F445990

General Info

Members Datasets Scaffolds Average Seq Length
447 254 894 217

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0043881|Ga0373927_0043881_1421_2137
Length 238
Sequence VAANDRHNNQLSGEDTMASRIGLRLLAAAALTGLGLTAGVHAQQAGMTFFVTSVGKGNGADLGGLDGADAHCAALAKAAGATSTNWRAYLSTTAPGGDAGVNARDRIGKGPWQNAKGVVVAKSVDDLHSASVNVTKQTALTEKGEVISGSGDPVNTHDILTGSDPQGMYSTAGGDTTCGNWTKSGEGSAIVGHHDRAGLKKETRHMKSWNSSHGSRGCSQDLLKASGGAGLIYCFVAN

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 4.03
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0043881 3300035695 Bacteria 2894
2 JGI25405J52794_10025037 3300003911 Bacteria 1222
3 Ga0065712_10186487 3300005290 Bacteria 1168
4 Ga0070658_10377896 3300005327 Bacteria 1215
5 Ga0070676_10042733 3300005328 Bacteria 2633
6 Ga0070690_100118947 3300005330 Bacteria 1771
7 Ga0070690_100181373 3300005330 Bacteria 1455
8 Ga0070670_100055240 3300005331 Bacteria 3409
9 Ga0070670_100099467 3300005331 Bacteria 2503
10 Ga0070666_10288651 3300005335 Bacteria 1167
11 Ga0070682_100141224 3300005337 Bacteria 1642
12 Ga0068868_100118055 3300005338 Bacteria 2161
13 Ga0070660_100134041 3300005339 Bacteria 1984
14 Ga0070689_100169061 3300005340 Bacteria 1771
15 Ga0070691_10100380 3300005341 Bacteria 1437
16 Ga0070691_10205978 3300005341 Bacteria 1035
17 Ga0070687_100088012 3300005343 Bacteria 1711
18 Ga0070668_100112046 3300005347 Bacteria 2172
19 Ga0070675_100080845 3300005354 Bacteria 2709
20 Ga0070675_100452622 3300005354 Bacteria 1151
21 Ga0070671_100090189 3300005355 Bacteria 2566
22 Ga0070671_100675831 3300005355 Bacteria 895
23 Ga0070673_100011272 3300005364 Bacteria 6097
24 Ga0070673_100266391 3300005364 Bacteria 1498
25 Ga0070673_100418290 3300005364 Bacteria 1201
26 Ga0070688_100057867 3300005365 Bacteria 2439
27 Ga0070659_100062020 3300005366 Bacteria 2954
28 Ga0070667_100164930 3300005367 Bacteria 1953
29 Ga0070709_10055105 3300005434 Bacteria 2509
30 Ga0070709_10638883 3300005434 Bacteria 823
31 Ga0070714_100045560 3300005435 Bacteria 3717
32 Ga0070714_100198926 3300005435 Bacteria 1832
33 Ga0070713_100029862 3300005436 Bacteria 4322
34 Ga0070713_100052557 3300005436 Bacteria 3374
35 Ga0070713_100056810 3300005436 Bacteria 3256
36 Ga0070713_100231162 3300005436 Bacteria 1681
37 Ga0070713_100264125 3300005436 Unclassified 1574
38 Ga0070713_100387500 3300005436 Unclassified 1303
39 Ga0070710_10023508 3300005437 Bacteria 3241
40 Ga0070710_10174836 3300005437 Bacteria 1340
41 Ga0070701_10231613 3300005438 Bacteria 1107
42 Ga0070711_100079640 3300005439 Bacteria 2330
43 Ga0070711_100287606 3300005439 Bacteria 1303
44 Ga0070711_100825020 3300005439 Bacteria 788
45 Ga0070700_100264696 3300005441 Bacteria 1239
46 Ga0070694_100048868 3300005444 Bacteria 2847
47 Ga0070663_100041999 3300005455 Bacteria 3211
48 Ga0070678_100247473 3300005456 Bacteria 1493
49 Ga0070678_100317666 3300005456 Bacteria 1329
50 Ga0070662_100204217 3300005457 Unclassified 1569
51 Ga0070685_10031425 3300005466 Bacteria 2966
52 Ga0070706_100245908 3300005467 Bacteria 1670
53 Ga0070707_100484371 3300005468 Bacteria 1198
54 Ga0070698_100262425 3300005471 Bacteria 1660
55 Ga0070684_100593192 3300005535 Bacteria 1030
56 Ga0070672_100133493 3300005543 Bacteria 2042
57 Ga0070686_100149450 3300005544 Bacteria 1634
58 Ga0070686_100311934 3300005544 Bacteria 1170
59 Ga0070695_100060611 3300005545 Bacteria 2452
60 Ga0070664_100314530 3300005564 Bacteria 1418
61 Ga0068856_100094668 3300005614 Bacteria 2974
62 Ga0070702_100166356 3300005615 Bacteria 1430
63 Ga0068852_100424519 3300005616 Unclassified 1312
64 Ga0068859_100608378 3300005617 Bacteria 1186
65 Ga0068866_10201469 3300005718 Bacteria 1189
66 Ga0068861_100212738 3300005719 Bacteria 1629
67 Ga0068861_100318431 3300005719 Bacteria 1354
68 Ga0068863_100789643 3300005841 Bacteria 947
69 Ga0068860_100362255 3300005843 Bacteria 1429
70 Ga0081455_10000776 3300005937 Bacteria 41109
71 Ga0081455_10018562 3300005937 Bacteria 6618
72 Ga0070717_10201667 3300006028 Bacteria 1743
73 Ga0070717_10421776 3300006028 Bacteria 1200
74 Ga0070717_10465321 3300006028 Unclassified 1141
75 Ga0070715_10123374 3300006163 Unclassified 1238
76 Ga0070715_10161742 3300006163 Bacteria 1107
77 Ga0070716_100181550 3300006173 Bacteria 1382
78 Ga0070716_100409069 3300006173 Bacteria 978
79 Ga0070712_100031703 3300006175 Unclassified 3563
80 Ga0070712_100056122 3300006175 Bacteria 2761
81 Ga0070712_100115207 3300006175 Archaea 2014
82 Ga0075366_10018402 3300006195 Bacteria 4032
83 Ga0075428_100264518 3300006844 Bacteria 1851
84 Ga0075428_100341960 3300006844 Bacteria 1606
85 Ga0075428_100671314 3300006844 Bacteria 1105
86 Ga0075428_100846880 3300006844 Bacteria 971
87 Ga0075430_100032509 3300006846 Bacteria 4430
88 Ga0075430_100334567 3300006846 Bacteria 1251
89 Ga0075431_100154812 3300006847 Bacteria 2359
90 Ga0075431_100208844 3300006847 Bacteria 1995
91 Ga0075433_10176668 3300006852 Bacteria 1900
92 Ga0075433_10564805 3300006852 Bacteria 1000
93 Ga0075434_100789719 3300006871 Bacteria 966
94 Ga0075429_100201539 3300006880 Bacteria 1743
95 Ga0068865_100180447 3300006881 Bacteria 1625
96 Ga0068865_100548982 3300006881 Bacteria 970
97 Ga0075436_100003242 3300006914 Bacteria 11147
98 Ga0075436_100027490 3300006914 Bacteria 3915
99 Ga0075436_100093997 3300006914 Bacteria 2085
100 Ga0097620_100608399 3300006931 Bacteria 1186
101 Ga0075435_100071836 3300007076 Bacteria 2827
102 Ga0075435_100146023 3300007076 Bacteria 1987
103 Ga0075435_100193335 3300007076 Bacteria 1723
104 Ga0075435_100469907 3300007076 Bacteria 1086
105 Ga0099794_10020478 3300007265 Bacteria 2994
106 Ga0099794_10024539 3300007265 Bacteria 2769
107 Ga0099794_10037290 3300007265 Bacteria 2300
108 Ga0099794_10251892 3300007265 Bacteria 911
109 Ga0105240_10096425 3300009093 Bacteria 3604
110 Ga0111539_10694160 3300009094 Bacteria 1185
111 Ga0111539_11127019 3300009094 Bacteria 912
112 Ga0105245_10261052 3300009098 Bacteria 1686
113 Ga0105247_10100676 3300009101 Bacteria 1847
114 Ga0105247_10245746 3300009101 Bacteria 1221
115 Ga0114129_10134518 3300009147 Bacteria 3393
116 Ga0114129_10207453 3300009147 Bacteria 2651
117 Ga0114129_10270909 3300009147 Bacteria 2271
118 Ga0114129_10760338 3300009147 Bacteria 1240
119 Ga0105243_10035825 3300009148 Bacteria 3848
120 Ga0105242_10174960 3300009176 Bacteria 1889
121 Ga0105248_10021074 3300009177 Bacteria 7222
122 Ga0105237_10345152 3300009545 Bacteria 1493
123 Ga0105238_10128554 3300009551 Bacteria 2512
124 Ga0105249_10336976 3300009553 Bacteria 1524
125 Ga0105239_10209374 3300010375 Bacteria 2185
126 Ga0105246_10207432 3300011119 Bacteria 1527
127 Ga0157315_1005690 3300012508 Bacteria 946
128 Ga0157369_10708366 3300013105 Bacteria 1036
129 Ga0157378_10305345 3300013297 Bacteria 1541
130 Ga0157378_10584988 3300013297 Bacteria 1126
131 Ga0163162_10259781 3300013306 Bacteria 1868
132 Ga0163162_10276881 3300013306 Bacteria 1810
133 Ga0163163_10095158 3300014325 Bacteria 2998
134 Ga0157380_10096008 3300014326 Bacteria 2457
135 Ga0157380_10292268 3300014326 Bacteria 1497
136 Ga0157377_10212033 3300014745 Bacteria 1235
137 Ga0157376_10091853 3300014969 Bacteria 2630
138 Ga0163161_10105006 3300017792 Bacteria 2107
139 Ga0213872_10115777 3300021361 Bacteria 1188
140 Ga0213876_10024232 3300021384 Bacteria 3203
141 Ga0213875_10000003 3300021388 Bacteria 719367
142 Ga0207692_10057249 3300025898 Bacteria 2003
143 Ga0207692_10123893 3300025898 Bacteria 1451
144 Ga0207692_10173279 3300025898 Bacteria 1252
145 Ga0207710_10256303 3300025900 Bacteria 876
146 Ga0207688_10003040 3300025901 Bacteria 9143
147 Ga0207685_10034603 3300025905 Bacteria 1837
148 Ga0207685_10096221 3300025905 Bacteria 1257
149 Ga0207685_10119055 3300025905 Bacteria 1156
150 Ga0207685_10153746 3300025905 Unclassified 1044
151 Ga0207699_10225209 3300025906 Bacteria 1282
152 Ga0207699_10673584 3300025906 Bacteria 756
153 Ga0207645_10068760 3300025907 Bacteria 2265
154 Ga0207645_10112143 3300025907 Bacteria 1766
155 Ga0207643_10215193 3300025908 Bacteria 1174
156 Ga0207684_10079157 3300025910 Unclassified 2796
157 Ga0207695_10011331 3300025913 Bacteria 10807
158 Ga0207695_10014839 3300025913 Bacteria 9202
159 Ga0207671_10536129 3300025914 Bacteria 933
160 Ga0207693_10008732 3300025915 Bacteria 8282
161 Ga0207693_10037505 3300025915 Unclassified 3820
162 Ga0207693_10062415 3300025915 Bacteria 2919
163 Ga0207693_10278566 3300025915 Bacteria 1310
164 Ga0207693_10582169 3300025915 Unclassified 872
165 Ga0207663_10081535 3300025916 Bacteria 2119
166 Ga0207663_10275640 3300025916 Unclassified 1248
167 Ga0207663_10374330 3300025916 Bacteria 1083
168 Ga0207657_10094680 3300025919 Bacteria 2486
169 Ga0207646_10539769 3300025922 Bacteria 1049
170 Ga0207681_10387881 3300025923 Bacteria 1126
171 Ga0207681_10615969 3300025923 Bacteria 898
172 Ga0207650_10053501 3300025925 Bacteria 2992
173 Ga0207659_10151443 3300025926 Bacteria 1812
174 Ga0207659_10183533 3300025926 Bacteria 1660
175 Ga0207659_10512918 3300025926 Bacteria 1016
176 Ga0207687_10097273 3300025927 Bacteria 2159
177 Ga0207700_10036988 3300025928 Bacteria 3531
178 Ga0207700_10079902 3300025928 Bacteria 2548
179 Ga0207700_10160519 3300025928 Bacteria 1867
180 Ga0207700_10308845 3300025928 Bacteria 1367
181 Ga0207700_10554440 3300025928 Bacteria 1020
182 Ga0207664_10151627 3300025929 Bacteria 1970
183 Ga0207664_10470427 3300025929 Bacteria 1123
184 Ga0207644_10001309 3300025931 Bacteria 16018
185 Ga0207644_10128663 3300025931 Unclassified 1936
186 Ga0207644_10306516 3300025931 Bacteria 1281
187 Ga0207690_10060077 3300025932 Bacteria 2578
188 Ga0207690_10307614 3300025932 Bacteria 1242
189 Ga0207706_10086725 3300025933 Bacteria 2752
190 Ga0207686_10068330 3300025934 Bacteria 2276
191 Ga0207686_10505564 3300025934 Bacteria 938
192 Ga0207709_10148270 3300025935 Bacteria 1622
193 Ga0207669_10254175 3300025937 Bacteria 1310
194 Ga0207665_10156079 3300025939 Bacteria 1638
195 Ga0207665_10167637 3300025939 Bacteria 1584
196 Ga0207665_10429615 3300025939 Bacteria 1010
197 Ga0207691_10011266 3300025940 Bacteria 8578
198 Ga0207711_10092920 3300025941 Bacteria 2656
199 Ga0207689_10009592 3300025942 Bacteria 8346
200 Ga0207679_10487620 3300025945 Bacteria 1098
201 Ga0207651_10025083 3300025960 Bacteria 3701
202 Ga0207651_10048355 3300025960 Bacteria 2875
203 Ga0207639_10288363 3300026041 Bacteria 1446
204 Ga0207678_10016350 3300026067 Bacteria 6514
205 Ga0207708_10010832 3300026075 Bacteria 6782
206 Ga0207708_10196425 3300026075 Bacteria 1608
207 Ga0207702_10477635 3300026078 Bacteria 1213
208 Ga0207702_10594302 3300026078 Bacteria 1085
209 Ga0207648_10036518 3300026089 Bacteria 4329
210 Ga0207648_10188233 3300026089 Bacteria 1828
211 Ga0207676_10095399 3300026095 Unclassified 2453
212 Ga0207674_10526867 3300026116 Bacteria 1141
213 Ga0207675_100010832 3300026118 Bacteria 8542
214 Ga0207675_100504046 3300026118 Bacteria 1205
215 Ga0207683_10072927 3300026121 Bacteria 3037
216 Ga0207683_10644535 3300026121 Bacteria 981
217 Ga0209996_1016207 3300027395 Bacteria 1022
218 Ga0209588_1030010 3300027671 Bacteria 1736
219 Ga0268265_10712522 3300028380 Bacteria 971
220 Ga0268264_10090882 3300028381 Bacteria 2632
221 Ga0373958_0031555 3300034819 Bacteria 1042
222 Ga0373938_0026728 3300034957 Bacteria 1209
223 Ga0373938_0071261 3300034957 Bacteria 831
224 Ga0373926_0069526 3300035083 Bacteria 1292
225 Ga0373928_0048641 3300035084 Bacteria 995
226 Ga0373929_0017056 3300035085 Bacteria 1430
227 Ga0373934_0207334 3300035086 Bacteria 807
228 Ga0373923_0311768 3300035111 Bacteria 746
229 Ga0373936_0051077 3300035113 Bacteria 1673
230 Ga0373941_0042518 3300035115 Bacteria 1411
231 Ga0373945_0257460 3300035116 Bacteria 738
232 Ga0373954_0246706 3300035118 Unclassified 879
233 Ga0373956_0019616 3300035119 Bacteria 2869
234 Ga0373957_0214915 3300035120 Bacteria 804
235 Ga0373943_0014716 3300035170 Bacteria 3547
236 Ga0373955_0056997 3300035172 Bacteria 2145
237 Ga0373955_0330523 3300035172 Bacteria 922
238 Ga0373924_0017812 3300035410 Bacteria 2731
239 Ga0373931_0000872 3300035691 Bacteria 12734
240 Ga0373935_0046572 3300035692 Bacteria 2739
241 Ga0373927_0016857 3300035695 Bacteria 4817
242 Ga0373927_0086130 3300035695 Bacteria 2039
243 Ga0373927_0097922 3300035695 Bacteria 1907
244 Ga0373933_0006242 3300035724 Bacteria 6488
245 Ga0373933_0031999 3300035724 Bacteria 3055
246 Ga0373933_0476209 3300035724 Bacteria 817
247 Ga0373947_0018254 3300035725 Bacteria 4037
248 Ga0373947_0020870 3300035725 Bacteria 3787
249 Ga0373947_0246479 3300035725 Bacteria 1180
250 Ga0373947_0365075 3300035725 Bacteria 970
251 Ga0373937_0026714 3300036401 Bacteria 5216
252 Ga0373937_0070817 3300036401 Bacteria 3216
253 Ga0373937_0677637 3300036401 Bacteria 977
254 Ga0373925_0027323 3300037068 Bacteria 4178
255 Ga0373925_0623530 3300037068 Bacteria 888
256 Ga0436364_0624552 3300037853 Bacteria 3142
257 Ga0436364_1376863 3300037853 Bacteria 5130
258 Ga0436365_0133200 3300039437 Bacteria 1374
259 Ga0436365_1293158 3300039437 Bacteria 4328
260 Ga0436365_1354233 3300039437 Unclassified 2349
261 Ga0436360_0456676 3300039438 Bacteria 2046
262 Ga0436360_0637626 3300039438 Bacteria 3533
263 Ga0436361_0752913 3300039447 Bacteria 1860
264 Ga0436361_1058341 3300039447 Bacteria 1130
265 Ga0436363_1368139 3300039450 Unclassified 910
266 Ga0451576_0329655 3300045051 Bacteria 1598
267 Ga0495592_0028000 3300046454 Bacteria 4268
268 Ga0495592_0189355 3300046454 Bacteria 1395
269 Ga0495629_0006045 3300046459 Bacteria 8999
270 Ga0495629_0191439 3300046459 Bacteria 1416
271 Ga0495629_0198995 3300046459 Bacteria 1385
272 Ga0495641_0009746 3300046461 Bacteria 5670
273 Ga0495641_0020710 3300046461 Bacteria 3326
274 Ga0495651_0008454 3300046462 Bacteria 7889
275 Ga0495651_0061065 3300046462 Bacteria 2885
276 Ga0495653_0011683 3300046463 Bacteria 7165
277 Ga0495653_0017244 3300046463 Bacteria 5873
278 Ga0495580_0190831 3300046472 Bacteria 1413
279 Ga0495605_0066338 3300046474 Bacteria 1715
280 Ga0495639_0101277 3300046475 Bacteria 1360
281 Ga0495662_0032416 3300046476 Bacteria 2524
282 Ga0495662_0139997 3300046476 Bacteria 1191
283 Ga0495664_0039061 3300046477 Bacteria 2804
284 Ga0495664_0083687 3300046477 Bacteria 1914
285 Ga0495584_0026408 3300046491 Bacteria 2942
286 Ga0495584_0187866 3300046491 Bacteria 1050
287 Ga0495585_0009802 3300046492 Bacteria 5730
288 Ga0495596_0084397 3300046500 Bacteria 1233
289 Ga0495608_0006748 3300046511 Bacteria 8139
290 Ga0495608_0014485 3300046511 Bacteria 5470
291 Ga0495608_0214582 3300046511 Bacteria 1209
292 Ga0495608_0229375 3300046511 Unclassified 1163
293 Ga0495618_0003343 3300046514 Bacteria 10011
294 Ga0495618_0006847 3300046514 Bacteria 6907
295 Ga0495618_0370968 3300046514 Bacteria 879
296 Ga0495628_0041066 3300046516 Bacteria 3693
297 Ga0495628_0212243 3300046516 Bacteria 1456
298 Ga0495628_0293247 3300046516 Unclassified 1205
299 Ga0495628_0549452 3300046516 Bacteria 829
300 Ga0495630_0073023 3300046517 Bacteria 2583
301 Ga0495630_0286544 3300046517 Bacteria 1259
302 Ga0495663_0194190 3300046525 Bacteria 707
303 Ga0495666_0267454 3300046526 Bacteria 777
304 Ga0495652_0009760 3300046529 Bacteria 8708
305 Ga0495652_0027745 3300046529 Bacteria 4987
306 Ga0495652_0130056 3300046529 Bacteria 1994
307 Ga0495652_0221583 3300046529 Bacteria 1421
308 Ga0495665_0188606 3300046531 Bacteria 1070
309 Ga0495665_0194245 3300046531 Bacteria 1053
310 Ga0495640_0036373 3300046533 Bacteria 3479
311 Ga0495640_0127604 3300046533 Bacteria 1648
312 Ga0495640_0158822 3300046533 Bacteria 1450
313 Ga0495587_0003209 3300046536 Bacteria 10928
314 Ga0495587_0008356 3300046536 Bacteria 6660
315 Ga0495587_0175821 3300046536 Bacteria 1215
316 Ga0495587_0332940 3300046536 Bacteria 847
317 Ga0495609_0261732 3300046538 Bacteria 711
318 Ga0495645_0030279 3300046543 Bacteria 3941
319 Ga0495645_0091802 3300046543 Bacteria 2169
320 Ga0495645_0209589 3300046543 Bacteria 1317
321 Ga0495622_0097336 3300046557 Bacteria 1350
322 Ga0495633_0126153 3300046558 Bacteria 1184
323 Ga0495667_0014854 3300046559 Bacteria 5261
324 Ga0495667_0020098 3300046559 Bacteria 4503
325 Ga0495667_0293577 3300046559 Unclassified 1030
326 Ga0495635_0020663 3300046663 Bacteria 4586
327 Ga0495659_0109979 3300046664 Bacteria 1075
328 Ga0495588_0204039 3300046674 Bacteria 1044
329 Ga0495657_0047445 3300046675 Bacteria 2904
330 Ga0495657_0055860 3300046675 Bacteria 2633
331 Ga0495657_0144748 3300046675 Bacteria 1479
332 Ga0495599_0009380 3300046678 Bacteria 5980
333 Ga0495599_0054310 3300046678 Bacteria 2510
334 Ga0495623_0037017 3300046679 Bacteria 3125
335 Ga0495623_0096757 3300046679 Bacteria 1803
336 Ga0495646_0011962 3300046680 Bacteria 5520
337 Ga0495646_0014749 3300046680 Bacteria 4967
338 Ga0495646_0160857 3300046680 Bacteria 1243
339 Ga0495646_0348190 3300046680 Bacteria 777
340 Ga0495658_0174160 3300046683 Bacteria 1333
341 Ga0495658_0412421 3300046683 Bacteria 861
342 Ga0495669_0017354 3300046684 Bacteria 3089
343 Ga0495613_0353284 3300046689 Bacteria 1009
344 Ga0495624_0022884 3300046690 Bacteria 4124
345 Ga0495624_0093251 3300046690 Bacteria 1857
346 Ga0495624_0112297 3300046690 Bacteria 1675
347 Ga0495670_0022618 3300046691 Bacteria 3105
348 Ga0495671_0139773 3300046692 Bacteria 1180
349 Ga0495600_0015637 3300046809 Bacteria 4803
350 Ga0495600_0049403 3300046809 Bacteria 2745
351 Ga0495600_0228236 3300046809 Bacteria 1189
352 Ga0495581_0039103 3300047315 Bacteria 2746
353 Ga0495604_0013763 3300047317 Bacteria 6450
354 Ga0495604_0072652 3300047317 Bacteria 2599
355 Ga0495674_0016629 3300047319 Bacteria 6864
356 Ga0495674_0264849 3300047319 Bacteria 1411
357 Ga0495674_0427582 3300047319 Bacteria 1066
358 Ga0495674_0627697 3300047319 Bacteria 849
359 Ga0495676_0115638 3300047321 Bacteria 1961
360 Ga0495676_0155944 3300047321 Bacteria 1620
361 Ga0495676_0237716 3300047321 Bacteria 1248
362 Ga0495680_0011545 3300047322 Bacteria 7815
363 Ga0495680_0098301 3300047322 Bacteria 2184
364 Ga0495675_0020467 3300047444 Bacteria 4208
365 Ga0495684_0028082 3300047471 Bacteria 4321
366 Ga0495684_0043726 3300047471 Bacteria 3430
367 Ga0495684_0292747 3300047471 Bacteria 1171
368 Ga0495593_0094735 3300047673 Bacteria 1536
369 Ga0495593_0101263 3300047673 Bacteria 1477
370 Ga0495602_0019831 3300048088 Bacteria 6661
371 Ga0495602_0028844 3300048088 Bacteria 5302
372 Ga0496101_0033656 3300048904 Bacteria 3615
373 Ga0496103_0057856 3300048906 Bacteria 2407
374 Ga0496104_0611272 3300048907 Bacteria 1000
375 Ga0496105_0113937 3300048908 Bacteria 2230
376 Ga0496105_0184613 3300048908 Bacteria 1707
377 Ga0496106_0856255 3300048909 Bacteria 719
378 Ga0496107_0126857 3300048910 Bacteria 1882
379 Ga0496109_0521699 3300048912 Bacteria 1121
380 Ga0496110_0533051 3300048913 Bacteria 1068
381 Ga0496110_0544508 3300048913 Unclassified 1055
382 Ga0496112_0157028 3300048915 Bacteria 2242
383 Ga0496112_0198835 3300048915 Bacteria 1964
384 Ga0496112_0206825 3300048915 Bacteria 1920
385 Ga0496112_0732281 3300048915 Bacteria 916
386 Ga0496113_0139697 3300048916 Bacteria 1905
387 Ga0496114_0424680 3300048917 Bacteria 1177
388 Ga0496115_0035496 3300048918 Bacteria 3944
389 Ga0496115_0143703 3300048918 Bacteria 1968
390 Ga0501039_0057282 3300049575 Bacteria 3018
391 Ga0501040_0133429 3300049576 Bacteria 1747
392 Ga0501042_0238838 3300049578 Bacteria 1311
393 Ga0501072_0074070 3300049588 Bacteria 2692
394 Ga0501072_0284732 3300049588 Bacteria 1314
395 Ga0501076_0036526 3300049592 Bacteria 3850
396 Ga0501077_0012768 3300049593 Bacteria 5263
397 Ga0501079_0033305 3300049741 Bacteria 3964
398 Ga0501080_0034306 3300049742 Bacteria 4736
399 Ga0501083_0271942 3300049744 Bacteria 1102
400 Ga0501045_0114504 3300049824 Bacteria 2000
401 nmdc:mga05p37_241041_c1 3300050507 Bacteria 2174
402 nmdc:mga05p37_261584_c1 3300050507 Bacteria 1683
403 nmdc:mga05p37_71398_c1 3300050507 Bacteria 4271
404 nmdc:mga05p37_900769_c1 3300050507 Bacteria 954
405 nmdc:mga09592_202916_c1 3300050508 Bacteria 1717
406 nmdc:mga0qj67_13493_c1 3300050509 Bacteria 6161
407 nmdc:mga0qj67_559123_c1 3300050509 Bacteria 917
408 nmdc:mga06r32_163067_c1 3300050510 Bacteria 2211
409 nmdc:mga06r32_45487_c1 3300050510 Bacteria 4184
410 nmdc:mga08y16_835003_c1 3300050511 Bacteria 912
411 nmdc:mga0n895_128883_c1 3300050512 Bacteria 2554
412 nmdc:mga0n895_179316_c1 3300050512 Bacteria 2149
413 nmdc:mga0n895_552931_c1 3300050512 Bacteria 1157
414 nmdc:mga0n895_683426_c1 3300050512 Bacteria 1023
415 nmdc:mga0rr50_16653_c1 3300050513 Bacteria 4889
416 nmdc:mga0rr50_16873_c1 3300050513 Bacteria 4862
417 nmdc:mga0rr50_176278_c1 3300050513 Bacteria 1745
418 nmdc:mga0rr50_180600_c1 3300050513 Bacteria 1086
419 nmdc:mga0rr50_484724_c1 3300050513 Bacteria 1050
420 nmdc:mga0rr50_751330_c1 3300050513 Bacteria 832
421 nmdc:mga08x19_29978_c1 3300050514 Bacteria 3415
422 nmdc:mga08x19_331358_c1 3300050514 Bacteria 1060
423 nmdc:mga0a205_797502_c1 3300050515 Bacteria 792
424 Ga0495601_0014045 3300053077 Bacteria 4824
425 Ga0495601_0042368 3300053077 Bacteria 2856
426 Ga0495601_0084597 3300053077 Bacteria 2037
427 Ga0495601_0127445 3300053077 Bacteria 1656
428 Ga0495601_0152951 3300053077 Bacteria 1506
429 Ga0495612_0004272 3300053078 Bacteria 5936
430 Ga0495612_0047590 3300053078 Bacteria 1757
431 Ga0495612_0060898 3300053078 Bacteria 1563
432 Ga0495655_0038937 3300053083 Bacteria 1202
433 Ga0495595_0001306 3300053084 Bacteria 9700
434 Ga0495595_0001804 3300053084 Bacteria 8343
435 Ga0495595_0008507 3300053084 Bacteria 4214
436 Ga0495595_0060794 3300053084 Bacteria 1769
437 Ga0495595_0089752 3300053084 Unclassified 1473
438 Ga0495595_0214226 3300053084 Bacteria 960
439 Ga0495619_0005370 3300053085 Bacteria 8113
440 Ga0495619_0056432 3300053085 Bacteria 2603
441 Ga0495619_0218102 3300053085 Unclassified 1321
442 Ga0495619_0264212 3300053085 Bacteria 1192
443 Ga0495619_0291602 3300053085 Bacteria 1130
444 Ga0501084_1122617 3300054114 Bacteria 660
445 Ga0501082_0007998 3300060353 Bacteria 9131
446 Ga0530510_0146073 3300061734 Bacteria 1744
447 Ga0530510_0461343 3300061734 Bacteria 961
448 Ga0373927_0043881
449 JGI25405J52794_10025037
450 Ga0065712_10186487
451 Ga0070658_10377896
452 Ga0070676_10042733
453 Ga0070690_100118947
454 Ga0070690_100181373
455 Ga0070670_100055240
456 Ga0070670_100099467
457 Ga0070666_10288651
458 Ga0070682_100141224
459 Ga0068868_100118055
460 Ga0070660_100134041
461 Ga0070689_100169061
462 Ga0070691_10100380
463 Ga0070691_10205978
464 Ga0070687_100088012
465 Ga0070668_100112046
466 Ga0070675_100080845
467 Ga0070675_100452622
468 Ga0070671_100090189
469 Ga0070671_100675831
470 Ga0070673_100011272
471 Ga0070673_100266391
472 Ga0070673_100418290
473 Ga0070688_100057867
474 Ga0070659_100062020
475 Ga0070667_100164930
476 Ga0070709_10055105
477 Ga0070709_10638883
478 Ga0070714_100045560
479 Ga0070714_100198926
480 Ga0070713_100029862
481 Ga0070713_100052557
482 Ga0070713_100056810
483 Ga0070713_100231162
484 Ga0070713_100264125
485 Ga0070713_100387500
486 Ga0070710_10023508
487 Ga0070710_10174836
488 Ga0070701_10231613
489 Ga0070711_100079640
490 Ga0070711_100287606
491 Ga0070711_100825020
492 Ga0070700_100264696
493 Ga0070694_100048868
494 Ga0070663_100041999
495 Ga0070678_100247473
496 Ga0070678_100317666
497 Ga0070662_100204217
498 Ga0070685_10031425
499 Ga0070706_100245908
500 Ga0070707_100484371
501 Ga0070698_100262425
502 Ga0070684_100593192
503 Ga0070672_100133493
504 Ga0070686_100149450
505 Ga0070686_100311934
506 Ga0070695_100060611
507 Ga0070664_100314530
508 Ga0068856_100094668
509 Ga0070702_100166356
510 Ga0068852_100424519
511 Ga0068859_100608378
512 Ga0068866_10201469
513 Ga0068861_100212738
514 Ga0068861_100318431
515 Ga0068863_100789643
516 Ga0068860_100362255
517 Ga0081455_10000776
518 Ga0081455_10018562
519 Ga0070717_10201667
520 Ga0070717_10421776
521 Ga0070717_10465321
522 Ga0070715_10123374
523 Ga0070715_10161742
524 Ga0070716_100181550
525 Ga0070716_100409069
526 Ga0070712_100031703
527 Ga0070712_100056122
528 Ga0070712_100115207
529 Ga0075366_10018402
530 Ga0075428_100264518
531 Ga0075428_100341960
532 Ga0075428_100671314
533 Ga0075428_100846880
534 Ga0075430_100032509
535 Ga0075430_100334567
536 Ga0075431_100154812
537 Ga0075431_100208844
538 Ga0075433_10176668
539 Ga0075433_10564805
540 Ga0075434_100789719
541 Ga0075429_100201539
542 Ga0068865_100180447
543 Ga0068865_100548982
544 Ga0075436_100003242
545 Ga0075436_100027490
546 Ga0075436_100093997
547 Ga0097620_100608399
548 Ga0075435_100071836
549 Ga0075435_100146023
550 Ga0075435_100193335
551 Ga0075435_100469907
552 Ga0099794_10020478
553 Ga0099794_10024539
554 Ga0099794_10037290
555 Ga0099794_10251892
556 Ga0105240_10096425
557 Ga0111539_10694160
558 Ga0111539_11127019
559 Ga0105245_10261052
560 Ga0105247_10100676
561 Ga0105247_10245746
562 Ga0114129_10134518
563 Ga0114129_10207453
564 Ga0114129_10270909
565 Ga0114129_10760338
566 Ga0105243_10035825
567 Ga0105242_10174960
568 Ga0105248_10021074
569 Ga0105237_10345152
570 Ga0105238_10128554
571 Ga0105249_10336976
572 Ga0105239_10209374
573 Ga0105246_10207432
574 Ga0157315_1005690
575 Ga0157369_10708366
576 Ga0157378_10305345
577 Ga0157378_10584988
578 Ga0163162_10259781
579 Ga0163162_10276881
580 Ga0163163_10095158
581 Ga0157380_10096008
582 Ga0157380_10292268
583 Ga0157377_10212033
584 Ga0157376_10091853
585 Ga0163161_10105006
586 Ga0213872_10115777
587 Ga0213876_10024232
588 Ga0213875_10000003
589 Ga0207692_10057249
590 Ga0207692_10123893
591 Ga0207692_10173279
592 Ga0207710_10256303
593 Ga0207688_10003040
594 Ga0207685_10034603
595 Ga0207685_10096221
596 Ga0207685_10119055
597 Ga0207685_10153746
598 Ga0207699_10225209
599 Ga0207699_10673584
600 Ga0207645_10068760
601 Ga0207645_10112143
602 Ga0207643_10215193
603 Ga0207684_10079157
604 Ga0207695_10011331
605 Ga0207695_10014839
606 Ga0207671_10536129
607 Ga0207693_10008732
608 Ga0207693_10037505
609 Ga0207693_10062415
610 Ga0207693_10278566
611 Ga0207693_10582169
612 Ga0207663_10081535
613 Ga0207663_10275640
614 Ga0207663_10374330
615 Ga0207657_10094680
616 Ga0207646_10539769
617 Ga0207681_10387881
618 Ga0207681_10615969
619 Ga0207650_10053501
620 Ga0207659_10151443
621 Ga0207659_10183533
622 Ga0207659_10512918
623 Ga0207687_10097273
624 Ga0207700_10036988
625 Ga0207700_10079902
626 Ga0207700_10160519
627 Ga0207700_10308845
628 Ga0207700_10554440
629 Ga0207664_10151627
630 Ga0207664_10470427
631 Ga0207644_10001309
632 Ga0207644_10128663
633 Ga0207644_10306516
634 Ga0207690_10060077
635 Ga0207690_10307614
636 Ga0207706_10086725
637 Ga0207686_10068330
638 Ga0207686_10505564
639 Ga0207709_10148270
640 Ga0207669_10254175
641 Ga0207665_10156079
642 Ga0207665_10167637
643 Ga0207665_10429615
644 Ga0207691_10011266
645 Ga0207711_10092920
646 Ga0207689_10009592
647 Ga0207679_10487620
648 Ga0207651_10025083
649 Ga0207651_10048355
650 Ga0207639_10288363
651 Ga0207678_10016350
652 Ga0207708_10010832
653 Ga0207708_10196425
654 Ga0207702_10477635
655 Ga0207702_10594302
656 Ga0207648_10036518
657 Ga0207648_10188233
658 Ga0207676_10095399
659 Ga0207674_10526867
660 Ga0207675_100010832
661 Ga0207675_100504046
662 Ga0207683_10072927
663 Ga0207683_10644535
664 Ga0209996_1016207
665 Ga0209588_1030010
666 Ga0268265_10712522
667 Ga0268264_10090882
668 Ga0373958_0031555
669 Ga0373938_0026728
670 Ga0373938_0071261
671 Ga0373926_0069526
672 Ga0373928_0048641
673 Ga0373929_0017056
674 Ga0373934_0207334
675 Ga0373923_0311768
676 Ga0373936_0051077
677 Ga0373941_0042518
678 Ga0373945_0257460
679 Ga0373954_0246706
680 Ga0373956_0019616
681 Ga0373957_0214915
682 Ga0373943_0014716
683 Ga0373955_0056997
684 Ga0373955_0330523
685 Ga0373924_0017812
686 Ga0373931_0000872
687 Ga0373935_0046572
688 Ga0373927_0016857
689 Ga0373927_0086130
690 Ga0373927_0097922
691 Ga0373933_0006242
692 Ga0373933_0031999
693 Ga0373933_0476209
694 Ga0373947_0018254
695 Ga0373947_0020870
696 Ga0373947_0246479
697 Ga0373947_0365075
698 Ga0373937_0026714
699 Ga0373937_0070817
700 Ga0373937_0677637
701 Ga0373925_0027323
702 Ga0373925_0623530
703 Ga0436364_0624552
704 Ga0436364_1376863
705 Ga0436365_0133200
706 Ga0436365_1293158
707 Ga0436365_1354233
708 Ga0436360_0456676
709 Ga0436360_0637626
710 Ga0436361_0752913
711 Ga0436361_1058341
712 Ga0436363_1368139
713 Ga0451576_0329655
714 Ga0495592_0028000
715 Ga0495592_0189355
716 Ga0495629_0006045
717 Ga0495629_0191439
718 Ga0495629_0198995
719 Ga0495641_0009746
720 Ga0495641_0020710
721 Ga0495651_0008454
722 Ga0495651_0061065
723 Ga0495653_0011683
724 Ga0495653_0017244
725 Ga0495580_0190831
726 Ga0495605_0066338
727 Ga0495639_0101277
728 Ga0495662_0032416
729 Ga0495662_0139997
730 Ga0495664_0039061
731 Ga0495664_0083687
732 Ga0495584_0026408
733 Ga0495584_0187866
734 Ga0495585_0009802
735 Ga0495596_0084397
736 Ga0495608_0006748
737 Ga0495608_0014485
738 Ga0495608_0214582
739 Ga0495608_0229375
740 Ga0495618_0003343
741 Ga0495618_0006847
742 Ga0495618_0370968
743 Ga0495628_0041066
744 Ga0495628_0212243
745 Ga0495628_0293247
746 Ga0495628_0549452
747 Ga0495630_0073023
748 Ga0495630_0286544
749 Ga0495663_0194190
750 Ga0495666_0267454
751 Ga0495652_0009760
752 Ga0495652_0027745
753 Ga0495652_0130056
754 Ga0495652_0221583
755 Ga0495665_0188606
756 Ga0495665_0194245
757 Ga0495640_0036373
758 Ga0495640_0127604
759 Ga0495640_0158822
760 Ga0495587_0003209
761 Ga0495587_0008356
762 Ga0495587_0175821
763 Ga0495587_0332940
764 Ga0495609_0261732
765 Ga0495645_0030279
766 Ga0495645_0091802
767 Ga0495645_0209589
768 Ga0495622_0097336
769 Ga0495633_0126153
770 Ga0495667_0014854
771 Ga0495667_0020098
772 Ga0495667_0293577
773 Ga0495635_0020663
774 Ga0495659_0109979
775 Ga0495588_0204039
776 Ga0495657_0047445
777 Ga0495657_0055860
778 Ga0495657_0144748
779 Ga0495599_0009380
780 Ga0495599_0054310
781 Ga0495623_0037017
782 Ga0495623_0096757
783 Ga0495646_0011962
784 Ga0495646_0014749
785 Ga0495646_0160857
786 Ga0495646_0348190
787 Ga0495658_0174160
788 Ga0495658_0412421
789 Ga0495669_0017354
790 Ga0495613_0353284
791 Ga0495624_0022884
792 Ga0495624_0093251
793 Ga0495624_0112297
794 Ga0495670_0022618
795 Ga0495671_0139773
796 Ga0495600_0015637
797 Ga0495600_0049403
798 Ga0495600_0228236
799 Ga0495581_0039103
800 Ga0495604_0013763
801 Ga0495604_0072652
802 Ga0495674_0016629
803 Ga0495674_0264849
804 Ga0495674_0427582
805 Ga0495674_0627697
806 Ga0495676_0115638
807 Ga0495676_0155944
808 Ga0495676_0237716
809 Ga0495680_0011545
810 Ga0495680_0098301
811 Ga0495675_0020467
812 Ga0495684_0028082
813 Ga0495684_0043726
814 Ga0495684_0292747
815 Ga0495593_0094735
816 Ga0495593_0101263
817 Ga0495602_0019831
818 Ga0495602_0028844
819 Ga0496101_0033656
820 Ga0496103_0057856
821 Ga0496104_0611272
822 Ga0496105_0113937
823 Ga0496105_0184613
824 Ga0496106_0856255
825 Ga0496107_0126857
826 Ga0496109_0521699
827 Ga0496110_0533051
828 Ga0496110_0544508
829 Ga0496112_0157028
830 Ga0496112_0198835
831 Ga0496112_0206825
832 Ga0496112_0732281
833 Ga0496113_0139697
834 Ga0496114_0424680
835 Ga0496115_0035496
836 Ga0496115_0143703
837 Ga0501039_0057282
838 Ga0501040_0133429
839 Ga0501042_0238838
840 Ga0501072_0074070
841 Ga0501072_0284732
842 Ga0501076_0036526
843 Ga0501077_0012768
844 Ga0501079_0033305
845 Ga0501080_0034306
846 Ga0501083_0271942
847 Ga0501045_0114504
848 nmdc:mga05p37_241041_c1
849 nmdc:mga05p37_261584_c1
850 nmdc:mga05p37_71398_c1
851 nmdc:mga05p37_900769_c1
852 nmdc:mga09592_202916_c1
853 nmdc:mga0qj67_13493_c1
854 nmdc:mga0qj67_559123_c1
855 nmdc:mga06r32_163067_c1
856 nmdc:mga06r32_45487_c1
857 nmdc:mga08y16_835003_c1
858 nmdc:mga0n895_128883_c1
859 nmdc:mga0n895_179316_c1
860 nmdc:mga0n895_552931_c1
861 nmdc:mga0n895_683426_c1
862 nmdc:mga0rr50_16653_c1
863 nmdc:mga0rr50_16873_c1
864 nmdc:mga0rr50_176278_c1
865 nmdc:mga0rr50_180600_c1
866 nmdc:mga0rr50_484724_c1
867 nmdc:mga0rr50_751330_c1
868 nmdc:mga08x19_29978_c1
869 nmdc:mga08x19_331358_c1
870 nmdc:mga0a205_797502_c1
871 Ga0495601_0014045
872 Ga0495601_0042368
873 Ga0495601_0084597
874 Ga0495601_0127445
875 Ga0495601_0152951
876 Ga0495612_0004272
877 Ga0495612_0047590
878 Ga0495612_0060898
879 Ga0495655_0038937
880 Ga0495595_0001306
881 Ga0495595_0001804
882 Ga0495595_0008507
883 Ga0495595_0060794
884 Ga0495595_0089752
885 Ga0495595_0214226
886 Ga0495619_0005370
887 Ga0495619_0056432
888 Ga0495619_0218102
889 Ga0495619_0264212
890 Ga0495619_0291602
891 Ga0501084_1122617
892 Ga0501082_0007998
893 Ga0530510_0146073
894 Ga0530510_0461343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dy0-assembly1.cif.gz_A murine endostatin, crystal form ii 0.6533 32 219
1dy2-assembly1.cif.gz_A murine collagen alpha1(xv), endostatin domain 0.6411 31 219
1bnl-assembly1.cif.gz_A zinc dependent dimers observed in crystals of human endostatin 0.6409 30 221
1koe-assembly1.cif.gz_A endostatin 0.6287 31 219
1dy2-assembly1.cif.gz_A murine collagen alpha1(xv), endostatin domain 0.6261 31 219
ID Description Score Start End Superfamily
af_G5EGA4_982_1161_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.6744 24 221 3.10.100.10
af_P39059_1210_1388_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.656 30 220 3.10.100.10
af_M9ND55_829_1006_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.6555 32 220 3.10.100.10
af_G5EGA4_982_1161_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.6513 24 221 3.10.100.10
af_M9ND55_829_1006_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.6177 32 220 3.10.100.10
ID Description Score Start End GO Terms
AF-A0A527YRC5-F1-model_v4 Uncharacterized protein 0.924 53 151
AF-A0A7U1HTX8-F1-model_v4 deleted 0.9239 50 148
AF-A0A167IQV1-F1-model_v4 Uncharacterized protein 0.9039 31 221
AF-A0A536SIB3-F1-model_v4 Lectin 0.902 24 221
AF-A0A1L3LXF0-F1-model_v4 Lectin 0.9015 31 221

Map