F445991

General Info

Members Datasets Scaffolds Average Seq Length
447 248 894 133

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0084270|Ga0436364_0084270_233_655
Length 140
Sequence VRTQRGDDDVKFTRSGGRTGPGPSDWFTGAVHIDGIRNPDDQSSVGCAHVRFTPGARTAWHTHPKGQTLYVTDGIGLVATRGGVQEIRPGDVVYIEPGEEHWHGATPDRFMAHVAIQEADDQGEVVTWGDHVTDDEYNQR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
120 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
121 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
122 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
123 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
124 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
127 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
130 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
131 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
132 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
237 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
238 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
239 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
240 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
241 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
242 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
243 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
244 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
245 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
246 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
247 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
248 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.64
Metatranscriptomes 0.45
Isolates 2.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 19.02
Rhizosphere 73.15
Stem 0
Stem Tuber 0
Unclassified 3.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0084270 3300037853 Bacteria 1787
2 Ga0070676_10202413 3300005328 Bacteria 1302
3 Ga0070683_100479423 3300005329 Bacteria 1188
4 Ga0070683_101126356 3300005329 Bacteria 754
5 Ga0070670_101218148 3300005331 Bacteria 688
6 Ga0070666_11293006 3300005335 Unclassified 544
7 Ga0070680_100602272 3300005336 Bacteria 943
8 Ga0070682_100006153 3300005337 Bacteria 6721
9 Ga0070682_100222378 3300005337 Bacteria 1345
10 Ga0070682_100809827 3300005337 Bacteria 762
11 Ga0070682_101291557 3300005337 Bacteria 620
12 Ga0070691_10516699 3300005341 Bacteria 693
13 Ga0070674_100270128 3300005356 Bacteria 1343
14 Ga0070709_10020586 3300005434 Bacteria 3829
15 Ga0070714_100042075 3300005435 Bacteria 3858
16 Ga0070714_101000647 3300005435 Bacteria 813
17 Ga0070701_10057027 3300005438 Bacteria 2046
18 Ga0070711_100641634 3300005439 Bacteria 889
19 Ga0070708_100927068 3300005445 Bacteria 817
20 Ga0070708_101902095 3300005445 Bacteria 551
21 Ga0070663_100064875 3300005455 Unclassified 2641
22 Ga0070698_100258058 3300005471 Bacteria 1675
23 Ga0070699_100080094 3300005518 Bacteria 2846
24 Ga0070679_100546162 3300005530 Bacteria 1102
25 Ga0070679_102163713 3300005530 Bacteria 506
26 Ga0068853_100816023 3300005539 Bacteria 894
27 Ga0070672_100725102 3300005543 Bacteria 871
28 Ga0070686_100056950 3300005544 Bacteria 2509
29 Ga0070686_100852171 3300005544 Bacteria 738
30 Ga0070696_100050836 3300005546 Bacteria 2881
31 Ga0070665_100342986 3300005548 Bacteria 1499
32 Ga0070665_100969067 3300005548 Bacteria 863
33 Ga0070664_100723983 3300005564 Bacteria 928
34 Ga0068857_100566809 3300005577 Bacteria 1071
35 Ga0068856_100026847 3300005614 Bacteria 5615
36 Ga0068856_100087431 3300005614 Bacteria 3099
37 Ga0068856_100187389 3300005614 Bacteria 2083
38 Ga0068856_101264415 3300005614 Bacteria 754
39 Ga0068852_100417067 3300005616 Bacteria 1323
40 Ga0068852_100491415 3300005616 Bacteria 1221
41 Ga0068866_10170835 3300005718 Bacteria 1276
42 Ga0068861_100697004 3300005719 Bacteria 943
43 Ga0068870_10716725 3300005840 Bacteria 692
44 Ga0068863_101539207 3300005841 Unclassified 674
45 Ga0070717_10028986 3300006028 Bacteria 4437
46 Ga0070717_10051566 3300006028 Bacteria 3387
47 Ga0075365_10033496 3300006038 Bacteria 3311
48 Ga0075365_10294396 3300006038 Bacteria 1142
49 Ga0075364_10062596 3300006051 Bacteria 2441
50 Ga0075364_10237106 3300006051 Bacteria 1239
51 Ga0070715_10001883 3300006163 Bacteria 6291
52 Ga0070715_10169011 3300006163 Bacteria 1087
53 Ga0070716_100171087 3300006173 Bacteria 1417
54 Ga0070716_100559593 3300006173 Unclassified 854
55 Ga0070712_100151486 3300006175 Bacteria 1781
56 Ga0070712_100717687 3300006175 Bacteria 853
57 Ga0070712_101031533 3300006175 Bacteria 712
58 Ga0097621_100079289 3300006237 Bacteria 2729
59 Ga0097621_100611862 3300006237 Bacteria 997
60 Ga0068871_100009061 3300006358 Bacteria 7187
61 Ga0068871_100412048 3300006358 Bacteria 1205
62 Ga0075433_10227485 3300006852 Bacteria 1656
63 Ga0075434_101885595 3300006871 Bacteria 604
64 Ga0068865_100398916 3300006881 Bacteria 1126
65 Ga0075436_100058811 3300006914 Bacteria 2655
66 Ga0075435_100100113 3300007076 Bacteria 2401
67 Ga0075435_100407095 3300007076 Bacteria 1170
68 Ga0105244_10003843 3300009036 Bacteria 10583
69 Ga0105245_10018982 3300009098 Bacteria 6018
70 Ga0105245_10044462 3300009098 Bacteria 3964
71 Ga0105243_10148258 3300009148 Bacteria 2010
72 Ga0105243_10173649 3300009148 Bacteria 1869
73 Ga0105243_10368837 3300009148 Bacteria 1324
74 Ga0105243_10414410 3300009148 Bacteria 1255
75 Ga0105243_10427988 3300009148 Bacteria 1236
76 Ga0105242_10227875 3300009176 Bacteria 1668
77 Ga0105248_10824640 3300009177 Bacteria 1047
78 Ga0105238_10336075 3300009551 Bacteria 1498
79 Ga0105238_11977232 3300009551 Bacteria 616
80 Ga0105239_10830827 3300010375 Bacteria 1059
81 Ga0105246_10041560 3300011119 Bacteria 3108
82 Ga0105246_10299794 3300011119 Bacteria 1297
83 Ga0105246_10393212 3300011119 Bacteria 1149
84 Ga0105246_12270027 3300011119 Bacteria 529
85 Ga0157373_10098305 3300013100 Bacteria 2060
86 Ga0157370_10819455 3300013104 Bacteria 846
87 Ga0157369_10050305 3300013105 Bacteria 4514
88 Ga0157369_10336302 3300013105 Bacteria 1569
89 Ga0157378_12261643 3300013297 Unclassified 595
90 Ga0163162_10218570 3300013306 Bacteria 2035
91 Ga0163162_11242143 3300013306 Bacteria 846
92 Ga0157372_10000025 3300013307 Bacteria 195491
93 Ga0157372_10113523 3300013307 Bacteria 3105
94 Ga0157372_10296894 3300013307 Bacteria 1879
95 Ga0157372_11273054 3300013307 Bacteria 849
96 Ga0157372_11509503 3300013307 Bacteria 774
97 Ga0157372_11902931 3300013307 Bacteria 684
98 Ga0157375_10042919 3300013308 Bacteria 4381
99 Ga0157375_10138993 3300013308 Bacteria 2554
100 Ga0157375_10897386 3300013308 Bacteria 1030
101 Ga0157375_11597744 3300013308 Bacteria 771
102 Ga0163163_10209029 3300014325 Bacteria 2000
103 Ga0163163_10279207 3300014325 Bacteria 1722
104 Ga0157380_11331698 3300014326 Bacteria 766
105 Ga0182008_10066939 3300014497 Bacteria 1768
106 Ga0157376_10022686 3300014969 Bacteria 4898
107 Ga0157376_10064754 3300014969 Bacteria 3084
108 Ga0163161_10155890 3300017792 Bacteria 1738
109 Ga0163161_10189690 3300017792 Bacteria 1580
110 Ga0163161_10539868 3300017792 Bacteria 954
111 Ga0206354_10523908 3300020081 Bacteria 684
112 Ga0206354_11011643 3300020081 Bacteria 1389
113 Ga0207682_10063034 3300025893 Unclassified 1556
114 Ga0207692_10081650 3300025898 Bacteria 1730
115 Ga0207642_10306708 3300025899 Bacteria 922
116 Ga0207647_10172589 3300025904 Bacteria 1258
117 Ga0207685_10017757 3300025905 Bacteria 2309
118 Ga0207685_10133951 3300025905 Bacteria 1103
119 Ga0207685_10310990 3300025905 Bacteria 783
120 Ga0207699_10277313 3300025906 Bacteria 1164
121 Ga0207699_10377615 3300025906 Bacteria 1005
122 Ga0207645_10303456 3300025907 Bacteria 1063
123 Ga0207643_10231689 3300025908 Unclassified 1133
124 Ga0207654_10040678 3300025911 Bacteria 2621
125 Ga0207695_10405223 3300025913 Bacteria 1248
126 Ga0207693_10002432 3300025915 Bacteria 16169
127 Ga0207693_10023481 3300025915 Bacteria 4896
128 Ga0207693_10177473 3300025915 Bacteria 1676
129 Ga0207693_10230447 3300025915 Bacteria 1455
130 Ga0207663_10108671 3300025916 Bacteria 1878
131 Ga0207663_10282893 3300025916 Bacteria 1233
132 Ga0207662_10668593 3300025918 Bacteria 726
133 Ga0207659_10137502 3300025926 Bacteria 1893
134 Ga0207700_10032114 3300025928 Bacteria 3740
135 Ga0207664_10009896 3300025929 Bacteria 6715
136 Ga0207664_10586847 3300025929 Bacteria 1000
137 Ga0207686_10880526 3300025934 Unclassified 721
138 Ga0207709_10237508 3300025935 Bacteria 1324
139 Ga0207709_10405095 3300025935 Bacteria 1044
140 Ga0207709_10812618 3300025935 Bacteria 755
141 Ga0207669_11484184 3300025937 Bacteria 578
142 Ga0207665_10002552 3300025939 Bacteria 12233
143 Ga0207665_10072911 3300025939 Bacteria 2347
144 Ga0207661_11228160 3300025944 Bacteria 689
145 Ga0207677_10133173 3300026023 Bacteria 1891
146 Ga0207639_10659979 3300026041 Bacteria 968
147 Ga0207639_11441474 3300026041 Bacteria 646
148 Ga0207678_10424899 3300026067 Unclassified 1153
149 Ga0207702_10110737 3300026078 Bacteria 2441
150 Ga0207648_10593011 3300026089 Bacteria 1021
151 Ga0207648_10685365 3300026089 Bacteria 949
152 Ga0207675_100243359 3300026118 Bacteria 1739
153 Ga0207675_100656250 3300026118 Bacteria 1055
154 Ga0207683_10001247 3300026121 Bacteria 23079
155 Ga0207683_10586369 3300026121 Unclassified 1031
156 Ga0207683_11086393 3300026121 Bacteria 742
157 Ga0207698_10914262 3300026142 Bacteria 885
158 Ga0207698_11855602 3300026142 Bacteria 618
159 Ga0268265_10595305 3300028380 Bacteria 1056
160 Ga0307408_100333222 3300031548 Bacteria 1282
161 Ga0307405_10077151 3300031731 Bacteria 2164
162 Ga0307410_10056507 3300031852 Bacteria 2669
163 Ga0307410_10071437 3300031852 Bacteria 2407
164 Ga0307410_11779329 3300031852 Bacteria 547
165 Ga0307406_10047647 3300031901 Bacteria 2702
166 Ga0307407_10514841 3300031903 Bacteria 879
167 Ga0307412_10480305 3300031911 Bacteria 1030
168 Ga0307409_100605090 3300031995 Bacteria 1084
169 Ga0307409_100940900 3300031995 Bacteria 879
170 Ga0307416_100014523 3300032002 Bacteria 5403
171 Ga0307416_100396018 3300032002 Bacteria 1417
172 Ga0307416_101229578 3300032002 Bacteria 855
173 Ga0307416_102294316 3300032002 Bacteria 640
174 Ga0307411_10366704 3300032005 Bacteria 1180
175 Ga0307415_100148244 3300032126 Bacteria 1802
176 Ga0307415_100782650 3300032126 Bacteria 869
177 Ga0373930_0031670 3300034816 Bacteria 1091
178 Ga0373932_0015009 3300035112 Unclassified 1958
179 Ga0373955_0931109 3300035172 Bacteria 535
180 Ga0373924_0214312 3300035410 Bacteria 850
181 Ga0373924_0291916 3300035410 Bacteria 724
182 Ga0373947_0941178 3300035725 Bacteria 590
183 Ga0373937_0070148 3300036401 Bacteria 3232
184 Ga0373937_1563458 3300036401 Bacteria 607
185 Ga0316584_0828495 3300036712 Bacteria 627
186 Ga0395899_0036087 3300037312 Bacteria 3710
187 Ga0395900_0140217 3300037418 Bacteria 2476
188 Ga0395900_0181150 3300037418 Bacteria 2141
189 Ga0395898_0041570 3300037466 Bacteria 4540
190 Ga0395898_1835753 3300037466 Bacteria 527
191 Ga0395905_0337326 3300037471 Bacteria 1398
192 Ga0395905_1559734 3300037471 Bacteria 565
193 Ga0436364_0396838 3300037853 Bacteria 2023
194 Ga0395901_0064816 3300038443 Bacteria 3803
195 Ga0395901_0110798 3300038443 Bacteria 2882
196 Ga0395901_0185093 3300038443 Bacteria 2184
197 Ga0395901_0334919 3300038443 Bacteria 1564
198 Ga0436365_0271220 3300039437 Bacteria 2016
199 Ga0451791_0801824 3300041451 Bacteria 9209
200 Ga0451791_1161454 3300041451 Bacteria 746
201 Ga0451793_0089090 3300041452 Bacteria 699
202 Ga0451797_0150346 3300041453 Bacteria 1920
203 Ga0451797_0741428 3300041453 Bacteria 2617
204 Ga0451797_1132993 3300041453 Bacteria 710
205 Ga0451797_1289681 3300041453 Bacteria 550
206 Ga0451795_0045740 3300041456 Bacteria 1616
207 Ga0451800_0024912 3300041459 Bacteria 1420
208 Ga0451802_0259548 3300041460 Bacteria 501
209 Ga0451802_1119482 3300041460 Unclassified 518
210 Ga0451807_1126513 3300041486 Bacteria 613
211 Ga0451835_0679999 3300041492 Bacteria 879
212 Ga0451835_1244652 3300041492 Bacteria 677
213 Ga0451837_0868196 3300041494 Bacteria 815
214 Ga0451837_1476930 3300041494 Bacteria 2222
215 Ga0451841_0697120 3300041498 Bacteria 3718
216 Ga0451841_0816943 3300041498 Bacteria 746
217 Ga0451845_0274456 3300041501 Bacteria 981
218 Ga0451849_1120982 3300041505 Bacteria 1591
219 Ga0451851_0661351 3300041507 Bacteria 605
220 Ga0451843_0015741 3300041509 Bacteria 6943
221 Ga0451843_0198918 3300041509 Bacteria 1239
222 Ga0451853_0099109 3300041512 Bacteria 3530
223 Ga0451853_1097122 3300041512 Bacteria 775
224 Ga0466963_0044727 3300044694 Bacteria 2914
225 Ga0466960_0807983 3300044901 Bacteria 568
226 Ga0466967_0025263 3300045976 Bacteria 4897
227 Ga0466967_0047322 3300045976 Bacteria 3749
228 Ga0466967_1403392 3300045976 Bacteria 695
229 Ga0495592_0041335 3300046454 Bacteria 3455
230 Ga0495592_0460255 3300046454 Bacteria 795
231 Ga0495603_0284030 3300046455 Bacteria 951
232 Ga0495629_0031865 3300046459 Bacteria 3733
233 Ga0495629_0264060 3300046459 Bacteria 1183
234 Ga0495629_0278887 3300046459 Bacteria 1147
235 Ga0495641_0141229 3300046461 Bacteria 1076
236 Ga0495651_0023097 3300046462 Bacteria 4837
237 Ga0495651_0075249 3300046462 Bacteria 2560
238 Ga0495651_0520229 3300046462 Bacteria 759
239 Ga0495653_0067943 3300046463 Bacteria 2674
240 Ga0495653_0100775 3300046463 Bacteria 2093
241 Ga0495582_0334821 3300046473 Bacteria 871
242 Ga0495664_0037137 3300046477 Bacteria 2874
243 Ga0495664_0506962 3300046477 Bacteria 720
244 Ga0495608_0022184 3300046511 Bacteria 4351
245 Ga0495608_0372830 3300046511 Bacteria 876
246 Ga0495608_0912131 3300046511 Bacteria 514
247 Ga0495618_0052107 3300046514 Bacteria 2586
248 Ga0495618_0059996 3300046514 Bacteria 2411
249 Ga0495628_0124758 3300046516 Bacteria 1973
250 Ga0495628_0167323 3300046516 Bacteria 1668
251 Ga0495628_0918152 3300046516 Bacteria 607
252 Ga0495630_0392818 3300046517 Bacteria 1063
253 Ga0495644_0016456 3300046523 Bacteria 2831
254 Ga0495652_0099426 3300046529 Bacteria 2362
255 Ga0495652_0110166 3300046529 Bacteria 2215
256 Ga0495652_0153116 3300046529 Bacteria 1799
257 Ga0495640_0028557 3300046533 Bacteria 4015
258 Ga0495640_0112735 3300046533 Unclassified 1775
259 Ga0495640_0715937 3300046533 Bacteria 600
260 Ga0495587_0022655 3300046536 Bacteria 3866
261 Ga0495587_0165521 3300046536 Bacteria 1257
262 Ga0495645_0288625 3300046543 Bacteria 1076
263 Ga0495667_0041332 3300046559 Bacteria 3058
264 Ga0495667_0182457 3300046559 Bacteria 1346
265 Ga0495667_0258263 3300046559 Unclassified 1108
266 Ga0495667_0632333 3300046559 Bacteria 666
267 Ga0495634_0024612 3300046642 Bacteria 4222
268 Ga0495634_0171326 3300046642 Bacteria 1364
269 Ga0495635_0014296 3300046663 Bacteria 5553
270 Ga0495635_0115620 3300046663 Bacteria 1831
271 Ga0495635_0596444 3300046663 Bacteria 721
272 Ga0495657_0523079 3300046675 Bacteria 690
273 Ga0495657_0693088 3300046675 Bacteria 586
274 Ga0495599_0119656 3300046678 Bacteria 1637
275 Ga0495599_0666597 3300046678 Bacteria 602
276 Ga0495623_0139525 3300046679 Bacteria 1444
277 Ga0495646_0032552 3300046680 Bacteria 3245
278 Ga0495646_0038864 3300046680 Bacteria 2936
279 Ga0495658_0194516 3300046683 Bacteria 1262
280 Ga0495613_0094928 3300046689 Bacteria 2158
281 Ga0495613_0115161 3300046689 Bacteria 1935
282 Ga0495624_0311926 3300046690 Archaea 948
283 Ga0495600_0173408 3300046809 Bacteria 1391
284 Ga0495604_0061597 3300047317 Bacteria 2869
285 Ga0495604_0127227 3300047317 Bacteria 1835
286 Ga0495604_0429280 3300047317 Bacteria 866
287 Ga0495674_0033451 3300047319 Bacteria 4657
288 Ga0495674_0398701 3300047319 Bacteria 1111
289 Ga0495676_0120629 3300047321 Bacteria 1908
290 Ga0495676_0902815 3300047321 Unclassified 566
291 Ga0495680_0007931 3300047322 Bacteria 9686
292 Ga0495680_0037978 3300047322 Bacteria 3853
293 Ga0495675_0189946 3300047444 Bacteria 1254
294 Ga0495675_0646825 3300047444 Bacteria 596
295 Ga0495684_0008987 3300047471 Bacteria 7716
296 Ga0495684_0074714 3300047471 Bacteria 2575
297 Ga0495684_1080419 3300047471 Bacteria 504
298 Ga0495602_0082751 3300048088 Bacteria 2692
299 Ga0495602_0541288 3300048088 Bacteria 808
300 Ga0495614_0261380 3300048089 Bacteria 794
301 Ga0495614_0514128 3300048089 Bacteria 571
302 Ga0496100_0034573 3300048903 Bacteria 3173
303 Ga0496100_0185081 3300048903 Bacteria 1508
304 Ga0496100_0380346 3300048903 Bacteria 1072
305 Ga0496100_0738037 3300048903 Bacteria 770
306 Ga0496101_0008192 3300048904 Bacteria 6825
307 Ga0496101_0055967 3300048904 Bacteria 2850
308 Ga0496101_0260795 3300048904 Bacteria 1352
309 Ga0496101_0542968 3300048904 Bacteria 919
310 Ga0496101_0561244 3300048904 Bacteria 903
311 Ga0496101_1131605 3300048904 Unclassified 614
312 Ga0496102_0071403 3300048905 Bacteria 3188
313 Ga0496102_0330840 3300048905 Bacteria 1435
314 Ga0496102_1424283 3300048905 Bacteria 612
315 Ga0496103_0002427 3300048906 Bacteria 11726
316 Ga0496103_0467713 3300048906 Bacteria 808
317 Ga0496104_0039785 3300048907 Bacteria 4403
318 Ga0496104_0047407 3300048907 Bacteria 4050
319 Ga0496104_0146495 3300048907 Bacteria 2267
320 Ga0496104_0182523 3300048907 Bacteria 2009
321 Ga0496104_0222840 3300048907 Bacteria 1798
322 Ga0496104_0302496 3300048907 Bacteria 1512
323 Ga0496104_1414900 3300048907 Bacteria 598
324 Ga0496105_0037890 3300048908 Bacteria 3972
325 Ga0496105_0068503 3300048908 Bacteria 2932
326 Ga0496105_0079009 3300048908 Bacteria 2716
327 Ga0496105_0159308 3300048908 Bacteria 1853
328 Ga0496105_0218209 3300048908 Bacteria 1553
329 Ga0496105_0278518 3300048908 Bacteria 1349
330 Ga0496106_0108744 3300048909 Bacteria 2156
331 Ga0496106_0112847 3300048909 Bacteria 2118
332 Ga0496106_0151157 3300048909 Bacteria 1832
333 Ga0496106_1238848 3300048909 Bacteria 581
334 Ga0496107_0152921 3300048910 Bacteria 1707
335 Ga0496107_0223314 3300048910 Bacteria 1401
336 Ga0496108_0052622 3300048911 Bacteria 3413
337 Ga0496108_0091872 3300048911 Bacteria 2580
338 Ga0496108_0099012 3300048911 Bacteria 2485
339 Ga0496108_0126167 3300048911 Bacteria 2197
340 Ga0496108_0947902 3300048911 Bacteria 737
341 Ga0496109_0017314 3300048912 Bacteria 6314
342 Ga0496109_0103013 3300048912 Bacteria 2649
343 Ga0496109_0307154 3300048912 Bacteria 1496
344 Ga0496109_0846999 3300048912 Bacteria 852
345 Ga0496109_1755600 3300048912 Unclassified 554
346 Ga0496109_1768476 3300048912 Bacteria 551
347 Ga0496109_1994537 3300048912 Bacteria 512
348 Ga0496110_0010833 3300048913 Bacteria 7435
349 Ga0496110_0056218 3300048913 Bacteria 3463
350 Ga0496110_0080453 3300048913 Bacteria 2903
351 Ga0496110_0181617 3300048913 Bacteria 1910
352 Ga0496110_0819303 3300048913 Bacteria 835
353 Ga0496111_0708885 3300048914 Bacteria 732
354 Ga0496111_0844108 3300048914 Bacteria 661
355 Ga0496111_0920028 3300048914 Bacteria 629
356 Ga0496112_0031174 3300048915 Bacteria 5168
357 Ga0496112_0197084 3300048915 Bacteria 1974
358 Ga0496113_0060566 3300048916 Bacteria 2854
359 Ga0496113_0111296 3300048916 Bacteria 2132
360 Ga0496113_0764672 3300048916 Bacteria 769
361 Ga0496114_0021794 3300048917 Bacteria 5215
362 Ga0496114_0039542 3300048917 Bacteria 3902
363 Ga0496114_0156438 3300048917 Bacteria 1979
364 Ga0496114_0228665 3300048917 Bacteria 1634
365 Ga0496114_0334996 3300048917 Bacteria 1338
366 Ga0496114_0587667 3300048917 Bacteria 982
367 Ga0496114_0683004 3300048917 Bacteria 901
368 Ga0496114_0751734 3300048917 Bacteria 852
369 Ga0496114_1077937 3300048917 Bacteria 688
370 Ga0496115_0002395 3300048918 Bacteria 13445
371 Ga0496115_0027593 3300048918 Bacteria 4443
372 Ga0496115_0338139 3300048918 Bacteria 1229
373 Ga0496115_0357882 3300048918 Bacteria 1190
374 Ga0496115_1110380 3300048918 Bacteria 599
375 Ga0496118_0201829 3300048921 Bacteria 1177
376 Ga0496122_0000275 3300048925 Bacteria 114580
377 Ga0496123_0000166 3300048926 Bacteria 131527
378 Ga0496124_0000205 3300048927 Bacteria 116897
379 Ga0501032_0213760 3300049569 Bacteria 1256
380 Ga0501033_0267223 3300049570 Bacteria 1209
381 Ga0501034_0032396 3300049571 Bacteria 5307
382 Ga0501036_0034538 3300049572 Bacteria 4277
383 Ga0501037_0261290 3300049573 Bacteria 1209
384 Ga0501038_0114138 3300049574 Bacteria 2234
385 Ga0501039_0158167 3300049575 Bacteria 1780
386 Ga0501040_0001316 3300049576 Bacteria 15749
387 Ga0501041_0005484 3300049577 Bacteria 7424
388 Ga0501041_0011367 3300049577 Bacteria 5260
389 Ga0501042_0002409 3300049578 Bacteria 11462
390 Ga0501043_0185527 3300049579 Bacteria 1619
391 Ga0501046_0013395 3300049580 Bacteria 6943
392 Ga0501047_0247321 3300049581 Bacteria 1632
393 Ga0501048_0006468 3300049582 Bacteria 8905
394 Ga0501048_0369839 3300049582 Bacteria 1023
395 Ga0501067_0006483 3300049583 Bacteria 6487
396 Ga0501067_0061355 3300049583 Bacteria 2081
397 Ga0501068_0009123 3300049584 Bacteria 5537
398 Ga0501068_0477755 3300049584 Bacteria 807
399 Ga0501069_0087018 3300049585 Bacteria 1764
400 Ga0501070_0011590 3300049586 Bacteria 7444
401 Ga0501070_0295266 3300049586 Bacteria 1321
402 Ga0501071_0303951 3300049587 Bacteria 1209
403 Ga0501072_0002661 3300049588 Bacteria 13389
404 Ga0501073_0256702 3300049589 Bacteria 1206
405 Ga0501074_0195036 3300049590 Bacteria 1443
406 Ga0501075_0094689 3300049591 Bacteria 2266
407 Ga0501076_0026772 3300049592 Bacteria 4469
408 Ga0501077_0030160 3300049593 Bacteria 3450
409 Ga0501079_0000263 3300049741 Bacteria 32250
410 Ga0501080_0228912 3300049742 Bacteria 1699
411 Ga0501081_0014680 3300049743 Bacteria 5167
412 Ga0501083_1135382 3300049744 Bacteria 508
413 Ga0501044_0438978 3300049823 Bacteria 1213
414 Ga0501045_0029915 3300049824 Bacteria 3938
415 Ga0501045_0311571 3300049824 Bacteria 1171
416 nmdc:mga00v17_213746_c1 3300050491 Bacteria 1248
417 nmdc:mga00v17_548370_c1 3300050491 Bacteria 748
418 nmdc:mga0yw44_32740_c1 3300050492 Bacteria 3032
419 nmdc:mga07m45_30685_c1 3300050496 Bacteria 2978
420 nmdc:mga0rr50_184622_c1 3300050513 Bacteria 1706
421 nmdc:mga0rr50_35595_c2 3300050513 Bacteria 2773
422 nmdc:mga08x19_440927_c1 3300050514 Bacteria 916
423 Ga0495601_0123808 3300053077 Bacteria 1681
424 Ga0495601_0205885 3300053077 Bacteria 1285
425 Ga0495612_0071828 3300053078 Bacteria 1444
426 Ga0495612_0292930 3300053078 Bacteria 729
427 Ga0495595_0003308 3300053084 Bacteria 6395
428 Ga0495595_0007692 3300053084 Bacteria 4415
429 Ga0495619_0001685 3300053085 Bacteria 14616
430 Ga0495619_0181516 3300053085 Bacteria 1456
431 Ga0501084_0033806 3300054114 Bacteria 4277
432 Ga0501082_0114943 3300060353 Bacteria 2330
433 Ga0530510_0029811 3300061734 Bacteria 3917
434 Ga0530510_1109123 3300061734 Bacteria 606
435 2523383372 2523231044 Bacteria 6434991
436 2676473377 2675903058 Bacteria 6822861
437 2808828589 2808606357 Bacteria 4466944
438 2808849842 2808606360 Bacteria 4404006
439 2808877574 2808606366 Bacteria 4415912
440 2808899045 2808606371 Bacteria 4251511
441 2812319703 2811994871 Bacteria 4497550
442 2827631887 2827628540 Bacteria 6858585
443 2857482890 2857481737 Bacteria 4761446
444 2904780185 2904776348 Bacteria 4658726
445 2945917439 2945916053 Bacteria 4555517
446 2946061286 2946059875 Bacteria 4386623
447 2974305497 2974302888 Bacteria 4369871
448 Ga0436364_0084270
449 Ga0070676_10202413
450 Ga0070683_100479423
451 Ga0070683_101126356
452 Ga0070670_101218148
453 Ga0070666_11293006
454 Ga0070680_100602272
455 Ga0070682_100006153
456 Ga0070682_100222378
457 Ga0070682_100809827
458 Ga0070682_101291557
459 Ga0070691_10516699
460 Ga0070674_100270128
461 Ga0070709_10020586
462 Ga0070714_100042075
463 Ga0070714_101000647
464 Ga0070701_10057027
465 Ga0070711_100641634
466 Ga0070708_100927068
467 Ga0070708_101902095
468 Ga0070663_100064875
469 Ga0070698_100258058
470 Ga0070699_100080094
471 Ga0070679_100546162
472 Ga0070679_102163713
473 Ga0068853_100816023
474 Ga0070672_100725102
475 Ga0070686_100056950
476 Ga0070686_100852171
477 Ga0070696_100050836
478 Ga0070665_100342986
479 Ga0070665_100969067
480 Ga0070664_100723983
481 Ga0068857_100566809
482 Ga0068856_100026847
483 Ga0068856_100087431
484 Ga0068856_100187389
485 Ga0068856_101264415
486 Ga0068852_100417067
487 Ga0068852_100491415
488 Ga0068866_10170835
489 Ga0068861_100697004
490 Ga0068870_10716725
491 Ga0068863_101539207
492 Ga0070717_10028986
493 Ga0070717_10051566
494 Ga0075365_10033496
495 Ga0075365_10294396
496 Ga0075364_10062596
497 Ga0075364_10237106
498 Ga0070715_10001883
499 Ga0070715_10169011
500 Ga0070716_100171087
501 Ga0070716_100559593
502 Ga0070712_100151486
503 Ga0070712_100717687
504 Ga0070712_101031533
505 Ga0097621_100079289
506 Ga0097621_100611862
507 Ga0068871_100009061
508 Ga0068871_100412048
509 Ga0075433_10227485
510 Ga0075434_101885595
511 Ga0068865_100398916
512 Ga0075436_100058811
513 Ga0075435_100100113
514 Ga0075435_100407095
515 Ga0105244_10003843
516 Ga0105245_10018982
517 Ga0105245_10044462
518 Ga0105243_10148258
519 Ga0105243_10173649
520 Ga0105243_10368837
521 Ga0105243_10414410
522 Ga0105243_10427988
523 Ga0105242_10227875
524 Ga0105248_10824640
525 Ga0105238_10336075
526 Ga0105238_11977232
527 Ga0105239_10830827
528 Ga0105246_10041560
529 Ga0105246_10299794
530 Ga0105246_10393212
531 Ga0105246_12270027
532 Ga0157373_10098305
533 Ga0157370_10819455
534 Ga0157369_10050305
535 Ga0157369_10336302
536 Ga0157378_12261643
537 Ga0163162_10218570
538 Ga0163162_11242143
539 Ga0157372_10000025
540 Ga0157372_10113523
541 Ga0157372_10296894
542 Ga0157372_11273054
543 Ga0157372_11509503
544 Ga0157372_11902931
545 Ga0157375_10042919
546 Ga0157375_10138993
547 Ga0157375_10897386
548 Ga0157375_11597744
549 Ga0163163_10209029
550 Ga0163163_10279207
551 Ga0157380_11331698
552 Ga0182008_10066939
553 Ga0157376_10022686
554 Ga0157376_10064754
555 Ga0163161_10155890
556 Ga0163161_10189690
557 Ga0163161_10539868
558 Ga0206354_10523908
559 Ga0206354_11011643
560 Ga0207682_10063034
561 Ga0207692_10081650
562 Ga0207642_10306708
563 Ga0207647_10172589
564 Ga0207685_10017757
565 Ga0207685_10133951
566 Ga0207685_10310990
567 Ga0207699_10277313
568 Ga0207699_10377615
569 Ga0207645_10303456
570 Ga0207643_10231689
571 Ga0207654_10040678
572 Ga0207695_10405223
573 Ga0207693_10002432
574 Ga0207693_10023481
575 Ga0207693_10177473
576 Ga0207693_10230447
577 Ga0207663_10108671
578 Ga0207663_10282893
579 Ga0207662_10668593
580 Ga0207659_10137502
581 Ga0207700_10032114
582 Ga0207664_10009896
583 Ga0207664_10586847
584 Ga0207686_10880526
585 Ga0207709_10237508
586 Ga0207709_10405095
587 Ga0207709_10812618
588 Ga0207669_11484184
589 Ga0207665_10002552
590 Ga0207665_10072911
591 Ga0207661_11228160
592 Ga0207677_10133173
593 Ga0207639_10659979
594 Ga0207639_11441474
595 Ga0207678_10424899
596 Ga0207702_10110737
597 Ga0207648_10593011
598 Ga0207648_10685365
599 Ga0207675_100243359
600 Ga0207675_100656250
601 Ga0207683_10001247
602 Ga0207683_10586369
603 Ga0207683_11086393
604 Ga0207698_10914262
605 Ga0207698_11855602
606 Ga0268265_10595305
607 Ga0307408_100333222
608 Ga0307405_10077151
609 Ga0307410_10056507
610 Ga0307410_10071437
611 Ga0307410_11779329
612 Ga0307406_10047647
613 Ga0307407_10514841
614 Ga0307412_10480305
615 Ga0307409_100605090
616 Ga0307409_100940900
617 Ga0307416_100014523
618 Ga0307416_100396018
619 Ga0307416_101229578
620 Ga0307416_102294316
621 Ga0307411_10366704
622 Ga0307415_100148244
623 Ga0307415_100782650
624 Ga0373930_0031670
625 Ga0373932_0015009
626 Ga0373955_0931109
627 Ga0373924_0214312
628 Ga0373924_0291916
629 Ga0373947_0941178
630 Ga0373937_0070148
631 Ga0373937_1563458
632 Ga0316584_0828495
633 Ga0395899_0036087
634 Ga0395900_0140217
635 Ga0395900_0181150
636 Ga0395898_0041570
637 Ga0395898_1835753
638 Ga0395905_0337326
639 Ga0395905_1559734
640 Ga0436364_0396838
641 Ga0395901_0064816
642 Ga0395901_0110798
643 Ga0395901_0185093
644 Ga0395901_0334919
645 Ga0436365_0271220
646 Ga0451791_0801824
647 Ga0451791_1161454
648 Ga0451793_0089090
649 Ga0451797_0150346
650 Ga0451797_0741428
651 Ga0451797_1132993
652 Ga0451797_1289681
653 Ga0451795_0045740
654 Ga0451800_0024912
655 Ga0451802_0259548
656 Ga0451802_1119482
657 Ga0451807_1126513
658 Ga0451835_0679999
659 Ga0451835_1244652
660 Ga0451837_0868196
661 Ga0451837_1476930
662 Ga0451841_0697120
663 Ga0451841_0816943
664 Ga0451845_0274456
665 Ga0451849_1120982
666 Ga0451851_0661351
667 Ga0451843_0015741
668 Ga0451843_0198918
669 Ga0451853_0099109
670 Ga0451853_1097122
671 Ga0466963_0044727
672 Ga0466960_0807983
673 Ga0466967_0025263
674 Ga0466967_0047322
675 Ga0466967_1403392
676 Ga0495592_0041335
677 Ga0495592_0460255
678 Ga0495603_0284030
679 Ga0495629_0031865
680 Ga0495629_0264060
681 Ga0495629_0278887
682 Ga0495641_0141229
683 Ga0495651_0023097
684 Ga0495651_0075249
685 Ga0495651_0520229
686 Ga0495653_0067943
687 Ga0495653_0100775
688 Ga0495582_0334821
689 Ga0495664_0037137
690 Ga0495664_0506962
691 Ga0495608_0022184
692 Ga0495608_0372830
693 Ga0495608_0912131
694 Ga0495618_0052107
695 Ga0495618_0059996
696 Ga0495628_0124758
697 Ga0495628_0167323
698 Ga0495628_0918152
699 Ga0495630_0392818
700 Ga0495644_0016456
701 Ga0495652_0099426
702 Ga0495652_0110166
703 Ga0495652_0153116
704 Ga0495640_0028557
705 Ga0495640_0112735
706 Ga0495640_0715937
707 Ga0495587_0022655
708 Ga0495587_0165521
709 Ga0495645_0288625
710 Ga0495667_0041332
711 Ga0495667_0182457
712 Ga0495667_0258263
713 Ga0495667_0632333
714 Ga0495634_0024612
715 Ga0495634_0171326
716 Ga0495635_0014296
717 Ga0495635_0115620
718 Ga0495635_0596444
719 Ga0495657_0523079
720 Ga0495657_0693088
721 Ga0495599_0119656
722 Ga0495599_0666597
723 Ga0495623_0139525
724 Ga0495646_0032552
725 Ga0495646_0038864
726 Ga0495658_0194516
727 Ga0495613_0094928
728 Ga0495613_0115161
729 Ga0495624_0311926
730 Ga0495600_0173408
731 Ga0495604_0061597
732 Ga0495604_0127227
733 Ga0495604_0429280
734 Ga0495674_0033451
735 Ga0495674_0398701
736 Ga0495676_0120629
737 Ga0495676_0902815
738 Ga0495680_0007931
739 Ga0495680_0037978
740 Ga0495675_0189946
741 Ga0495675_0646825
742 Ga0495684_0008987
743 Ga0495684_0074714
744 Ga0495684_1080419
745 Ga0495602_0082751
746 Ga0495602_0541288
747 Ga0495614_0261380
748 Ga0495614_0514128
749 Ga0496100_0034573
750 Ga0496100_0185081
751 Ga0496100_0380346
752 Ga0496100_0738037
753 Ga0496101_0008192
754 Ga0496101_0055967
755 Ga0496101_0260795
756 Ga0496101_0542968
757 Ga0496101_0561244
758 Ga0496101_1131605
759 Ga0496102_0071403
760 Ga0496102_0330840
761 Ga0496102_1424283
762 Ga0496103_0002427
763 Ga0496103_0467713
764 Ga0496104_0039785
765 Ga0496104_0047407
766 Ga0496104_0146495
767 Ga0496104_0182523
768 Ga0496104_0222840
769 Ga0496104_0302496
770 Ga0496104_1414900
771 Ga0496105_0037890
772 Ga0496105_0068503
773 Ga0496105_0079009
774 Ga0496105_0159308
775 Ga0496105_0218209
776 Ga0496105_0278518
777 Ga0496106_0108744
778 Ga0496106_0112847
779 Ga0496106_0151157
780 Ga0496106_1238848
781 Ga0496107_0152921
782 Ga0496107_0223314
783 Ga0496108_0052622
784 Ga0496108_0091872
785 Ga0496108_0099012
786 Ga0496108_0126167
787 Ga0496108_0947902
788 Ga0496109_0017314
789 Ga0496109_0103013
790 Ga0496109_0307154
791 Ga0496109_0846999
792 Ga0496109_1755600
793 Ga0496109_1768476
794 Ga0496109_1994537
795 Ga0496110_0010833
796 Ga0496110_0056218
797 Ga0496110_0080453
798 Ga0496110_0181617
799 Ga0496110_0819303
800 Ga0496111_0708885
801 Ga0496111_0844108
802 Ga0496111_0920028
803 Ga0496112_0031174
804 Ga0496112_0197084
805 Ga0496113_0060566
806 Ga0496113_0111296
807 Ga0496113_0764672
808 Ga0496114_0021794
809 Ga0496114_0039542
810 Ga0496114_0156438
811 Ga0496114_0228665
812 Ga0496114_0334996
813 Ga0496114_0587667
814 Ga0496114_0683004
815 Ga0496114_0751734
816 Ga0496114_1077937
817 Ga0496115_0002395
818 Ga0496115_0027593
819 Ga0496115_0338139
820 Ga0496115_0357882
821 Ga0496115_1110380
822 Ga0496118_0201829
823 Ga0496122_0000275
824 Ga0496123_0000166
825 Ga0496124_0000205
826 Ga0501032_0213760
827 Ga0501033_0267223
828 Ga0501034_0032396
829 Ga0501036_0034538
830 Ga0501037_0261290
831 Ga0501038_0114138
832 Ga0501039_0158167
833 Ga0501040_0001316
834 Ga0501041_0005484
835 Ga0501041_0011367
836 Ga0501042_0002409
837 Ga0501043_0185527
838 Ga0501046_0013395
839 Ga0501047_0247321
840 Ga0501048_0006468
841 Ga0501048_0369839
842 Ga0501067_0006483
843 Ga0501067_0061355
844 Ga0501068_0009123
845 Ga0501068_0477755
846 Ga0501069_0087018
847 Ga0501070_0011590
848 Ga0501070_0295266
849 Ga0501071_0303951
850 Ga0501072_0002661
851 Ga0501073_0256702
852 Ga0501074_0195036
853 Ga0501075_0094689
854 Ga0501076_0026772
855 Ga0501077_0030160
856 Ga0501079_0000263
857 Ga0501080_0228912
858 Ga0501081_0014680
859 Ga0501083_1135382
860 Ga0501044_0438978
861 Ga0501045_0029915
862 Ga0501045_0311571
863 nmdc:mga00v17_213746_c1
864 nmdc:mga00v17_548370_c1
865 nmdc:mga0yw44_32740_c1
866 nmdc:mga07m45_30685_c1
867 nmdc:mga0rr50_184622_c1
868 nmdc:mga0rr50_35595_c2
869 nmdc:mga08x19_440927_c1
870 Ga0495601_0123808
871 Ga0495601_0205885
872 Ga0495612_0071828
873 Ga0495612_0292930
874 Ga0495595_0003308
875 Ga0495595_0007692
876 Ga0495619_0001685
877 Ga0495619_0181516
878 Ga0501084_0033806
879 Ga0501082_0114943
880 Ga0530510_0029811
881 Ga0530510_1109123
882 2523383372
883 2676473377
884 2808828589
885 2808849842
886 2808877574
887 2808899045
888 2812319703
889 2827631887
890 2857482890
891 2904780185
892 2945917439
893 2946061286
894 2974305497

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

48

116

0.92

PF02311

AraC_binding

AraC-like ligand binding domain

45

133

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f4p-assembly2.cif.gz_C crystal structure of a cupin-like protein (tm1010) from thermotoga maritima msb8 at 1.90 a resolution 0.9432 11 129
4bif-assembly2.cif.gz_H biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria 0.9388 1 129
4uxa-assembly3.cif.gz_R improved variant of (r)-selective manganese-dependent hydroxynitrile lyase from bacteria 0.9354 1 129
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.9322 22 112
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.8826 36 108
ID Description Score Start End Superfamily
4bifA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9248 1 129 2.60.120.10
2f4pA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.913 11 129 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9038 36 108 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8817 35 108 2.60.120.10
1sfnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8742 22 112 2.60.120.10
ID Description Score Start End GO Terms
AF-B7RLW8-F1-model_v4 Cupin type-2 domain-containing protein 0.9977 34 129
AF-A0A659YKM7-F1-model_v4 deleted 0.996 40 126
AF-A0A527ZL51-F1-model_v4 Cupin domain-containing protein 0.9939 34 131
AF-A0A4Q6DG11-F1-model_v4 deleted 0.992 36 130
AF-A0A4Q3QCU4-F1-model_v4 deleted 0.9913 33 130

Map