F445982

General Info

Members Datasets Scaffolds Average Seq Length
447 150 894 215

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100680050|Ga0307416_1006800501
Length 211
Sequence MKRGMLIALACTGLATAAAAAWSSQIVERPRSEPVTKQQQPEWADKDRIFLTKAQLFQAHAEGAIDRDIQSVLDVRKRMHYGDFVWNDRNVPKGPVWVRVDLKSQLISVFRSGHEIGTAVVLYGADEKQTPNGVFPVIAKIKDHKSATYDGAPMPYTLRLTQDGVAIHGSDVRWGAATHGCIGVPVEFAQRLFGQVAKGDQILIISDKRTA

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.37
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 8.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100680050 3300032002 Bacteria 1117
2 JGI24741J21665_1013318 3300001915 Unclassified 1397
3 JGI24752J21851_1012852 3300001976 Bacteria 1093
4 JGI24740J21852_10001031 3300001979 Bacteria 12488
5 JGI24740J21852_10009653 3300001979 Bacteria 3764
6 JGI24737J22298_10000694 3300001990 Bacteria 11827
7 JGI24735J21928_10006593 3300002067 Bacteria 3813
8 Ga0070658_10005841 3300005327 Bacteria 9977
9 Ga0070658_10094609 3300005327 Bacteria 2465
10 Ga0070658_10170816 3300005327 Unclassified 1826
11 Ga0070658_10386502 3300005327 Bacteria 1201
12 Ga0070676_10040472 3300005328 Bacteria 2699
13 Ga0070683_100003587 3300005329 Bacteria 12633
14 Ga0070683_100015020 3300005329 Bacteria 6793
15 Ga0070683_100029582 3300005329 Bacteria 4961
16 Ga0070690_100026639 3300005330 Bacteria 3568
17 Ga0070677_10146683 3300005333 Bacteria 1094
18 Ga0068869_100142064 3300005334 Unclassified 1854
19 Ga0070666_10001176 3300005335 Bacteria 15883
20 Ga0070666_10002282 3300005335 Bacteria 11591
21 Ga0070666_10003878 3300005335 Bacteria 9083
22 Ga0070680_100001216 3300005336 Bacteria 18552
23 Ga0070680_100002808 3300005336 Bacteria 12933
24 Ga0070682_100002011 3300005337 Bacteria 11357
25 Ga0068868_100001161 3300005338 Bacteria 18055
26 Ga0068868_100071287 3300005338 Bacteria 2771
27 Ga0070660_100004312 3300005339 Bacteria 9825
28 Ga0070660_100005494 3300005339 Bacteria 8781
29 Ga0070660_100006676 3300005339 Bacteria 8010
30 Ga0070660_100140098 3300005339 Bacteria 1940
31 Ga0070660_100142976 3300005339 Bacteria 1921
32 Ga0070660_100340952 3300005339 Bacteria 1233
33 Ga0070660_100392945 3300005339 Bacteria 1146
34 Ga0070661_100006370 3300005344 Bacteria 8143
35 Ga0070661_100010119 3300005344 Bacteria 6549
36 Ga0070661_100010481 3300005344 Bacteria 6449
37 Ga0070661_100010877 3300005344 Bacteria 6338
38 Ga0070661_100733899 3300005344 Bacteria 807
39 Ga0070692_10017273 3300005345 Bacteria 3446
40 Ga0070675_100011515 3300005354 Bacteria 6928
41 Ga0070671_100022646 3300005355 Bacteria 5132
42 Ga0070671_100084630 3300005355 Bacteria 2652
43 Ga0070671_100302394 3300005355 Bacteria 1362
44 Ga0070671_100392488 3300005355 Bacteria 1187
45 Ga0070674_100050510 3300005356 Bacteria 2863
46 Ga0070674_100079719 3300005356 Bacteria 2337
47 Ga0070673_100005934 3300005364 Bacteria 7893
48 Ga0070673_100025931 3300005364 Bacteria 4322
49 Ga0070673_100078298 3300005364 Bacteria 2674
50 Ga0070673_100461749 3300005364 Unclassified 1143
51 Ga0070659_100019941 3300005366 Bacteria 5089
52 Ga0070659_100020469 3300005366 Bacteria 5025
53 Ga0070659_100031766 3300005366 Bacteria 4091
54 Ga0070659_100074187 3300005366 Bacteria 2710
55 Ga0070659_100136132 3300005366 Bacteria 1997
56 Ga0070659_100684540 3300005366 Unclassified 886
57 Ga0070667_100001536 3300005367 Bacteria 20668
58 Ga0070667_100006718 3300005367 Bacteria 9558
59 Ga0070667_100020854 3300005367 Bacteria 5442
60 Ga0070663_100018589 3300005455 Bacteria 4560
61 Ga0070663_100035507 3300005455 Bacteria 3459
62 Ga0070663_100063687 3300005455 Bacteria 2664
63 Ga0070678_100027274 3300005456 Bacteria 3877
64 Ga0070678_100044215 3300005456 Bacteria 3179
65 Ga0070678_100048827 3300005456 Bacteria 3050
66 Ga0070662_100019685 3300005457 Bacteria 4586
67 Ga0070662_100045817 3300005457 Bacteria 3140
68 Ga0070662_100067230 3300005457 Bacteria 2631
69 Ga0070662_100072451 3300005457 Bacteria 2543
70 Ga0070662_100077374 3300005457 Bacteria 2469
71 Ga0070662_100169662 3300005457 Bacteria 1713
72 Ga0070662_100206719 3300005457 Bacteria 1560
73 Ga0070662_100523137 3300005457 Bacteria 991
74 Ga0070681_10035860 3300005458 Bacteria 4981
75 Ga0070681_10485832 3300005458 Bacteria 1148
76 Ga0068867_100016330 3300005459 Bacteria 5271
77 Ga0068867_100121774 3300005459 Bacteria 2017
78 Ga0070679_100007057 3300005530 Bacteria 10479
79 Ga0070679_100028348 3300005530 Bacteria 5520
80 Ga0070679_100097546 3300005530 Bacteria 2927
81 Ga0070684_100002793 3300005535 Bacteria 12939
82 Ga0070684_100011377 3300005535 Bacteria 7088
83 Ga0070684_100085182 3300005535 Bacteria 2803
84 Ga0068853_100001655 3300005539 Bacteria 16309
85 Ga0068853_100123017 3300005539 Bacteria 2316
86 Ga0068853_100321814 3300005539 Unclassified 1434
87 Ga0070672_100003681 3300005543 Bacteria 9966
88 Ga0070672_100028381 3300005543 Bacteria 4185
89 Ga0070672_100032876 3300005543 Bacteria 3921
90 Ga0070672_100142113 3300005543 Bacteria 1981
91 Ga0070686_100018590 3300005544 Bacteria 4083
92 Ga0070686_100092921 3300005544 Bacteria 2022
93 Ga0070693_100111392 3300005547 Bacteria 1684
94 Ga0070665_100015682 3300005548 Bacteria 7612
95 Ga0070665_100048245 3300005548 Bacteria 4276
96 Ga0070665_100053425 3300005548 Bacteria 4052
97 Ga0070665_100150212 3300005548 Bacteria 2332
98 Ga0068855_100025325 3300005563 Bacteria 7100
99 Ga0068855_101026496 3300005563 Bacteria 865
100 Ga0070664_100006388 3300005564 Bacteria 9507
101 Ga0070664_100006589 3300005564 Bacteria 9363
102 Ga0070664_100006646 3300005564 Bacteria 9325
103 Ga0070664_100007607 3300005564 Bacteria 8748
104 Ga0070664_100040967 3300005564 Bacteria 3907
105 Ga0070664_100049940 3300005564 Bacteria 3538
106 Ga0070664_100159769 3300005564 Bacteria 1993
107 Ga0070664_100504563 3300005564 Unclassified 1115
108 Ga0068857_100010987 3300005577 Bacteria 7881
109 Ga0068857_100026383 3300005577 Bacteria 5121
110 Ga0068857_100711096 3300005577 Unclassified 955
111 Ga0068854_100024555 3300005578 Bacteria 4128
112 Ga0068854_100036057 3300005578 Bacteria 3465
113 Ga0068854_100058388 3300005578 Bacteria 2785
114 Ga0068854_100103063 3300005578 Bacteria 2142
115 Ga0068854_100209996 3300005578 Bacteria 1535
116 Ga0068854_100225597 3300005578 Bacteria 1484
117 Ga0068854_100588463 3300005578 Bacteria 948
118 Ga0068856_100052840 3300005614 Bacteria 4007
119 Ga0068856_100155537 3300005614 Bacteria 2296
120 Ga0068852_100008770 3300005616 Bacteria 7479
121 Ga0068852_100017648 3300005616 Bacteria 5605
122 Ga0068852_100074361 3300005616 Bacteria 2992
123 Ga0068852_100147587 3300005616 Bacteria 2183
124 Ga0068852_100303477 3300005616 Bacteria 1546
125 Ga0068852_100631723 3300005616 Bacteria 1077
126 Ga0068852_100963226 3300005616 Bacteria 871
127 Ga0068859_100138255 3300005617 Bacteria 2510
128 Ga0068859_100207872 3300005617 Bacteria 2043
129 Ga0068859_100632642 3300005617 Unclassified 1162
130 Ga0068864_100080134 3300005618 Bacteria 2860
131 Ga0068864_100153443 3300005618 Bacteria 2088
132 Ga0068864_100298665 3300005618 Bacteria 1507
133 Ga0068866_10021011 3300005718 Bacteria 3000
134 Ga0068851_10023269 3300005834 Bacteria 3027
135 Ga0068851_10107231 3300005834 Bacteria 1488
136 Ga0068851_10195521 3300005834 Bacteria 1126
137 Ga0068851_10249585 3300005834 Bacteria 1006
138 Ga0068870_10113383 3300005840 Bacteria 1551
139 Ga0068863_100025244 3300005841 Bacteria 5664
140 Ga0068863_100112215 3300005841 Bacteria 2596
141 Ga0068863_100140761 3300005841 Bacteria 2306
142 Ga0068858_100008096 3300005842 Bacteria 10119
143 Ga0068858_100057591 3300005842 Bacteria 3591
144 Ga0068858_100369982 3300005842 Bacteria 1374
145 Ga0068858_100433095 3300005842 Unclassified 1266
146 Ga0068860_100034667 3300005843 Bacteria 4842
147 Ga0068860_100054031 3300005843 Bacteria 3818
148 Ga0068860_100491415 3300005843 Bacteria 1224
149 Ga0097621_100088366 3300006237 Bacteria 2589
150 Ga0097621_100092462 3300006237 Bacteria 2533
151 Ga0068871_100028811 3300006358 Bacteria 4358
152 Ga0068871_100049941 3300006358 Bacteria 3382
153 Ga0068865_100035134 3300006881 Bacteria 3368
154 Ga0068865_100042488 3300006881 Bacteria 3100
155 Ga0097620_100138252 3300006931 Bacteria 2510
156 Ga0097620_100207852 3300006931 Bacteria 2043
157 Ga0097620_100632656 3300006931 Unclassified 1162
158 Ga0105240_10013884 3300009093 Bacteria 11033
159 Ga0105240_10156310 3300009093 Bacteria 2711
160 Ga0105245_10051404 3300009098 Bacteria 3695
161 Ga0105245_10079971 3300009098 Bacteria 2986
162 Ga0105245_10097788 3300009098 Bacteria 2711
163 Ga0105247_10502063 3300009101 Bacteria 884
164 Ga0105243_10064776 3300009148 Bacteria 2934
165 Ga0105243_10174897 3300009148 Bacteria 1862
166 Ga0105242_10011839 3300009176 Bacteria 6714
167 Ga0105248_10000268 3300009177 Bacteria 61070
168 Ga0105248_10025156 3300009177 Bacteria 6617
169 Ga0105248_10153774 3300009177 Bacteria 2596
170 Ga0105248_10638811 3300009177 Unclassified 1201
171 Ga0105237_10003495 3300009545 Bacteria 18645
172 Ga0105238_10009976 3300009551 Bacteria 9522
173 Ga0105238_11109124 3300009551 Bacteria 814
174 Ga0105246_10657510 3300011119 Bacteria 913
175 Ga0157373_10016819 3300013100 Bacteria 5332
176 Ga0157373_10044591 3300013100 Unclassified 3166
177 Ga0157373_10126835 3300013100 Bacteria 1795
178 Ga0157373_10394087 3300013100 Bacteria 992
179 Ga0157371_10013381 3300013102 Bacteria 6233
180 Ga0157371_10034820 3300013102 Bacteria 3610
181 Ga0157371_10064469 3300013102 Bacteria 2596
182 Ga0157371_10100695 3300013102 Bacteria 2049
183 Ga0157371_10147309 3300013102 Bacteria 1678
184 Ga0157371_10177345 3300013102 Bacteria 1524
185 Ga0157370_10000630 3300013104 Bacteria 43948
186 Ga0157370_10008771 3300013104 Bacteria 10869
187 Ga0157370_10100143 3300013104 Bacteria 2715
188 Ga0157370_10196603 3300013104 Bacteria 1871
189 Ga0157369_10018227 3300013105 Bacteria 7874
190 Ga0157369_10021443 3300013105 Bacteria 7226
191 Ga0157369_10023493 3300013105 Bacteria 6867
192 Ga0157369_10090433 3300013105 Bacteria 3268
193 Ga0157369_10125478 3300013105 Bacteria 2722
194 Ga0157369_10456878 3300013105 Unclassified 1322
195 Ga0157369_10670991 3300013105 Unclassified 1068
196 Ga0157374_10012728 3300013296 Bacteria 7329
197 Ga0157374_10092891 3300013296 Bacteria 2880
198 Ga0157374_10672003 3300013296 Unclassified 1048
199 Ga0157378_10168704 3300013297 Bacteria 2051
200 Ga0157378_10207106 3300013297 Bacteria 1858
201 Ga0157378_10436041 3300013297 Bacteria 1298
202 Ga0163162_10011412 3300013306 Bacteria 8664
203 Ga0163162_10090794 3300013306 Bacteria 3136
204 Ga0157372_10004121 3300013307 Bacteria 15580
205 Ga0157372_10111336 3300013307 Unclassified 3136
206 Ga0157372_10214359 3300013307 Bacteria 2231
207 Ga0157372_10608263 3300013307 Unclassified 1274
208 Ga0157372_11425069 3300013307 Unclassified 798
209 Ga0157375_10075380 3300013308 Bacteria 3398
210 Ga0157375_10111363 3300013308 Bacteria 2836
211 Ga0163163_10001398 3300014325 Bacteria 20368
212 Ga0163163_10244231 3300014325 Bacteria 1845
213 Ga0157377_10136709 3300014745 Bacteria 1502
214 Ga0157379_10068367 3300014968 Bacteria 3176
215 Ga0157379_10096595 3300014968 Bacteria 2652
216 Ga0157379_10117835 3300014968 Bacteria 2389
217 Ga0157376_10005890 3300014969 Bacteria 8602
218 Ga0207697_10130693 3300025315 Bacteria 1085
219 Ga0207656_10093875 3300025321 Bacteria 1366
220 Ga0207688_10306775 3300025901 Bacteria 971
221 Ga0207680_10001101 3300025903 Bacteria 12739
222 Ga0207680_10006476 3300025903 Bacteria 5662
223 Ga0207680_10097735 3300025903 Unclassified 1880
224 Ga0207647_10001007 3300025904 Bacteria 21881
225 Ga0207647_10002538 3300025904 Bacteria 13827
226 Ga0207647_10005352 3300025904 Bacteria 9429
227 Ga0207645_10073949 3300025907 Unclassified 2182
228 Ga0207705_10001479 3300025909 Bacteria 18709
229 Ga0207705_10001742 3300025909 Bacteria 17224
230 Ga0207705_10002409 3300025909 Bacteria 14441
231 Ga0207705_10121278 3300025909 Bacteria 1940
232 Ga0207705_10191123 3300025909 Bacteria 1548
233 Ga0207705_10207333 3300025909 Bacteria 1486
234 Ga0207705_10551907 3300025909 Bacteria 896
235 Ga0207705_10707818 3300025909 Bacteria 783
236 Ga0207707_10089027 3300025912 Unclassified 2697
237 Ga0207707_10150335 3300025912 Bacteria 2036
238 Ga0207707_10379496 3300025912 Bacteria 1215
239 Ga0207707_10414054 3300025912 Bacteria 1156
240 Ga0207695_10023774 3300025913 Bacteria 6915
241 Ga0207671_10019410 3300025914 Bacteria 5197
242 Ga0207660_10008267 3300025917 Bacteria 6726
243 Ga0207660_10187496 3300025917 Bacteria 1609
244 Ga0207657_10000862 3300025919 Bacteria 31986
245 Ga0207657_10001100 3300025919 Bacteria 28711
246 Ga0207657_10009823 3300025919 Bacteria 9587
247 Ga0207657_10010657 3300025919 Bacteria 9156
248 Ga0207657_10021814 3300025919 Bacteria 6016
249 Ga0207657_10068688 3300025919 Bacteria 3009
250 Ga0207657_10217943 3300025919 Bacteria 1530
251 Ga0207657_10280912 3300025919 Bacteria 1322
252 Ga0207657_10323756 3300025919 Bacteria 1218
253 Ga0207649_10003181 3300025920 Bacteria 9003
254 Ga0207649_10013534 3300025920 Bacteria 4554
255 Ga0207649_10021732 3300025920 Bacteria 3699
256 Ga0207649_10028956 3300025920 Bacteria 3267
257 Ga0207649_10033077 3300025920 Bacteria 3087
258 Ga0207649_10793485 3300025920 Unclassified 739
259 Ga0207652_10001258 3300025921 Bacteria 22543
260 Ga0207652_10058702 3300025921 Bacteria 3315
261 Ga0207652_10073424 3300025921 Bacteria 2976
262 Ga0207694_10014147 3300025924 Bacteria 6016
263 Ga0207694_10328713 3300025924 Bacteria 1263
264 Ga0207650_10016367 3300025925 Bacteria 5183
265 Ga0207650_10056772 3300025925 Bacteria 2910
266 Ga0207650_10229483 3300025925 Bacteria 1497
267 Ga0207659_10006776 3300025926 Bacteria 7040
268 Ga0207659_10185273 3300025926 Bacteria 1652
269 Ga0207687_10022111 3300025927 Bacteria 4231
270 Ga0207687_10024613 3300025927 Bacteria 4023
271 Ga0207687_10090014 3300025927 Bacteria 2235
272 Ga0207664_10027671 3300025929 Bacteria 4302
273 Ga0207644_10000287 3300025931 Bacteria 33209
274 Ga0207644_10000978 3300025931 Bacteria 18260
275 Ga0207644_10001443 3300025931 Bacteria 15321
276 Ga0207644_10004265 3300025931 Bacteria 9278
277 Ga0207644_10005192 3300025931 Bacteria 8510
278 Ga0207690_10001778 3300025932 Bacteria 13246
279 Ga0207690_10012296 3300025932 Bacteria 5122
280 Ga0207690_10019205 3300025932 Bacteria 4203
281 Ga0207690_10104616 3300025932 Bacteria 2028
282 Ga0207690_10108376 3300025932 Bacteria 1996
283 Ga0207690_10127681 3300025932 Bacteria 1856
284 Ga0207690_10455153 3300025932 Bacteria 1029
285 Ga0207706_10003553 3300025933 Bacteria 14886
286 Ga0207706_10007807 3300025933 Bacteria 9877
287 Ga0207706_10033022 3300025933 Bacteria 4607
288 Ga0207706_10033900 3300025933 Bacteria 4544
289 Ga0207706_10042280 3300025933 Bacteria 4039
290 Ga0207706_10059440 3300025933 Bacteria 3366
291 Ga0207709_10199446 3300025935 Bacteria 1428
292 Ga0207669_10026485 3300025937 Bacteria 3155
293 Ga0207669_10050758 3300025937 Bacteria 2482
294 Ga0207669_10087378 3300025937 Bacteria 2019
295 Ga0207669_10251718 3300025937 Unclassified 1316
296 Ga0207704_10099727 3300025938 Bacteria 1933
297 Ga0207704_10278119 3300025938 Bacteria 1271
298 Ga0207691_10001260 3300025940 Bacteria 25362
299 Ga0207691_10490176 3300025940 Unclassified 1044
300 Ga0207711_10000885 3300025941 Bacteria 28910
301 Ga0207711_10002333 3300025941 Bacteria 17001
302 Ga0207711_10044027 3300025941 Bacteria 3809
303 Ga0207661_10006666 3300025944 Bacteria 8167
304 Ga0207661_10026223 3300025944 Bacteria 4438
305 Ga0207661_10053438 3300025944 Bacteria 3232
306 Ga0207661_10832523 3300025944 Bacteria 850
307 Ga0207679_10006262 3300025945 Bacteria 7509
308 Ga0207679_10011864 3300025945 Bacteria 5664
309 Ga0207679_10046404 3300025945 Bacteria 3149
310 Ga0207679_10066650 3300025945 Bacteria 2698
311 Ga0207679_10131814 3300025945 Bacteria 2006
312 Ga0207679_10245571 3300025945 Bacteria 1519
313 Ga0207667_10013269 3300025949 Bacteria 9441
314 Ga0207667_10144706 3300025949 Unclassified 2447
315 Ga0207667_10337886 3300025949 Bacteria 1537
316 Ga0207651_10002851 3300025960 Bacteria 8326
317 Ga0207651_10016239 3300025960 Bacteria 4355
318 Ga0207651_10038147 3300025960 Bacteria 3154
319 Ga0207651_10038664 3300025960 Bacteria 3138
320 Ga0207651_10351611 3300025960 Bacteria 1241
321 Ga0207640_10003537 3300025981 Bacteria 8424
322 Ga0207640_10072529 3300025981 Bacteria 2323
323 Ga0207640_10199493 3300025981 Bacteria 1515
324 Ga0207658_10001086 3300025986 Bacteria 22006
325 Ga0207658_10033159 3300025986 Bacteria 3682
326 Ga0207658_10043095 3300025986 Bacteria 3278
327 Ga0207658_10094724 3300025986 Bacteria 2324
328 Ga0207677_10001149 3300026023 Bacteria 14447
329 Ga0207677_10112497 3300026023 Bacteria 2030
330 Ga0207703_10002773 3300026035 Bacteria 14999
331 Ga0207703_10018516 3300026035 Bacteria 5438
332 Ga0207703_10132096 3300026035 Unclassified 2157
333 Ga0207639_10020939 3300026041 Bacteria 4691
334 Ga0207639_10291541 3300026041 Unclassified 1439
335 Ga0207678_10001575 3300026067 Bacteria 20968
336 Ga0207678_10012717 3300026067 Bacteria 7391
337 Ga0207678_10019623 3300026067 Bacteria 5943
338 Ga0207678_10120968 3300026067 Bacteria 2234
339 Ga0207678_10149638 3300026067 Bacteria 1993
340 Ga0207678_10174676 3300026067 Bacteria 1834
341 Ga0207702_10006032 3300026078 Bacteria 10518
342 Ga0207702_10062684 3300026078 Bacteria 3176
343 Ga0207702_10157897 3300026078 Bacteria 2069
344 Ga0207702_10592429 3300026078 Bacteria 1087
345 Ga0207702_10980525 3300026078 Bacteria 838
346 Ga0207641_10031106 3300026088 Bacteria 4425
347 Ga0207648_10002272 3300026089 Bacteria 20792
348 Ga0207676_10002638 3300026095 Bacteria 12786
349 Ga0207676_10278809 3300026095 Unclassified 1517
350 Ga0207676_10360150 3300026095 Bacteria 1348
351 Ga0207674_10000139 3300026116 Bacteria 84273
352 Ga0207674_10004664 3300026116 Bacteria 16458
353 Ga0207674_10005070 3300026116 Bacteria 15722
354 Ga0207683_10001183 3300026121 Bacteria 23626
355 Ga0207683_10009677 3300026121 Bacteria 8216
356 Ga0207683_10068358 3300026121 Bacteria 3136
357 Ga0207698_10001417 3300026142 Bacteria 13917
358 Ga0207698_10031762 3300026142 Bacteria 3816
359 Ga0207698_10162965 3300026142 Bacteria 1953
360 Ga0207698_10197273 3300026142 Bacteria 1799
361 Ga0207698_10267433 3300026142 Bacteria 1574
362 Ga0207698_10558141 3300026142 Unclassified 1124
363 Ga0268266_10037292 3300028379 Bacteria 4142
364 Ga0268266_10037504 3300028379 Bacteria 4128
365 Ga0268264_10017797 3300028381 Bacteria 5817
366 Ga0268264_10455096 3300028381 Bacteria 1241
367 Ga0307408_100083877 3300031548 Bacteria 2389
368 Ga0307409_100018648 3300031995 Bacteria 4673
369 Ga0307416_100004815 3300032002 Bacteria 8205
370 Ga0307414_10045287 3300032004 Bacteria 3012
371 Ga0307411_10015475 3300032005 Bacteria 4286
372 Ga0373935_0065507 3300035692 Bacteria 2332
373 Ga0373925_0111448 3300037068 Bacteria 2114
374 Ga0395899_0000916 3300037312 Bacteria 27731
375 Ga0395899_0053218 3300037312 Bacteria 2998
376 Ga0395899_0058129 3300037312 Bacteria 2853
377 Ga0395899_0284596 3300037312 Bacteria 1123
378 Ga0395900_0001285 3300037418 Bacteria 30628
379 Ga0395900_0001721 3300037418 Bacteria 25276
380 Ga0395900_0025702 3300037418 Bacteria 6028
381 Ga0395900_0071003 3300037418 Bacteria 3579
382 Ga0395900_0101079 3300037418 Bacteria 2961
383 Ga0395900_0109293 3300037418 Bacteria 2840
384 Ga0395900_0163607 3300037418 Bacteria 2268
385 Ga0395898_0001920 3300037466 Bacteria 26462
386 Ga0395898_0042977 3300037466 Bacteria 4455
387 Ga0395898_0052262 3300037466 Bacteria 3992
388 Ga0395898_0065099 3300037466 Bacteria 3534
389 Ga0395898_0149598 3300037466 Bacteria 2234
390 Ga0395898_0234670 3300037466 Bacteria 1749
391 Ga0395898_0469454 3300037466 Bacteria 1198
392 Ga0395898_0479632 3300037466 Unclassified 1183
393 Ga0395905_0001547 3300037471 Bacteria 27515
394 Ga0395905_0002287 3300037471 Bacteria 21496
395 Ga0395905_0006619 3300037471 Bacteria 11621
396 Ga0395905_0007539 3300037471 Bacteria 10819
397 Ga0395905_0015060 3300037471 Bacteria 7367
398 Ga0395905_0036139 3300037471 Bacteria 4639
399 Ga0395905_0041483 3300037471 Bacteria 4318
400 Ga0395905_0054597 3300037471 Bacteria 3738
401 Ga0395905_0072473 3300037471 Bacteria 3229
402 Ga0395905_0153625 3300037471 Bacteria 2165
403 Ga0395905_0212434 3300037471 Bacteria 1812
404 Ga0395905_0256187 3300037471 Bacteria 1634
405 Ga0395905_0477788 3300037471 Unclassified 1145
406 Ga0395905_0592246 3300037471 Unclassified 1010
407 Ga0395905_0731382 3300037471 Bacteria 892
408 Ga0395901_0000671 3300038443 Bacteria 39338
409 Ga0395901_0003154 3300038443 Bacteria 16572
410 Ga0395901_0019442 3300038443 Bacteria 6945
411 Ga0395901_0020131 3300038443 Bacteria 6828
412 Ga0395901_0023784 3300038443 Bacteria 6282
413 Ga0395901_0034649 3300038443 Bacteria 5214
414 Ga0395901_0040326 3300038443 Bacteria 4835
415 Ga0395901_0132348 3300038443 Bacteria 2620
416 Ga0395901_0364072 3300038443 Unclassified 1490
417 Ga0395901_0513138 3300038443 Bacteria 1219
418 Ga0395901_0552590 3300038443 Bacteria 1167
419 Ga0436365_1341754 3300039437 Bacteria 8968
420 Ga0439458_0019464 3300042157 Bacteria 1562
421 Ga0466958_0061082 3300045836 Bacteria 2295
422 Ga0466967_0024790 3300045976 Bacteria 4937
423 Ga0466967_0151591 3300045976 Bacteria 2167
424 Ga0496100_0001219 3300048903 Bacteria 12495
425 Ga0496100_0405503 3300048903 Bacteria 1039
426 Ga0496101_0000484 3300048904 Bacteria 25084
427 Ga0496101_0215340 3300048904 Unclassified 1489
428 Ga0496102_0057662 3300048905 Bacteria 3547
429 Ga0496102_0246511 3300048905 Bacteria 1684
430 Ga0496102_0543677 3300048905 Bacteria 1084
431 Ga0496105_0065733 3300048908 Bacteria 2993
432 Ga0496106_0014361 3300048909 Bacteria 5851
433 Ga0496106_0474486 3300048909 Unclassified 1005
434 Ga0496107_0010584 3300048910 Bacteria 6412
435 Ga0496107_0255439 3300048910 Unclassified 1304
436 Ga0496108_0005348 3300048911 Bacteria 10379
437 Ga0496108_0037446 3300048911 Bacteria 4040
438 Ga0496109_0036971 3300048912 Bacteria 4409
439 Ga0496109_0198409 3300048912 Bacteria 1886
440 Ga0496110_0000252 3300048913 Bacteria 34772
441 Ga0496110_0093977 3300048913 Bacteria 2684
442 Ga0496111_0004334 3300048914 Bacteria 8952
443 Ga0496111_0057968 3300048914 Bacteria 2803
444 Ga0496112_0023362 3300048915 Bacteria 5906
445 Ga0496112_0097136 3300048915 Bacteria 2916
446 Ga0496113_0002825 3300048916 Bacteria 10205
447 Ga0496113_0169336 3300048916 Bacteria 1729
448 Ga0307416_100680050
449 JGI24741J21665_1013318
450 JGI24752J21851_1012852
451 JGI24740J21852_10001031
452 JGI24740J21852_10009653
453 JGI24737J22298_10000694
454 JGI24735J21928_10006593
455 Ga0070658_10005841
456 Ga0070658_10094609
457 Ga0070658_10170816
458 Ga0070658_10386502
459 Ga0070676_10040472
460 Ga0070683_100003587
461 Ga0070683_100015020
462 Ga0070683_100029582
463 Ga0070690_100026639
464 Ga0070677_10146683
465 Ga0068869_100142064
466 Ga0070666_10001176
467 Ga0070666_10002282
468 Ga0070666_10003878
469 Ga0070680_100001216
470 Ga0070680_100002808
471 Ga0070682_100002011
472 Ga0068868_100001161
473 Ga0068868_100071287
474 Ga0070660_100004312
475 Ga0070660_100005494
476 Ga0070660_100006676
477 Ga0070660_100140098
478 Ga0070660_100142976
479 Ga0070660_100340952
480 Ga0070660_100392945
481 Ga0070661_100006370
482 Ga0070661_100010119
483 Ga0070661_100010481
484 Ga0070661_100010877
485 Ga0070661_100733899
486 Ga0070692_10017273
487 Ga0070675_100011515
488 Ga0070671_100022646
489 Ga0070671_100084630
490 Ga0070671_100302394
491 Ga0070671_100392488
492 Ga0070674_100050510
493 Ga0070674_100079719
494 Ga0070673_100005934
495 Ga0070673_100025931
496 Ga0070673_100078298
497 Ga0070673_100461749
498 Ga0070659_100019941
499 Ga0070659_100020469
500 Ga0070659_100031766
501 Ga0070659_100074187
502 Ga0070659_100136132
503 Ga0070659_100684540
504 Ga0070667_100001536
505 Ga0070667_100006718
506 Ga0070667_100020854
507 Ga0070663_100018589
508 Ga0070663_100035507
509 Ga0070663_100063687
510 Ga0070678_100027274
511 Ga0070678_100044215
512 Ga0070678_100048827
513 Ga0070662_100019685
514 Ga0070662_100045817
515 Ga0070662_100067230
516 Ga0070662_100072451
517 Ga0070662_100077374
518 Ga0070662_100169662
519 Ga0070662_100206719
520 Ga0070662_100523137
521 Ga0070681_10035860
522 Ga0070681_10485832
523 Ga0068867_100016330
524 Ga0068867_100121774
525 Ga0070679_100007057
526 Ga0070679_100028348
527 Ga0070679_100097546
528 Ga0070684_100002793
529 Ga0070684_100011377
530 Ga0070684_100085182
531 Ga0068853_100001655
532 Ga0068853_100123017
533 Ga0068853_100321814
534 Ga0070672_100003681
535 Ga0070672_100028381
536 Ga0070672_100032876
537 Ga0070672_100142113
538 Ga0070686_100018590
539 Ga0070686_100092921
540 Ga0070693_100111392
541 Ga0070665_100015682
542 Ga0070665_100048245
543 Ga0070665_100053425
544 Ga0070665_100150212
545 Ga0068855_100025325
546 Ga0068855_101026496
547 Ga0070664_100006388
548 Ga0070664_100006589
549 Ga0070664_100006646
550 Ga0070664_100007607
551 Ga0070664_100040967
552 Ga0070664_100049940
553 Ga0070664_100159769
554 Ga0070664_100504563
555 Ga0068857_100010987
556 Ga0068857_100026383
557 Ga0068857_100711096
558 Ga0068854_100024555
559 Ga0068854_100036057
560 Ga0068854_100058388
561 Ga0068854_100103063
562 Ga0068854_100209996
563 Ga0068854_100225597
564 Ga0068854_100588463
565 Ga0068856_100052840
566 Ga0068856_100155537
567 Ga0068852_100008770
568 Ga0068852_100017648
569 Ga0068852_100074361
570 Ga0068852_100147587
571 Ga0068852_100303477
572 Ga0068852_100631723
573 Ga0068852_100963226
574 Ga0068859_100138255
575 Ga0068859_100207872
576 Ga0068859_100632642
577 Ga0068864_100080134
578 Ga0068864_100153443
579 Ga0068864_100298665
580 Ga0068866_10021011
581 Ga0068851_10023269
582 Ga0068851_10107231
583 Ga0068851_10195521
584 Ga0068851_10249585
585 Ga0068870_10113383
586 Ga0068863_100025244
587 Ga0068863_100112215
588 Ga0068863_100140761
589 Ga0068858_100008096
590 Ga0068858_100057591
591 Ga0068858_100369982
592 Ga0068858_100433095
593 Ga0068860_100034667
594 Ga0068860_100054031
595 Ga0068860_100491415
596 Ga0097621_100088366
597 Ga0097621_100092462
598 Ga0068871_100028811
599 Ga0068871_100049941
600 Ga0068865_100035134
601 Ga0068865_100042488
602 Ga0097620_100138252
603 Ga0097620_100207852
604 Ga0097620_100632656
605 Ga0105240_10013884
606 Ga0105240_10156310
607 Ga0105245_10051404
608 Ga0105245_10079971
609 Ga0105245_10097788
610 Ga0105247_10502063
611 Ga0105243_10064776
612 Ga0105243_10174897
613 Ga0105242_10011839
614 Ga0105248_10000268
615 Ga0105248_10025156
616 Ga0105248_10153774
617 Ga0105248_10638811
618 Ga0105237_10003495
619 Ga0105238_10009976
620 Ga0105238_11109124
621 Ga0105246_10657510
622 Ga0157373_10016819
623 Ga0157373_10044591
624 Ga0157373_10126835
625 Ga0157373_10394087
626 Ga0157371_10013381
627 Ga0157371_10034820
628 Ga0157371_10064469
629 Ga0157371_10100695
630 Ga0157371_10147309
631 Ga0157371_10177345
632 Ga0157370_10000630
633 Ga0157370_10008771
634 Ga0157370_10100143
635 Ga0157370_10196603
636 Ga0157369_10018227
637 Ga0157369_10021443
638 Ga0157369_10023493
639 Ga0157369_10090433
640 Ga0157369_10125478
641 Ga0157369_10456878
642 Ga0157369_10670991
643 Ga0157374_10012728
644 Ga0157374_10092891
645 Ga0157374_10672003
646 Ga0157378_10168704
647 Ga0157378_10207106
648 Ga0157378_10436041
649 Ga0163162_10011412
650 Ga0163162_10090794
651 Ga0157372_10004121
652 Ga0157372_10111336
653 Ga0157372_10214359
654 Ga0157372_10608263
655 Ga0157372_11425069
656 Ga0157375_10075380
657 Ga0157375_10111363
658 Ga0163163_10001398
659 Ga0163163_10244231
660 Ga0157377_10136709
661 Ga0157379_10068367
662 Ga0157379_10096595
663 Ga0157379_10117835
664 Ga0157376_10005890
665 Ga0207697_10130693
666 Ga0207656_10093875
667 Ga0207688_10306775
668 Ga0207680_10001101
669 Ga0207680_10006476
670 Ga0207680_10097735
671 Ga0207647_10001007
672 Ga0207647_10002538
673 Ga0207647_10005352
674 Ga0207645_10073949
675 Ga0207705_10001479
676 Ga0207705_10001742
677 Ga0207705_10002409
678 Ga0207705_10121278
679 Ga0207705_10191123
680 Ga0207705_10207333
681 Ga0207705_10551907
682 Ga0207705_10707818
683 Ga0207707_10089027
684 Ga0207707_10150335
685 Ga0207707_10379496
686 Ga0207707_10414054
687 Ga0207695_10023774
688 Ga0207671_10019410
689 Ga0207660_10008267
690 Ga0207660_10187496
691 Ga0207657_10000862
692 Ga0207657_10001100
693 Ga0207657_10009823
694 Ga0207657_10010657
695 Ga0207657_10021814
696 Ga0207657_10068688
697 Ga0207657_10217943
698 Ga0207657_10280912
699 Ga0207657_10323756
700 Ga0207649_10003181
701 Ga0207649_10013534
702 Ga0207649_10021732
703 Ga0207649_10028956
704 Ga0207649_10033077
705 Ga0207649_10793485
706 Ga0207652_10001258
707 Ga0207652_10058702
708 Ga0207652_10073424
709 Ga0207694_10014147
710 Ga0207694_10328713
711 Ga0207650_10016367
712 Ga0207650_10056772
713 Ga0207650_10229483
714 Ga0207659_10006776
715 Ga0207659_10185273
716 Ga0207687_10022111
717 Ga0207687_10024613
718 Ga0207687_10090014
719 Ga0207664_10027671
720 Ga0207644_10000287
721 Ga0207644_10000978
722 Ga0207644_10001443
723 Ga0207644_10004265
724 Ga0207644_10005192
725 Ga0207690_10001778
726 Ga0207690_10012296
727 Ga0207690_10019205
728 Ga0207690_10104616
729 Ga0207690_10108376
730 Ga0207690_10127681
731 Ga0207690_10455153
732 Ga0207706_10003553
733 Ga0207706_10007807
734 Ga0207706_10033022
735 Ga0207706_10033900
736 Ga0207706_10042280
737 Ga0207706_10059440
738 Ga0207709_10199446
739 Ga0207669_10026485
740 Ga0207669_10050758
741 Ga0207669_10087378
742 Ga0207669_10251718
743 Ga0207704_10099727
744 Ga0207704_10278119
745 Ga0207691_10001260
746 Ga0207691_10490176
747 Ga0207711_10000885
748 Ga0207711_10002333
749 Ga0207711_10044027
750 Ga0207661_10006666
751 Ga0207661_10026223
752 Ga0207661_10053438
753 Ga0207661_10832523
754 Ga0207679_10006262
755 Ga0207679_10011864
756 Ga0207679_10046404
757 Ga0207679_10066650
758 Ga0207679_10131814
759 Ga0207679_10245571
760 Ga0207667_10013269
761 Ga0207667_10144706
762 Ga0207667_10337886
763 Ga0207651_10002851
764 Ga0207651_10016239
765 Ga0207651_10038147
766 Ga0207651_10038664
767 Ga0207651_10351611
768 Ga0207640_10003537
769 Ga0207640_10072529
770 Ga0207640_10199493
771 Ga0207658_10001086
772 Ga0207658_10033159
773 Ga0207658_10043095
774 Ga0207658_10094724
775 Ga0207677_10001149
776 Ga0207677_10112497
777 Ga0207703_10002773
778 Ga0207703_10018516
779 Ga0207703_10132096
780 Ga0207639_10020939
781 Ga0207639_10291541
782 Ga0207678_10001575
783 Ga0207678_10012717
784 Ga0207678_10019623
785 Ga0207678_10120968
786 Ga0207678_10149638
787 Ga0207678_10174676
788 Ga0207702_10006032
789 Ga0207702_10062684
790 Ga0207702_10157897
791 Ga0207702_10592429
792 Ga0207702_10980525
793 Ga0207641_10031106
794 Ga0207648_10002272
795 Ga0207676_10002638
796 Ga0207676_10278809
797 Ga0207676_10360150
798 Ga0207674_10000139
799 Ga0207674_10004664
800 Ga0207674_10005070
801 Ga0207683_10001183
802 Ga0207683_10009677
803 Ga0207683_10068358
804 Ga0207698_10001417
805 Ga0207698_10031762
806 Ga0207698_10162965
807 Ga0207698_10197273
808 Ga0207698_10267433
809 Ga0207698_10558141
810 Ga0268266_10037292
811 Ga0268266_10037504
812 Ga0268264_10017797
813 Ga0268264_10455096
814 Ga0307408_100083877
815 Ga0307409_100018648
816 Ga0307416_100004815
817 Ga0307414_10045287
818 Ga0307411_10015475
819 Ga0373935_0065507
820 Ga0373925_0111448
821 Ga0395899_0000916
822 Ga0395899_0053218
823 Ga0395899_0058129
824 Ga0395899_0284596
825 Ga0395900_0001285
826 Ga0395900_0001721
827 Ga0395900_0025702
828 Ga0395900_0071003
829 Ga0395900_0101079
830 Ga0395900_0109293
831 Ga0395900_0163607
832 Ga0395898_0001920
833 Ga0395898_0042977
834 Ga0395898_0052262
835 Ga0395898_0065099
836 Ga0395898_0149598
837 Ga0395898_0234670
838 Ga0395898_0469454
839 Ga0395898_0479632
840 Ga0395905_0001547
841 Ga0395905_0002287
842 Ga0395905_0006619
843 Ga0395905_0007539
844 Ga0395905_0015060
845 Ga0395905_0036139
846 Ga0395905_0041483
847 Ga0395905_0054597
848 Ga0395905_0072473
849 Ga0395905_0153625
850 Ga0395905_0212434
851 Ga0395905_0256187
852 Ga0395905_0477788
853 Ga0395905_0592246
854 Ga0395905_0731382
855 Ga0395901_0000671
856 Ga0395901_0003154
857 Ga0395901_0019442
858 Ga0395901_0020131
859 Ga0395901_0023784
860 Ga0395901_0034649
861 Ga0395901_0040326
862 Ga0395901_0132348
863 Ga0395901_0364072
864 Ga0395901_0513138
865 Ga0395901_0552590
866 Ga0436365_1341754
867 Ga0439458_0019464
868 Ga0466958_0061082
869 Ga0466967_0024790
870 Ga0466967_0151591
871 Ga0496100_0001219
872 Ga0496100_0405503
873 Ga0496101_0000484
874 Ga0496101_0215340
875 Ga0496102_0057662
876 Ga0496102_0246511
877 Ga0496102_0543677
878 Ga0496105_0065733
879 Ga0496106_0014361
880 Ga0496106_0474486
881 Ga0496107_0010584
882 Ga0496107_0255439
883 Ga0496108_0005348
884 Ga0496108_0037446
885 Ga0496109_0036971
886 Ga0496109_0198409
887 Ga0496110_0000252
888 Ga0496110_0093977
889 Ga0496111_0004334
890 Ga0496111_0057968
891 Ga0496112_0023362
892 Ga0496112_0097136
893 Ga0496113_0002825
894 Ga0496113_0169336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

95

204

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uwv-assembly2.cif.gz_A crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8996 99 209
5uwv-assembly5.cif.gz_C crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8945 99 209
5uwv-assembly1.cif.gz_B crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8856 100 207
6d51-assembly1.cif.gz_A crystal structure of l,d-transpeptidase 3 from mycobacterium tuberculosis in complex with a faropenem-derived adduct 0.8796 100 209
5uwv-assembly3.cif.gz_D crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8787 100 208
ID Description Score Start End Superfamily
6d51A02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8796 100 209 2.40.440.10
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8787 100 208 2.40.440.10
af_M9PB21_880_1122_3.10.129.110 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Polyketide synthase dehydratase 0.8672 100 122 3.10.129.110
4jmxA02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8578 100 208 2.40.440.10
af_P9WPS3_469_590_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.8325 110 122 3.40.1110.10
ID Description Score Start End GO Terms
AF-A0A2N3D0N6-F1-model_v4 L,D-transpeptidase 0.9578 77 208 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A4V1STV8-F1-model_v4 L,D-transpeptidase 0.9572 80 208 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A0Q4LAG3-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9567 77 211 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A0Q4K0S9-F1-model_v4 deleted 0.9553 83 208
AF-A0A147I5E8-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9544 71 209 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972

Map