 1469
315 Ga0495641_0163909 3300046461 Bacteria 994
316 Ga0495651_0008070 3300046462 Bacteria 8072
317 Ga0495653_0016304 3300046463 Bacteria 6053
318 Ga0495653_0032150 3300046463 Bacteria 4169
319 Ga0495582_0013704 3300046473 Bacteria 4463
320 Ga0495639_0012658 3300046475 Bacteria 3640
321 Ga0495662_0016296 3300046476 Bacteria 3600
322 Ga0495664_0018774 3300046477 Bacteria 3967
323 Ga0495664_0030001 3300046477 Bacteria 3184
324 Ga0495664_0112882 3300046477 Bacteria 1641
325 Ga0495664_0142185 3300046477 Bacteria 1455
326 Ga0495664_0423519 3300046477 Bacteria 798
327 Ga0495584_0045383 3300046491 Bacteria 2217
328 Ga0495608_0037667 3300046511 Bacteria 3251
329 Ga0495618_0042745 3300046514 Bacteria 2857
330 Ga0495618_0412547 3300046514 Bacteria 824
331 Ga0495628_0019212 3300046516 Bacteria 5652
332 Ga0495628_0218284 3300046516 Bacteria 1433
333 Ga0495628_0298687 3300046516 Bacteria 1192
334 Ga0495666_0028390 3300046526 Bacteria 2752
335 Ga0495652_0028288 3300046529 Bacteria 4934
336 Ga0495652_0517918 3300046529 Bacteria 825
337 Ga0495665_0020603 3300046531 Bacteria 3540
338 Ga0495640_0023711 3300046533 Bacteria 4465
339 Ga0495640_0173907 3300046533 Bacteria 1375
340 Ga0495640_0381485 3300046533 Bacteria 867
341 Ga0495587_0256803 3300046536 Bacteria 982
342 Ga0495621_0158626 3300046539 Bacteria 894
343 Ga0495645_0093389 3300046543 Bacteria 2147
344 Ga0495645_0106488 3300046543 Bacteria 1988
345 Ga0495667_0007971 3300046559 Bacteria 7183
346 Ga0495667_0052923 3300046559 Bacteria 2674
347 Ga0495667_0067207 3300046559 Bacteria 2342
348 Ga0495634_0075442 3300046642 Bacteria 2214
349 Ga0495634_0084616 3300046642 Bacteria 2068
350 Ga0495635_0296931 3300046663 Bacteria 1083
351 Ga0495657_0113099 3300046675 Bacteria 1717
352 Ga0495599_0039556 3300046678 Bacteria 2962
353 Ga0495599_0126309 3300046678 Bacteria 1589
354 Ga0495599_0333392 3300046678 Bacteria 911
355 Ga0495599_0488952 3300046678 Bacteria 725
356 Ga0495646_0044940 3300046680 Bacteria 2699
357 Ga0495646_0089373 3300046680 Bacteria 1782
358 Ga0495613_0116833 3300046689 Bacteria 1918
359 Ga0495613_0225004 3300046689 Bacteria 1316
360 Ga0495624_0017600 3300046690 Bacteria 4794
361 Ga0495624_0186369 3300046690 Bacteria 1263
362 Ga0495600_0022190 3300046809 Bacteria 4073
363 Ga0495600_0107303 3300046809 Bacteria 1819
364 Ga0495600_0238554 3300046809 Bacteria 1159
365 Ga0495581_0013011 3300047315 Bacteria 4823
366 Ga0495581_0075647 3300047315 Bacteria 1948
367 Ga0495604_0034053 3300047317 Bacteria 4030
368 Ga0495604_0279124 3300047317 Bacteria 1129
369 Ga0495674_0049881 3300047319 Bacteria 3695
370 Ga0495674_0135080 3300047319 Bacteria 2076
371 Ga0495676_0039327 3300047321 Bacteria 3918
372 Ga0495680_0019495 3300047322 Bacteria 5722
373 Ga0495680_0083211 3300047322 Bacteria 2413
374 Ga0495680_0096327 3300047322 Bacteria 2210
375 Ga0495675_0012772 3300047444 Bacteria 5289
376 Ga0495684_0021457 3300047471 Bacteria 4973
377 Ga0495593_0015580 3300047673 Bacteria 4302
378 Ga0495593_0065905 3300047673 Bacteria 1888
379 Ga0495593_0230678 3300047673 Bacteria 928
380 Ga0495602_0031032 3300048088 Bacteria 5059
381 Ga0495602_0067315 3300048088 Bacteria 3081
382 Ga0495602_0197165 3300048088 Bacteria 1539
383 Ga0495614_0053764 3300048089 Bacteria 1727
384 Ga0496100_0208085 3300048903 Bacteria 1429
385 Ga0496100_0739203 3300048903 Bacteria 769
386 Ga0496101_0014660 3300048904 Bacteria 5272
387 Ga0496101_0041412 3300048904 Bacteria 3284
388 Ga0496102_0014547 3300048905 Bacteria 6838
389 Ga0496103_0100400 3300048906 Bacteria 1831
390 Ga0496104_0029892 3300048907 Bacteria 5059
391 Ga0496104_0062840 3300048907 Bacteria 3521
392 Ga0496104_0661536 3300048907 Bacteria 953
393 Ga0496105_0050474 3300048908 Bacteria 3436
394 Ga0496105_0076415 3300048908 Bacteria 2765
395 Ga0496106_0012349 3300048909 Bacteria 6304
396 Ga0496106_0019381 3300048909 Bacteria 5045
397 Ga0496106_0131626 3300048909 Bacteria 1962
398 Ga0496107_0022619 3300048910 Bacteria 4442
399 Ga0496107_0096230 3300048910 Bacteria 2166
400 Ga0496107_0145340 3300048910 Bacteria 1753
401 Ga0496108_0015975 3300048911 Bacteria 6119
402 Ga0496109_0001255 3300048912 Bacteria 21059
403 Ga0496109_0148630 3300048912 Bacteria 2193
404 Ga0496110_0027900 3300048913 Bacteria 4843
405 Ga0496110_0787928 3300048913 Bacteria 855
406 Ga0496111_0071160 3300048914 Bacteria 2531
407 Ga0496111_0188163 3300048914 Bacteria 1535
408 Ga0496112_0060927 3300048915 Bacteria 3719
409 Ga0496113_0250811 3300048916 Bacteria 1413
410 Ga0496114_0073220 3300048917 Bacteria 2883
411 Ga0496114_0549089 3300048917 Bacteria 1021
412 Ga0496115_0041008 3300048918 Bacteria 3682
413 Ga0501034_0014783 3300049571 Bacteria 8033
414 Ga0501036_0011861 3300049572 Bacteria 7223
415 Ga0501038_0008516 3300049574 Bacteria 9424
416 Ga0501042_0004814 3300049578 Bacteria 8629
417 Ga0501043_0017466 3300049579 Bacteria 5624
418 Ga0501047_0002506 3300049581 Bacteria 17504
419 Ga0501048_0001507 3300049582 Bacteria 17632
420 Ga0501074_0042608 3300049590 Bacteria 3284
421 Ga0501083_0220352 3300049744 Bacteria 1236
422 Ga0501044_0016663 3300049823 Bacteria 7891
423 nmdc:mga0qj67_116260_c1 3300050509 Bacteria 2161
424 nmdc:mga06r32_245081_c1 3300050510 Bacteria 1779
425 nmdc:mga06r32_98673_c1 3300050510 Bacteria 2864
426 nmdc:mga08y16_27717_c1 3300050511 Bacteria 5969
427 nmdc:mga08y16_841367_c1 3300050511 Bacteria 907
428 nmdc:mga08y16_89609_c1 3300050511 Bacteria 3205
429 nmdc:mga0n895_189119_c1 3300050512 Bacteria 2090
430 nmdc:mga0n895_27975_c1 3300050512 Bacteria 5359
431 nmdc:mga0rr50_196660_c1 3300050513 Bacteria 1655
432 nmdc:mga08x19_15914_c1 3300050514 Bacteria 4582
433 nmdc:mga0a205_43430_c1 3300050515 Bacteria 4334
434 Ga0495601_0109613 3300053077 Bacteria 1787
435 Ga0495601_0239592 3300053077 Bacteria 1184
436 Ga0495612_0012497 3300053078 Bacteria 3423
437 Ga0495612_0015936 3300053078 Bacteria 3011
438 Ga0495595_0080656 3300053084 Bacteria 1549
439 Ga0495619_0373486 3300053085 Bacteria 985
440 Ga0500637_0093443 3300053178 Bacteria 1742
441 Ga0466962_0015026 3300061719 Bacteria 3733
442 Ga0466962_0236970 3300061719 Bacteria 895
443 2676488371 2675903060 Bacteria 10051191
444 2870801997 2870801768 Bacteria 2710986
445 2939583779 2939582691 Bacteria 7088898
446 3002999030 3002998708 Bacteria 11715108
447 8047718340 8047710418 Bacteria 11023148
448 Ga0466958_0197348
449 Ga0070658_10273618
450 Ga0070683_100022659
451 Ga0070683_100104499
452 Ga0070682_100107406
453 Ga0068868_100139852
454 Ga0070689_100198201
455 Ga0070661_100756726
456 Ga0070668_100210613
457 Ga0070659_100239900
458 Ga0070667_100101802
459 Ga0070709_10014309
460 Ga0070709_10035913
461 Ga0070714_100023646
462 Ga0070714_100091093
463 Ga0070714_100098798
464 Ga0070714_100414746
465 Ga0070713_100054534
466 Ga0070713_100072609
467 Ga0070713_100600611
468 Ga0070710_10007967
469 Ga0070710_10044966
470 Ga0070711_100027813
471 Ga0070711_100385825
472 Ga0070700_100187245
473 Ga0070663_100559968
474 Ga0070663_100706933
475 Ga0070685_10075440
476 Ga0070706_100064032
477 Ga0070707_100291154
478 Ga0070698_100130787
479 Ga0070699_100515370
480 Ga0070684_100041836
481 Ga0070684_100268353
482 Ga0070684_100852012
483 Ga0070665_100001102
484 Ga0070664_100209322
485 Ga0070664_100225815
486 Ga0068856_100033907
487 Ga0068856_100134927
488 Ga0068856_100807505
489 Ga0070702_100085291
490 Ga0068852_100192820
491 Ga0068859_100372396
492 Ga0068864_100328631
493 Ga0068866_10188813
494 Ga0068861_100572604
495 Ga0068851_10200583
496 Ga0068860_100051663
497 Ga0081455_10002885
498 Ga0081538_10063627
499 Ga0081539_10004899
500 Ga0081539_10011407
501 Ga0081539_10060256
502 Ga0081539_10163414
503 Ga0070717_10012405
504 Ga0070717_10014227
505 Ga0070717_10110558
506 Ga0070717_10154628
507 Ga0070717_10208186
508 Ga0070717_10231879
509 Ga0070717_10463518
510 Ga0070717_10594283
511 Ga0070716_100077087
512 Ga0070712_100002695
513 Ga0070712_100011848
514 Ga0075428_100152342
515 Ga0075431_100025630
516 Ga0075431_100174849
517 Ga0075431_100366645
518 Ga0075433_10031046
519 Ga0075434_100034391
520 Ga0075436_100014843
521 Ga0075436_100479905
522 Ga0097620_100372409
523 Ga0075435_100088208
524 Ga0111539_10051902
525 Ga0111539_10059883
526 Ga0111539_10204189
527 Ga0111539_10944393
528 Ga0105245_10140285
529 Ga0105247_10265790
530 Ga0114129_10052732
531 Ga0105243_10102611
532 Ga0105243_10707597
533 Ga0105248_10635384
534 Ga0105249_10022136
535 Ga0105246_10295131
536 Ga0157369_10688807
537 Ga0157378_10302817
538 Ga0163162_10121629
539 Ga0163163_10691971
540 Ga0157380_10526875
541 Ga0157380_11299645
542 Ga0157379_11039924
543 Ga0213874_10004419
544 Ga0213874_10022406
545 Ga0213876_10095235
546 Ga0213876_10210525
547 Ga0213875_10015588
548 Ga0213875_10018472
549 Ga0213875_10035522
550 Ga0213875_10035753
551 Ga0213875_10072730
552 Ga0207692_10012385
553 Ga0207692_10047594
554 Ga0207642_10065084
555 Ga0207688_10055117
556 Ga0207699_10011410
557 Ga0207699_10135766
558 Ga0207705_10380185
559 Ga0207705_10496993
560 Ga0207684_10037247
561 Ga0207707_10140689
562 Ga0207693_10004920
563 Ga0207693_10009336
564 Ga0207693_10094901
565 Ga0207663_10011071
566 Ga0207663_10034510
567 Ga0207663_10035354
568 Ga0207663_10541462
569 Ga0207663_10647362
570 Ga0207657_10098683
571 Ga0207657_10332244
572 Ga0207646_10165814
573 Ga0207650_10442987
574 Ga0207687_10360706
575 Ga0207700_10040731
576 Ga0207700_10228308
577 Ga0207664_10025964
578 Ga0207664_10026818
579 Ga0207664_10032387
580 Ga0207664_10042134
581 Ga0207664_10124495
582 Ga0207664_10215227
583 Ga0207664_10427102
584 Ga0207664_10648304
585 Ga0207664_10699809
586 Ga0207690_10117001
587 Ga0207706_10320994
588 Ga0207665_10018368
589 Ga0207661_10412494
590 Ga0207679_10037796
591 Ga0207679_10157236
592 Ga0207712_11001182
593 Ga0207658_10115158
594 Ga0207677_10199132
595 Ga0207677_10294218
596 Ga0207678_10105639
597 Ga0207708_10346536
598 Ga0207702_10027029
599 Ga0207702_10291759
600 Ga0207676_10287351
601 Ga0207675_100178833
602 Ga0207675_100234472
603 Ga0207683_10455882
604 Ga0207698_10096860
605 Ga0207428_10021716
606 Ga0268266_10027911
607 Ga0268266_10049653
608 Ga0268264_10010030
609 Ga0307515_10091610
610 Ga0307509_10285635
611 Ga0307408_100377572
612 Ga0307508_10396066
613 Ga0307405_10021457
614 Ga0307413_10702727
615 Ga0307406_10076376
616 Ga0307406_10089110
617 Ga0307409_100477692
618 Ga0307416_100032222
619 Ga0307416_100487459
620 Ga0307416_101105097
621 Ga0307411_10635958
622 Ga0307415_100000771
623 Ga0307415_100586157
624 Ga0373944_0004931
625 Ga0373923_0016448
626 Ga0373936_0005513
627 Ga0373936_0036689
628 Ga0373945_0042724
629 Ga0373953_0041018
630 Ga0373954_0015803
631 Ga0373956_0001992
632 Ga0373956_0114695
633 Ga0373957_0008451
634 Ga0373957_0061219
635 Ga0373943_0008809
636 Ga0373946_0007674
637 Ga0373955_0189242
638 Ga0373924_0003088
639 Ga0373924_0019446
640 Ga0373924_0072594
641 Ga0373931_0095503
642 Ga0373935_0005175
643 Ga0373935_0038523
644 Ga0373935_0094032
645 Ga0373927_0026010
646 Ga0373933_0014646
647 Ga0373933_0035213
648 Ga0373933_0080836
649 Ga0373933_0180225
650 Ga0373933_0349367
651 Ga0373947_0019117
652 Ga0373947_0066688
653 Ga0373937_0100438
654 Ga0373937_0776861
655 Ga0373925_0058659
656 Ga0373925_0194479
657 Ga0395900_0001878
658 Ga0395898_0004969
659 Ga0436364_0313968
660 Ga0436364_0369788
661 Ga0436364_0390966
662 Ga0436364_0541733
663 Ga0436364_0729730
664 Ga0436364_1008667
665 Ga0436364_1232571
666 Ga0436365_0007367
667 Ga0436365_0259986
668 Ga0436365_0621914
669 Ga0436365_0872734
670 Ga0436365_1186547
671 Ga0436365_1216533
672 Ga0436365_1342420
673 Ga0436365_1421205
674 Ga0436365_1612919
675 Ga0436365_1691212
676 Ga0436360_0202294
677 Ga0436360_0546653
678 Ga0436361_0776560
679 Ga0436361_1162437
680 Ga0436363_0258507
681 Ga0436363_0342616
682 Ga0436363_0498093
683 Ga0436363_0501877
684 Ga0436363_0869304
685 Ga0436363_0928390
686 Ga0436363_0952078
687 Ga0436363_1265842
688 Ga0436363_1714932
689 Ga0436362_0208969
690 Ga0436362_0295887
691 Ga0436362_0313005
692 Ga0436362_0565950
693 Ga0436362_0785100
694 Ga0436362_0819636
695 Ga0436362_0918273
696 Ga0436362_1242770
697 Ga0451839_0189701
698 Ga0439449_0030943
699 Ga0450904_000410
700 Ga0466969_0001191
701 Ga0466969_0026165
702 Ga0466969_0112620
703 Ga0466966_0094237
704 Ga0466966_0412613
705 Ga0466966_0634446
706 Ga0466961_0046205
707 Ga0466961_0088156
708 Ga0466961_0364060
709 Ga0466961_0592547
710 Ga0466963_0000510
711 Ga0466963_0005861
712 Ga0466963_0028448
713 Ga0466963_0047583
714 Ga0466963_0100546
715 Ga0466964_0455476
716 Ga0466971_0033839
717 Ga0466971_0060043
718 Ga0466971_0064879
719 Ga0466971_0216399
720 Ga0466968_0010323
721 Ga0466968_0013206
722 Ga0466968_0088269
723 Ga0466970_0106593
724 Ga0466970_0231306
725 Ga0466957_0151750
726 Ga0466957_0208105
727 Ga0466957_0482533
728 Ga0466960_0042958
729 Ga0466959_0009424
730 Ga0466959_0009641
731 Ga0466959_0028418
732 Ga0466959_0087959
733 Ga0466959_0137199
734 Ga0466959_0193282
735 Ga0466959_0203753
736 Ga0466959_0267341
737 Ga0466959_0290205
738 Ga0466959_0453655
739 Ga0466959_0518767
740 Ga0466959_0533411
741 Ga0466958_0013922
742 Ga0466958_0036723
743 Ga0466958_0058484
744 Ga0466958_0088619
745 Ga0466958_0094015
746 Ga0466958_0101940
747 Ga0466958_0333860
748 Ga0466967_0000478
749 Ga0466967_0051741
750 Ga0466967_0090422
751 Ga0466967_0174203
752 Ga0466967_0274930
753 Ga0466967_0791530
754 Ga0466967_1333493
755 Ga0495592_0028464
756 Ga0495592_0037460
757 Ga0495592_0143915
758 Ga0495629_0008763
759 Ga0495629_0050650
760 Ga0495641_0030029
761 Ga0495641_0079469
762 Ga0495641_0163909
763 Ga0495651_0008070
764 Ga0495653_0016304
765 Ga0495653_0032150
766 Ga0495582_0013704
767 Ga0495639_0012658
768 Ga0495662_0016296
769 Ga0495664_0018774
770 Ga0495664_0030001
771 Ga0495664_0112882
772 Ga0495664_0142185
773 Ga0495664_0423519
774 Ga0495584_0045383
775 Ga0495608_0037667
776 Ga0495618_0042745
777 Ga0495618_0412547
778 Ga0495628_0019212
779 Ga0495628_0218284
780 Ga0495628_0298687
781 Ga0495666_0028390
782 Ga0495652_0028288
783 Ga0495652_0517918
784 Ga0495665_0020603
785 Ga0495640_0023711
786 Ga0495640_0173907
787 Ga0495640_0381485
788 Ga0495587_0256803
789 Ga0495621_0158626
790 Ga0495645_0093389
791 Ga0495645_0106488
792 Ga0495667_0007971
793 Ga0495667_0052923
794 Ga0495667_0067207
795 Ga0495634_0075442
796 Ga0495634_0084616
797 Ga0495635_0296931
798 Ga0495657_0113099
799 Ga0495599_0039556
800 Ga0495599_0126309
801 Ga0495599_0333392
802 Ga0495599_0488952
803 Ga0495646_0044940
804 Ga0495646_0089373
805 Ga0495613_0116833
806 Ga0495613_0225004
807 Ga0495624_0017600
808 Ga0495624_0186369
809 Ga0495600_0022190
810 Ga0495600_0107303
811 Ga0495600_0238554
812 Ga0495581_0013011
813 Ga0495581_0075647
814 Ga0495604_0034053
815 Ga0495604_0279124
816 Ga0495674_0049881
817 Ga0495674_0135080
818 Ga0495676_0039327
819 Ga0495680_0019495
820 Ga0495680_0083211
821 Ga0495680_0096327
822 Ga0495675_0012772
823 Ga0495684_0021457
824 Ga0495593_0015580
825 Ga0495593_0065905
826 Ga0495593_0230678
827 Ga0495602_0031032
828 Ga0495602_0067315
829 Ga0495602_0197165
830 Ga0495614_0053764
831 Ga0496100_0208085
832 Ga0496100_0739203
833 Ga0496101_0014660
834 Ga0496101_0041412
835 Ga0496102_0014547
836 Ga0496103_0100400
837 Ga0496104_0029892
838 Ga0496104_0062840
839 Ga0496104_0661536
840 Ga0496105_0050474
841 Ga0496105_0076415
842 Ga0496106_0012349
843 Ga0496106_0019381
844 Ga0496106_0131626
845 Ga0496107_0022619
846 Ga0496107_0096230
847 Ga0496107_0145340
848 Ga0496108_0015975
849 Ga0496109_0001255
850 Ga0496109_0148630
851 Ga0496110_0027900
852 Ga0496110_0787928
853 Ga0496111_0071160
854 Ga0496111_0188163
855 Ga0496112_0060927
856 Ga0496113_0250811
857 Ga0496114_0073220
858 Ga0496114_0549089
859 Ga0496115_0041008
860 Ga0501034_0014783
861 Ga0501036_0011861
862 Ga0501038_0008516
863 Ga0501042_0004814
864 Ga0501043_0017466
865 Ga0501047_0002506
866 Ga0501048_0001507
867 Ga0501074_0042608
868 Ga0501083_0220352
869 Ga0501044_0016663
870 nmdc:mga0qj67_116260_c1
871 nmdc:mga06r32_245081_c1
872 nmdc:mga06r32_98673_c1
873 nmdc:mga08y16_27717_c1
874 nmdc:mga08y16_841367_c1
875 nmdc:mga08y16_89609_c1
876 nmdc:mga0n895_189119_c1
877 nmdc:mga0n895_27975_c1
878 nmdc:mga0rr50_196660_c1
879 nmdc:mga08x19_15914_c1
880 nmdc:mga0a205_43430_c1
881 Ga0495601_0109613
882 Ga0495601_0239592
883 Ga0495612_0012497
884 Ga0495612_0015936
885 Ga0495595_0080656
886 Ga0495619_0373486
887 Ga0500637_0093443
888 Ga0466962_0015026
889 Ga0466962_0236970
890 2676488371
891 2870801997
892 2939583779
893 3002999030
894 8047718340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

16

126

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9783 1 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9731 2 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9721 1 118
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9708 1 118
6ont-assembly1.cif.gz_A-2 structure of the francisella response regulator 1452 receiver domain 0.964 2 118
ID Description Score Start End Superfamily
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.975 1 80 3.40.50.2300
af_Q2FVQ9_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9678 1 80 3.40.50.2300
2oqrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9659 2 77 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9649 1 80 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9601 2 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A656QF84-F1-model_v4 Transcriptional regulator 0.8788 1 216 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1V6JSW1-F1-model_v4 deleted 0.8749 2 217
AF-A0A656QF84-F1-model_v4 Transcriptional regulator 0.8713 1 216 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1V6JSW1-F1-model_v4 deleted 0.8675 2 217
AF-A0A7U0J252-F1-model_v4 deleted 0.8549 1 216

Map