F445977

General Info

Members Datasets Scaffolds Average Seq Length
447 282 894 332

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10054782|Ga0307513_100547824
Length 393
Sequence MRTRRLSGSLPPGHDCHTYDAVGYGTVGTAVTEPGQGFRCRPGTTLSTIDPTGDATMSTSSDVIDDAPKANTDTPLPPATLGGERKGSVEQIALLLFIVVPFLALVASVPLTWSWGGVSWLDLGLLVFFYFLGCHGVTIGFHRYFTHGSFKAKRPLRIALAIAGSMAVEGPLVRWVADHRKHHKFSDAEGDPHSPWRFGETLPALMKGLWWAHIAWMFDEERTPQDKYAPDLIKDTTIRAISRHFIYWTMLSLALPALIGGLVTMSWWGAFTGFFWGSLVRVALLHHVTWSINSICHAVGKRPFKSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVMRGQVDSSARIIRWCEQLGWAYDVRWPSRSRIDSRRNPDQDGSRRRRETAEAA

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
17 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
23 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
24 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
25 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
26 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
34 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
39 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
40 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
43 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
44 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
45 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
46 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
47 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
48 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
49 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
50 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
51 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
52 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
53 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
54 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
55 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
56 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
57 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
58 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
141 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
175 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
176 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
177 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
178 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
179 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
180 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
184 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
185 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
186 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
190 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
191 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
192 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
193 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
194 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
195 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
196 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
197 2643221548 Streptomyces sp. Root55 Isolate Unclassified
198 2643221578 Streptomyces sp. Root63 Isolate Unclassified
199 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
200 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
201 2643221647 Streptomyces sp. Root369 Isolate Unclassified
202 2643221670 Streptomyces sp. Root431 Isolate Unclassified
203 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
204 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
205 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
206 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
207 2643221714 Streptomyces sp. Root264 Isolate Unclassified
208 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
209 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
210 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
211 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
212 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
213 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
214 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
215 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
216 2808606448 Streptomyces sp. 193411 Isolate Unclassified
217 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
218 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
219 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
220 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
221 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
222 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
223 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
224 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
225 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
226 2862574272 Streptomyces sp. AcE210 Isolate Nodule
227 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
228 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
229 2867428634 Streptomyces sp. RP5T Isolate Unclassified
230 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
231 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
232 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
233 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
234 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
235 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
236 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
237 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
238 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
239 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
240 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
241 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
242 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
243 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
244 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
245 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
246 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
247 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
248 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
249 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
250 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
251 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
252 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
253 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
254 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
255 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
256 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
257 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
258 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
259 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
260 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
261 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
262 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
263 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
264 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
265 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
266 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
267 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
268 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
269 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
270 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
271 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
272 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
273 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
274 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
275 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
276 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
277 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
278 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
279 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
280 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
281 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
282 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.19
Metatranscriptomes 0
Isolates 20.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.92
Nodule 0.45
Rhizoplane 0.22
Rhizosphere 80.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10054782 3300031456 Bacteria 4273
2 JGI24739J22299_10007392 3300001989 Bacteria 4124
3 JGI24737J22298_10008413 3300001990 Bacteria 3454
4 JGI24738J21930_10005364 3300002075 Bacteria 3077
5 rootH1_10000563 3300003316 Bacteria 10284
6 rootH2_10063986 3300003320 Bacteria 5039
7 rootL2_10042584 3300003322 Bacteria 3890
8 Ga0070674_100246943 3300005356 Bacteria 1400
9 Ga0070684_100243965 3300005535 Bacteria 1642
10 Ga0068855_100181021 3300005563 Bacteria 2383
11 Ga0068854_100349972 3300005578 Bacteria 1209
12 Ga0081455_10007869 3300005937 Bacteria 11160
13 Ga0081455_10021389 3300005937 Bacteria 6068
14 Ga0075363_100003666 3300006048 Bacteria 6596
15 Ga0070715_10008850 3300006163 Bacteria 3525
16 Ga0075367_10002171 3300006178 Bacteria 8841
17 Ga0105251_10020046 3300009011 Bacteria 3519
18 Ga0105250_10021683 3300009092 Bacteria 2592
19 Ga0114129_10018390 3300009147 Bacteria 9953
20 Ga0105248_10079941 3300009177 Bacteria 3674
21 Ga0105246_10001087 3300011119 Bacteria 15722
22 Ga0157372_10080646 3300013307 Bacteria 3683
23 Ga0182008_10000608 3300014497 Bacteria 26318
24 Ga0182007_10001466 3300015262 Bacteria 12633
25 Ga0183367_1005 3300015688 Bacteria 652063
26 Ga0207426_1001884 3300025302 Bacteria 15318
27 Ga0207426_1007037 3300025302 Bacteria 4773
28 Ga0207713_1042301 3300025735 Bacteria 1893
29 Ga0207647_10047143 3300025904 Bacteria 2682
30 Ga0207685_10017948 3300025905 Bacteria 2300
31 Ga0207661_10246674 3300025944 Bacteria 1586
32 Ga0209813_10026907 3300027866 Bacteria 1666
33 Ga0307517_10003673 3300028786 Bacteria 23852
34 Ga0307517_10032555 3300028786 Bacteria 6021
35 Ga0307515_10000054 3300028794 Bacteria 265489
36 Ga0268256_1007460 3300030500 Bacteria 3897
37 Ga0307513_10017398 3300031456 Bacteria 8621
38 Ga0307509_10019115 3300031507 Bacteria 7832
39 Ga0307508_10002248 3300031616 Bacteria 20579
40 Ga0307508_10030433 3300031616 Bacteria 4879
41 Ga0307514_10002847 3300031649 Bacteria 17323
42 Ga0307516_10003541 3300031730 Bacteria 19967
43 Ga0307516_10022400 3300031730 Bacteria 6488
44 Ga0307518_10010854 3300031838 Bacteria 6508
45 Ga0307507_10150105 3300033179 Bacteria 1756
46 Ga0307507_10162754 3300033179 Bacteria 1644
47 Ga0307510_10009333 3300033180 Bacteria 11688
48 Ga0307510_10021482 3300033180 Bacteria 7521
49 Ga0307510_10080950 3300033180 Bacteria 3153
50 Ga0395898_0004515 3300037466 Bacteria 15209
51 Ga0395898_0031261 3300037466 Bacteria 5321
52 Ga0439436_0000224 3300041404 Bacteria 13644
53 Ga0451835_0250204 3300041492 Bacteria 1676
54 Ga0451853_3096261 3300041512 Bacteria 1221
55 Ga0439433_0000054 3300041999 Bacteria 13978
56 Ga0439433_0003837 3300041999 Bacteria 3233
57 Ga0439448_0008548 3300042005 Bacteria 3000
58 Ga0439449_0004871 3300042007 Bacteria 5170
59 Ga0439449_0011509 3300042007 Bacteria 3328
60 Ga0439455_0000204 3300042012 Bacteria 6901
61 Ga0439457_001327 3300042014 Bacteria 7418
62 Ga0439457_001852 3300042014 Bacteria 6241
63 Ga0439462_0000933 3300042015 Bacteria 6197
64 Ga0450890_007952 3300042127 Bacteria 1356
65 Ga0450894_000119 3300042131 Bacteria 13510
66 Ga0450895_000330 3300042132 Bacteria 2554
67 Ga0450899_000575 3300042135 Bacteria 4189
68 Ga0450903_000857 3300042138 Bacteria 5900
69 Ga0450906_001939 3300042145 Bacteria 4525
70 Ga0439458_0003112 3300042157 Bacteria 3944
71 Ga0450908_010515 3300042184 Bacteria 1707
72 Ga0466969_0006837 3300044656 Bacteria 6068
73 Ga0466969_0008968 3300044656 Bacteria 5302
74 Ga0466972_0000961 3300044658 Bacteria 13842
75 Ga0466972_0004402 3300044658 Bacteria 7040
76 Ga0466972_0009810 3300044658 Bacteria 4807
77 Ga0466972_0097863 3300044658 Bacteria 1389
78 Ga0466965_0000189 3300044683 Bacteria 19146
79 Ga0466966_0001937 3300044684 Bacteria 13407
80 Ga0466966_0002232 3300044684 Bacteria 12596
81 Ga0466966_0052283 3300044684 Bacteria 2595
82 Ga0466961_0000701 3300044693 Bacteria 21109
83 Ga0466961_0005317 3300044693 Bacteria 8101
84 Ga0466961_0015792 3300044693 Bacteria 4845
85 Ga0466961_0056307 3300044693 Bacteria 2505
86 Ga0466963_0000593 3300044694 Bacteria 17261
87 Ga0466963_0003809 3300044694 Bacteria 8699
88 Ga0466963_0052007 3300044694 Bacteria 2717
89 Ga0466964_0008496 3300044706 Bacteria 3860
90 Ga0466964_0037650 3300044706 Bacteria 1943
91 Ga0466971_0001210 3300044719 Bacteria 10730
92 Ga0466970_0000692 3300044765 Bacteria 16499
93 Ga0466970_0031971 3300044765 Bacteria 2780
94 Ga0466957_0000672 3300044842 Bacteria 17423
95 Ga0466957_0233402 3300044842 Bacteria 1219
96 Ga0466960_0013261 3300044901 Bacteria 3497
97 Ga0466959_0003547 3300045049 Bacteria 10254
98 Ga0466958_0000356 3300045836 Bacteria 18444
99 Ga0466967_0006475 3300045976 Bacteria 8294
100 Ga0466967_0023000 3300045976 Bacteria 5099
101 Ga0466967_0039500 3300045976 Bacteria 4058
102 Ga0466967_0381781 3300045976 Bacteria 1368
103 Ga0495627_024329 3300046453 Bacteria 1975
104 Ga0495592_0003705 3300046454 Bacteria 11021
105 Ga0495592_0013613 3300046454 Bacteria 6187
106 Ga0495603_0000882 3300046455 Bacteria 17240
107 Ga0495603_0024238 3300046455 Bacteria 3669
108 Ga0495603_0056246 3300046455 Bacteria 2329
109 Ga0495603_0060299 3300046455 Bacteria 2242
110 Ga0495629_0005160 3300046459 Bacteria 9770
111 Ga0495629_0006020 3300046459 Bacteria 9021
112 Ga0495629_0006520 3300046459 Bacteria 8648
113 Ga0495629_0009306 3300046459 Bacteria 7190
114 Ga0495629_0020294 3300046459 Bacteria 4744
115 Ga0495629_0032836 3300046459 Bacteria 3673
116 Ga0495629_0078223 3300046459 Bacteria 2309
117 Ga0495629_0166964 3300046459 Bacteria 1528
118 Ga0495638_0018606 3300046460 Bacteria 4611
119 Ga0495651_0002115 3300046462 Bacteria 15334
120 Ga0495651_0029379 3300046462 Bacteria 4285
121 Ga0495651_0047075 3300046462 Bacteria 3336
122 Ga0495580_0021757 3300046472 Bacteria 4729
123 Ga0495605_0011087 3300046474 Bacteria 5034
124 Ga0495605_0108091 3300046474 Bacteria 1272
125 Ga0495605_0111135 3300046474 Bacteria 1250
126 Ga0495639_0031768 3300046475 Bacteria 2352
127 Ga0495662_0001917 3300046476 Bacteria 10440
128 Ga0495662_0016660 3300046476 Bacteria 3560
129 Ga0495664_0003333 3300046477 Bacteria 8729
130 Ga0495664_0004144 3300046477 Bacteria 7913
131 Ga0495585_0033586 3300046492 Bacteria 2903
132 Ga0495585_0045198 3300046492 Bacteria 2459
133 Ga0495594_0001837 3300046499 Bacteria 11047
134 Ga0495594_0032269 3300046499 Bacteria 2842
135 Ga0495594_0081727 3300046499 Bacteria 1804
136 Ga0495583_0040229 3300046506 Bacteria 2197
137 Ga0495606_0031343 3300046507 Bacteria 3698
138 Ga0495610_0045662 3300046512 Bacteria 2166
139 Ga0495616_0004153 3300046513 Bacteria 9181
140 Ga0495616_0056602 3300046513 Bacteria 1936
141 Ga0495618_0007540 3300046514 Bacteria 6589
142 Ga0495618_0011095 3300046514 Bacteria 5459
143 Ga0495618_0120853 3300046514 Bacteria 1677
144 Ga0495620_0046267 3300046515 Bacteria 1879
145 Ga0495620_0056341 3300046515 Bacteria 1653
146 Ga0495630_0055104 3300046517 Bacteria 2979
147 Ga0495631_0018641 3300046518 Bacteria 3264
148 Ga0495637_0079040 3300046520 Bacteria 1314
149 Ga0495643_0004924 3300046522 Bacteria 9173
150 Ga0495643_0018872 3300046522 Bacteria 3995
151 Ga0495644_0040726 3300046523 Bacteria 1751
152 Ga0495648_0050499 3300046524 Bacteria 2540
153 Ga0495652_0008027 3300046529 Bacteria 9677
154 Ga0495652_0008044 3300046529 Bacteria 9661
155 Ga0495654_0036477 3300046530 Bacteria 2470
156 Ga0495640_0001993 3300046533 Bacteria 16280
157 Ga0495640_0024954 3300046533 Bacteria 4343
158 Ga0495640_0108656 3300046533 Bacteria 1814
159 Ga0495640_0113938 3300046533 Bacteria 1763
160 Ga0495587_0001112 3300046536 Bacteria 17620
161 Ga0495609_0021426 3300046538 Bacteria 2981
162 Ga0495597_0040136 3300046542 Bacteria 2093
163 Ga0495597_0060955 3300046542 Bacteria 1644
164 Ga0495622_0029219 3300046557 Bacteria 2575
165 Ga0495667_0078249 3300046559 Bacteria 2150
166 Ga0495667_0079613 3300046559 Bacteria 2130
167 Ga0495668_0066235 3300046616 Bacteria 1987
168 Ga0495668_0068836 3300046616 Bacteria 1946
169 Ga0495668_0074985 3300046616 Bacteria 1858
170 Ga0495634_0002311 3300046642 Bacteria 15949
171 Ga0495634_0190725 3300046642 Bacteria 1278
172 Ga0495611_0076284 3300046648 Bacteria 1536
173 Ga0495625_0072322 3300046660 Bacteria 2418
174 Ga0495635_0031726 3300046663 Bacteria 3666
175 Ga0495588_0002204 3300046674 Bacteria 8340
176 Ga0495588_0002441 3300046674 Bacteria 7959
177 Ga0495588_0006215 3300046674 Bacteria 5369
178 Ga0495588_0081196 3300046674 Bacteria 1692
179 Ga0495657_0001809 3300046675 Bacteria 18279
180 Ga0495657_0011842 3300046675 Bacteria 6501
181 Ga0495657_0013046 3300046675 Bacteria 6145
182 Ga0495657_0080917 3300046675 Bacteria 2101
183 Ga0495646_0004109 3300046680 Bacteria 9132
184 Ga0495658_0024166 3300046683 Bacteria 3233
185 Ga0495658_0041008 3300046683 Bacteria 2576
186 Ga0495613_0000988 3300046689 Bacteria 21626
187 Ga0495613_0002046 3300046689 Bacteria 15333
188 Ga0495613_0012754 3300046689 Bacteria 6248
189 Ga0495613_0069680 3300046689 Bacteria 2564
190 Ga0495624_0025370 3300046690 Bacteria 3892
191 Ga0495624_0027750 3300046690 Bacteria 3704
192 Ga0495624_0037092 3300046690 Bacteria 3138
193 Ga0495670_0006348 3300046691 Bacteria 5807
194 Ga0495670_0025637 3300046691 Bacteria 2917
195 Ga0495671_0003809 3300046692 Bacteria 9170
196 Ga0495649_0025145 3300046694 Bacteria 3317
197 Ga0495649_0108528 3300046694 Bacteria 1472
198 Ga0495589_0009307 3300046794 Bacteria 5110
199 Ga0495589_0010969 3300046794 Bacteria 4704
200 Ga0495589_0014689 3300046794 Bacteria 4029
201 Ga0495589_0018560 3300046794 Bacteria 3565
202 Ga0495589_0036817 3300046794 Bacteria 2452
203 Ga0495589_0060068 3300046794 Bacteria 1867
204 Ga0495589_0100299 3300046794 Bacteria 1401
205 Ga0495600_0006521 3300046809 Bacteria 7102
206 Ga0495600_0044400 3300046809 Bacteria 2899
207 Ga0495600_0057891 3300046809 Bacteria 2531
208 Ga0495660_0003248 3300046810 Bacteria 10107
209 Ga0495581_0007204 3300047315 Bacteria 6437
210 Ga0495581_0015900 3300047315 Bacteria 4371
211 Ga0495581_0086944 3300047315 Bacteria 1812
212 Ga0495604_0000674 3300047317 Bacteria 28915
213 Ga0495604_0000735 3300047317 Bacteria 27516
214 Ga0495604_0007554 3300047317 Bacteria 8599
215 Ga0495604_0029568 3300047317 Bacteria 4358
216 Ga0495636_0000831 3300047318 Bacteria 11393
217 Ga0495636_0003966 3300047318 Bacteria 5781
218 Ga0495674_0142270 3300047319 Bacteria 2016
219 Ga0495672_0072605 3300047320 Bacteria 1943
220 Ga0495676_0003194 3300047321 Bacteria 14809
221 Ga0495676_0003583 3300047321 Bacteria 14090
222 Ga0495676_0003639 3300047321 Bacteria 13983
223 Ga0495676_0014148 3300047321 Bacteria 7144
224 Ga0495676_0023048 3300047321 Bacteria 5409
225 Ga0495676_0032025 3300047321 Bacteria 4442
226 Ga0495676_0080437 3300047321 Bacteria 2474
227 Ga0495680_0008739 3300047322 Bacteria 9174
228 Ga0495687_001773 3300047443 Bacteria 19035
229 Ga0495687_028747 3300047443 Bacteria 2581
230 Ga0495687_084283 3300047443 Bacteria 1235
231 Ga0495687_088541 3300047443 Bacteria 1191
232 Ga0495675_0004739 3300047444 Bacteria 8259
233 Ga0495675_0040361 3300047444 Bacteria 2974
234 Ga0495677_0065620 3300047445 Bacteria 1349
235 Ga0495685_000960 3300047447 Bacteria 8712
236 Ga0495685_001460 3300047447 Bacteria 7245
237 Ga0495685_003653 3300047447 Bacteria 4917
238 Ga0495685_007913 3300047447 Bacteria 3519
239 Ga0495685_024236 3300047447 Bacteria 2088
240 Ga0495685_027382 3300047447 Bacteria 1960
241 Ga0495685_061883 3300047447 Bacteria 1260
242 Ga0495681_0002035 3300047470 Bacteria 14732
243 Ga0495681_0003658 3300047470 Bacteria 10681
244 Ga0495684_0023289 3300047471 Bacteria 4762
245 Ga0495686_0023839 3300047472 Bacteria 4027
246 Ga0495593_0000340 3300047673 Bacteria 25830
247 Ga0495593_0080252 3300047673 Bacteria 1688
248 Ga0495602_0057275 3300048088 Bacteria 3420
249 Ga0495602_0132631 3300048088 Bacteria 1984
250 Ga0495614_0000349 3300048089 Bacteria 18391
251 Ga0495614_0032622 3300048089 Bacteria 2241
252 Ga0495614_0053682 3300048089 Bacteria 1728
253 Ga0495626_0058412 3300048091 Bacteria 1762
254 Ga0495682_0020614 3300049460 Bacteria 2474
255 Ga0501031_0004394 3300049568 Bacteria 9135
256 Ga0501031_0033357 3300049568 Bacteria 3358
257 Ga0501031_0038371 3300049568 Bacteria 3126
258 Ga0501031_0069562 3300049568 Bacteria 2293
259 Ga0501032_0000839 3300049569 Bacteria 24970
260 Ga0501032_0017332 3300049569 Bacteria 5056
261 Ga0501032_0025139 3300049569 Bacteria 4106
262 Ga0501033_0013786 3300049570 Bacteria 6149
263 Ga0501033_0020583 3300049570 Bacteria 4985
264 Ga0501033_0046646 3300049570 Bacteria 3221
265 Ga0501033_0120368 3300049570 Bacteria 1905
266 Ga0501034_0003222 3300049571 Bacteria 18678
267 Ga0501034_0004538 3300049571 Bacteria 15431
268 Ga0501034_0023290 3300049571 Bacteria 6310
269 Ga0501034_0023433 3300049571 Bacteria 6290
270 Ga0501034_0024250 3300049571 Bacteria 6169
271 Ga0501034_0033066 3300049571 Bacteria 5251
272 Ga0501034_0045229 3300049571 Bacteria 4449
273 Ga0501036_0000654 3300049572 Bacteria 25428
274 Ga0501036_0008965 3300049572 Bacteria 8226
275 Ga0501036_0010639 3300049572 Bacteria 7600
276 Ga0501036_0036089 3300049572 Bacteria 4182
277 Ga0501036_0042098 3300049572 Bacteria 3866
278 Ga0501037_0006150 3300049573 Bacteria 8768
279 Ga0501038_0000244 3300049574 Bacteria 46048
280 Ga0501038_0036606 3300049574 Bacteria 4305
281 Ga0501038_0049709 3300049574 Bacteria 3625
282 Ga0501038_0056403 3300049574 Bacteria 3373
283 Ga0501038_0060767 3300049574 Bacteria 3233
284 Ga0501039_0045434 3300049575 Bacteria 3393
285 Ga0501039_0055859 3300049575 Bacteria 3059
286 Ga0501040_0041534 3300049576 Bacteria 3132
287 Ga0501041_0001628 3300049577 Bacteria 12539
288 Ga0501042_0010781 3300049578 Bacteria 6144
289 Ga0501043_0002202 3300049579 Bacteria 16611
290 Ga0501043_0002533 3300049579 Bacteria 15457
291 Ga0501043_0005149 3300049579 Bacteria 10583
292 Ga0501043_0169166 3300049579 Bacteria 1705
293 Ga0501043_0282356 3300049579 Bacteria 1272
294 Ga0501046_0007822 3300049580 Bacteria 9380
295 Ga0501046_0018534 3300049580 Bacteria 5788
296 Ga0501046_0032063 3300049580 Bacteria 4256
297 Ga0501047_0002881 3300049581 Bacteria 16314
298 Ga0501047_0003100 3300049581 Bacteria 15774
299 Ga0501047_0049720 3300049581 Bacteria 4047
300 Ga0501047_0050668 3300049581 Bacteria 4009
301 Ga0501047_0063164 3300049581 Bacteria 3572
302 Ga0501047_0135396 3300049581 Bacteria 2344
303 Ga0501047_0185532 3300049581 Bacteria 1945
304 Ga0501048_0025531 3300049582 Bacteria 4305
305 Ga0501067_0012227 3300049583 Bacteria 4756
306 Ga0501068_0000677 3300049584 Bacteria 17420
307 Ga0501070_0001681 3300049586 Bacteria 19595
308 Ga0501070_0011325 3300049586 Bacteria 7536
309 Ga0501070_0052198 3300049586 Bacteria 3393
310 Ga0501071_0249106 3300049587 Bacteria 1341
311 Ga0501072_0005566 3300049588 Bacteria 9583
312 Ga0501073_0007496 3300049589 Bacteria 8107
313 Ga0501074_0009328 3300049590 Bacteria 7128
314 Ga0501074_0098504 3300049590 Bacteria 2092
315 Ga0501077_0007730 3300049593 Bacteria 6634
316 Ga0501079_0003192 3300049741 Bacteria 12010
317 Ga0501083_0003941 3300049744 Bacteria 10430
318 Ga0501282_000971 3300049778 Bacteria 3248
319 Ga0501035_0001352 3300049822 Bacteria 25241
320 Ga0501035_0016254 3300049822 Bacteria 6866
321 Ga0501035_0059094 3300049822 Bacteria 3414
322 Ga0501035_0103264 3300049822 Bacteria 2500
323 Ga0501044_0000401 3300049823 Bacteria 53413
324 Ga0501044_0001734 3300049823 Bacteria 25480
325 Ga0501044_0028618 3300049823 Bacteria 5881
326 Ga0501044_0059273 3300049823 Bacteria 3922
327 Ga0501044_0071448 3300049823 Bacteria 3529
328 Ga0501044_0116179 3300049823 Bacteria 2681
329 Ga0501044_0211849 3300049823 Bacteria 1891
330 Ga0501044_0325158 3300049823 Bacteria 1461
331 Ga0501045_0022039 3300049824 Bacteria 4559
332 Ga0501045_0040232 3300049824 Bacteria 3402
333 nmdc:mga03n38_1669_c1 3300050490 Bacteria 6519
334 nmdc:mga06z11_1006_c1 3300050494 Bacteria 10294
335 nmdc:mga04h51_8447_c1 3300050495 Bacteria 2755
336 Ga0500640_035523 3300053095 Bacteria 2190
337 Ga0500654_005221 3300053099 Bacteria 9189
338 Ga0500560_010256 3300053107 Bacteria 2339
339 Ga0500569_000425 3300053109 Bacteria 6895
340 Ga0500572_048239 3300053111 Bacteria 1260
341 Ga0500621_072033 3300053126 Bacteria 1392
342 Ga0500628_000581 3300053129 Bacteria 6673
343 Ga0500658_0023434 3300053134 Bacteria 2356
344 Ga0500573_0018653 3300053140 Bacteria 3958
345 Ga0500573_0020538 3300053140 Bacteria 3784
346 Ga0500600_0050721 3300053149 Bacteria 2355
347 Ga0500633_0001177 3300053160 Bacteria 4765
348 Ga0500656_000145 3300053732 Bacteria 4345
349 Ga0500587_000596 3300053739 Bacteria 4511
350 Ga0501084_0001951 3300054114 Bacteria 16471
351 Ga0466962_0002407 3300061719 Bacteria 8875
352 Ga0466962_0006410 3300061719 Bacteria 5650
353 Ga0466962_0013291 3300061719 Bacteria 3960
354 Ga0530510_0017331 3300061734 Bacteria 5104
355 2547411673 2547132111 Bacteria 8013147
356 2554258088 2554235005 Bacteria 6457341
357 2585300155 2582581312 Bacteria 7308206
358 2585308686 2582581313 Bacteria 10042643
359 2585318796 2582581314 Bacteria 11452267
360 2616695336 2616644814 Bacteria 11555299
361 2616904032 2616644941 Bacteria 8510691
362 2643765659 2643221548 Bacteria 8053412
363 2643898571 2643221578 Bacteria 9213798
364 2643948225 2643221587 Bacteria 7586415
365 2644173700 2643221631 Bacteria 8168043
366 2644264066 2643221647 Bacteria 10741251
367 2644388828 2643221670 Bacteria 6497041
368 2644406488 2643221673 Bacteria 9196637
369 2644429698 2643221677 Bacteria 7584031
370 2644436945 2643221678 Bacteria 9540101
371 2644459771 2643221682 Bacteria 6743283
372 2644628676 2643221714 Bacteria 9015452
373 2784588413 2784132148 Bacteria 8627943
374 2785343562 2784746763 Bacteria 9783172
375 2785369248 2784746768 Bacteria 10036182
376 2786670383 2786546132 Bacteria 10419719
377 2793980392 2791355406 Bacteria 11364898
378 2804847252 2802429296 Bacteria 7227771
379 2808841839 2808606359 Bacteria 9866990
380 2808920384 2808606375 Bacteria 9466072
381 2809232014 2808606448 Bacteria 8656184
382 2811848779 2808606982 Bacteria 7791042
383 2812358411 2811994879 Bacteria 9313447
384 2812480755 2811994917 Bacteria 7761064
385 2819697892 2818991463 Bacteria 7948711
386 2852636906 2852635781 Bacteria 8251373
387 2862179591 2862178590 Bacteria 8583590
388 2862285448 2862281513 Bacteria 9621493
389 2862296412 2862290372 Bacteria 7471434
390 2862514596 2862507626 Bacteria 9425308
391 2862579426 2862574272 Bacteria 10567477
392 2863404941 2863404153 Bacteria 9672205
393 2867349541 2867346516 Bacteria 7608576
394 2867430603 2867428634 Bacteria 9590268
395 2873155954 2873151551 Bacteria 8625867
396 2875394343 2875391855 Bacteria 7600475
397 2877681302 2877676314 Bacteria 9512378
398 2912720292 2912715099 Bacteria 9460473
399 2912724516 2912723979 Bacteria 8557534
400 2912760476 2912757875 Bacteria 7940295
401 2918504332 2918501144 Bacteria 8668083
402 2919469717 2919468124 Bacteria 9133025
403 2935392601 2935390628 Bacteria 7043367
404 2946050261 2946045630 Bacteria 8527308
405 2946067468 2946064051 Bacteria 8957905
406 2946075719 2946072368 Bacteria 8999607
407 2947229535 2947224130 Bacteria 9938529
408 2954007725 2954002825 Bacteria 9173742
409 2954386445 2954380949 Bacteria 10050426
410 2954676729 2954673503 Bacteria 9685905
411 2954687437 2954682443 Bacteria 9862841
412 2954697126 2954691527 Bacteria 10720516
413 2954705010 2954701450 Bacteria 10834262
414 2954716428 2954711539 Bacteria 10867210
415 2954726372 2954721474 Bacteria 10456478
416 2954735438 2954731030 Bacteria 10243860
417 2954745297 2954740390 Bacteria 10229294
418 2954754293 2954749733 Bacteria 10366972
419 2954764271 2954759201 Bacteria 9358192
420 2966602752 2966598605 Bacteria 7676064
421 2990046874 2990044586 Bacteria 6603797
422 2990068196 2990059506 Bacteria 9321252
423 2990089708 2990088156 Bacteria 6657676
424 2995468378 2995463766 Bacteria 8577691
425 2997601008 2997600082 Bacteria 9896405
426 3006324298 3006321560 Bacteria 8247479
427 3006394554 3006393351 Bacteria 6615579
428 3006429115 3006425503 Bacteria 6491253
429 3006496261 3006493962 Bacteria 8825450
430 8008485674 8008485437 Bacteria 7198341
431 8008567866 8008558824 Bacteria 10610750
432 8008579028 8008574985 Bacteria 7815457
433 8023628833 8023623736 Bacteria 8593882
434 8025415939 8025413630 Bacteria 7014048
435 8025480074 8025478263 Bacteria 8209203
436 8025530148 8025524527 Bacteria 7197316
437 8025536650 8025530807 Bacteria 8495698
438 8033689094 8033684223 Bacteria 6906479
439 8047896637 8047893842 Bacteria 11723082
440 8048134664 8048127548 Bacteria 11053136
441 8048362298 8048356638 Bacteria 11044339
442 8048373650 8048369669 Bacteria 11666822
443 8048384592 8048379754 Bacteria 11877923
444 8054164130 8054160619 Bacteria 7783213
445 8056450379 8056447290 Bacteria 7680491
446 8056668819 8056667051 Bacteria 6953971
447 8056833699 8056829672 Bacteria 9045328
448 Ga0307513_10054782
449 JGI24739J22299_10007392
450 JGI24737J22298_10008413
451 JGI24738J21930_10005364
452 rootH1_10000563
453 rootH2_10063986
454 rootL2_10042584
455 Ga0070674_100246943
456 Ga0070684_100243965
457 Ga0068855_100181021
458 Ga0068854_100349972
459 Ga0081455_10007869
460 Ga0081455_10021389
461 Ga0075363_100003666
462 Ga0070715_10008850
463 Ga0075367_10002171
464 Ga0105251_10020046
465 Ga0105250_10021683
466 Ga0114129_10018390
467 Ga0105248_10079941
468 Ga0105246_10001087
469 Ga0157372_10080646
470 Ga0182008_10000608
471 Ga0182007_10001466
472 Ga0183367_1005
473 Ga0207426_1001884
474 Ga0207426_1007037
475 Ga0207713_1042301
476 Ga0207647_10047143
477 Ga0207685_10017948
478 Ga0207661_10246674
479 Ga0209813_10026907
480 Ga0307517_10003673
481 Ga0307517_10032555
482 Ga0307515_10000054
483 Ga0268256_1007460
484 Ga0307513_10017398
485 Ga0307509_10019115
486 Ga0307508_10002248
487 Ga0307508_10030433
488 Ga0307514_10002847
489 Ga0307516_10003541
490 Ga0307516_10022400
491 Ga0307518_10010854
492 Ga0307507_10150105
493 Ga0307507_10162754
494 Ga0307510_10009333
495 Ga0307510_10021482
496 Ga0307510_10080950
497 Ga0395898_0004515
498 Ga0395898_0031261
499 Ga0439436_0000224
500 Ga0451835_0250204
501 Ga0451853_3096261
502 Ga0439433_0000054
503 Ga0439433_0003837
504 Ga0439448_0008548
505 Ga0439449_0004871
506 Ga0439449_0011509
507 Ga0439455_0000204
508 Ga0439457_001327
509 Ga0439457_001852
510 Ga0439462_0000933
511 Ga0450890_007952
512 Ga0450894_000119
513 Ga0450895_000330
514 Ga0450899_000575
515 Ga0450903_000857
516 Ga0450906_001939
517 Ga0439458_0003112
518 Ga0450908_010515
519 Ga0466969_0006837
520 Ga0466969_0008968
521 Ga0466972_0000961
522 Ga0466972_0004402
523 Ga0466972_0009810
524 Ga0466972_0097863
525 Ga0466965_0000189
526 Ga0466966_0001937
527 Ga0466966_0002232
528 Ga0466966_0052283
529 Ga0466961_0000701
530 Ga0466961_0005317
531 Ga0466961_0015792
532 Ga0466961_0056307
533 Ga0466963_0000593
534 Ga0466963_0003809
535 Ga0466963_0052007
536 Ga0466964_0008496
537 Ga0466964_0037650
538 Ga0466971_0001210
539 Ga0466970_0000692
540 Ga0466970_0031971
541 Ga0466957_0000672
542 Ga0466957_0233402
543 Ga0466960_0013261
544 Ga0466959_0003547
545 Ga0466958_0000356
546 Ga0466967_0006475
547 Ga0466967_0023000
548 Ga0466967_0039500
549 Ga0466967_0381781
550 Ga0495627_024329
551 Ga0495592_0003705
552 Ga0495592_0013613
553 Ga0495603_0000882
554 Ga0495603_0024238
555 Ga0495603_0056246
556 Ga0495603_0060299
557 Ga0495629_0005160
558 Ga0495629_0006020
559 Ga0495629_0006520
560 Ga0495629_0009306
561 Ga0495629_0020294
562 Ga0495629_0032836
563 Ga0495629_0078223
564 Ga0495629_0166964
565 Ga0495638_0018606
566 Ga0495651_0002115
567 Ga0495651_0029379
568 Ga0495651_0047075
569 Ga0495580_0021757
570 Ga0495605_0011087
571 Ga0495605_0108091
572 Ga0495605_0111135
573 Ga0495639_0031768
574 Ga0495662_0001917
575 Ga0495662_0016660
576 Ga0495664_0003333
577 Ga0495664_0004144
578 Ga0495585_0033586
579 Ga0495585_0045198
580 Ga0495594_0001837
581 Ga0495594_0032269
582 Ga0495594_0081727
583 Ga0495583_0040229
584 Ga0495606_0031343
585 Ga0495610_0045662
586 Ga0495616_0004153
587 Ga0495616_0056602
588 Ga0495618_0007540
589 Ga0495618_0011095
590 Ga0495618_0120853
591 Ga0495620_0046267
592 Ga0495620_0056341
593 Ga0495630_0055104
594 Ga0495631_0018641
595 Ga0495637_0079040
596 Ga0495643_0004924
597 Ga0495643_0018872
598 Ga0495644_0040726
599 Ga0495648_0050499
600 Ga0495652_0008027
601 Ga0495652_0008044
602 Ga0495654_0036477
603 Ga0495640_0001993
604 Ga0495640_0024954
605 Ga0495640_0108656
606 Ga0495640_0113938
607 Ga0495587_0001112
608 Ga0495609_0021426
609 Ga0495597_0040136
610 Ga0495597_0060955
611 Ga0495622_0029219
612 Ga0495667_0078249
613 Ga0495667_0079613
614 Ga0495668_0066235
615 Ga0495668_0068836
616 Ga0495668_0074985
617 Ga0495634_0002311
618 Ga0495634_0190725
619 Ga0495611_0076284
620 Ga0495625_0072322
621 Ga0495635_0031726
622 Ga0495588_0002204
623 Ga0495588_0002441
624 Ga0495588_0006215
625 Ga0495588_0081196
626 Ga0495657_0001809
627 Ga0495657_0011842
628 Ga0495657_0013046
629 Ga0495657_0080917
630 Ga0495646_0004109
631 Ga0495658_0024166
632 Ga0495658_0041008
633 Ga0495613_0000988
634 Ga0495613_0002046
635 Ga0495613_0012754
636 Ga0495613_0069680
637 Ga0495624_0025370
638 Ga0495624_0027750
639 Ga0495624_0037092
640 Ga0495670_0006348
641 Ga0495670_0025637
642 Ga0495671_0003809
643 Ga0495649_0025145
644 Ga0495649_0108528
645 Ga0495589_0009307
646 Ga0495589_0010969
647 Ga0495589_0014689
648 Ga0495589_0018560
649 Ga0495589_0036817
650 Ga0495589_0060068
651 Ga0495589_0100299
652 Ga0495600_0006521
653 Ga0495600_0044400
654 Ga0495600_0057891
655 Ga0495660_0003248
656 Ga0495581_0007204
657 Ga0495581_0015900
658 Ga0495581_0086944
659 Ga0495604_0000674
660 Ga0495604_0000735
661 Ga0495604_0007554
662 Ga0495604_0029568
663 Ga0495636_0000831
664 Ga0495636_0003966
665 Ga0495674_0142270
666 Ga0495672_0072605
667 Ga0495676_0003194
668 Ga0495676_0003583
669 Ga0495676_0003639
670 Ga0495676_0014148
671 Ga0495676_0023048
672 Ga0495676_0032025
673 Ga0495676_0080437
674 Ga0495680_0008739
675 Ga0495687_001773
676 Ga0495687_028747
677 Ga0495687_084283
678 Ga0495687_088541
679 Ga0495675_0004739
680 Ga0495675_0040361
681 Ga0495677_0065620
682 Ga0495685_000960
683 Ga0495685_001460
684 Ga0495685_003653
685 Ga0495685_007913
686 Ga0495685_024236
687 Ga0495685_027382
688 Ga0495685_061883
689 Ga0495681_0002035
690 Ga0495681_0003658
691 Ga0495684_0023289
692 Ga0495686_0023839
693 Ga0495593_0000340
694 Ga0495593_0080252
695 Ga0495602_0057275
696 Ga0495602_0132631
697 Ga0495614_0000349
698 Ga0495614_0032622
699 Ga0495614_0053682
700 Ga0495626_0058412
701 Ga0495682_0020614
702 Ga0501031_0004394
703 Ga0501031_0033357
704 Ga0501031_0038371
705 Ga0501031_0069562
706 Ga0501032_0000839
707 Ga0501032_0017332
708 Ga0501032_0025139
709 Ga0501033_0013786
710 Ga0501033_0020583
711 Ga0501033_0046646
712 Ga0501033_0120368
713 Ga0501034_0003222
714 Ga0501034_0004538
715 Ga0501034_0023290
716 Ga0501034_0023433
717 Ga0501034_0024250
718 Ga0501034_0033066
719 Ga0501034_0045229
720 Ga0501036_0000654
721 Ga0501036_0008965
722 Ga0501036_0010639
723 Ga0501036_0036089
724 Ga0501036_0042098
725 Ga0501037_0006150
726 Ga0501038_0000244
727 Ga0501038_0036606
728 Ga0501038_0049709
729 Ga0501038_0056403
730 Ga0501038_0060767
731 Ga0501039_0045434
732 Ga0501039_0055859
733 Ga0501040_0041534
734 Ga0501041_0001628
735 Ga0501042_0010781
736 Ga0501043_0002202
737 Ga0501043_0002533
738 Ga0501043_0005149
739 Ga0501043_0169166
740 Ga0501043_0282356
741 Ga0501046_0007822
742 Ga0501046_0018534
743 Ga0501046_0032063
744 Ga0501047_0002881
745 Ga0501047_0003100
746 Ga0501047_0049720
747 Ga0501047_0050668
748 Ga0501047_0063164
749 Ga0501047_0135396
750 Ga0501047_0185532
751 Ga0501048_0025531
752 Ga0501067_0012227
753 Ga0501068_0000677
754 Ga0501070_0001681
755 Ga0501070_0011325
756 Ga0501070_0052198
757 Ga0501071_0249106
758 Ga0501072_0005566
759 Ga0501073_0007496
760 Ga0501074_0009328
761 Ga0501074_0098504
762 Ga0501077_0007730
763 Ga0501079_0003192
764 Ga0501083_0003941
765 Ga0501282_000971
766 Ga0501035_0001352
767 Ga0501035_0016254
768 Ga0501035_0059094
769 Ga0501035_0103264
770 Ga0501044_0000401
771 Ga0501044_0001734
772 Ga0501044_0028618
773 Ga0501044_0059273
774 Ga0501044_0071448
775 Ga0501044_0116179
776 Ga0501044_0211849
777 Ga0501044_0325158
778 Ga0501045_0022039
779 Ga0501045_0040232
780 nmdc:mga03n38_1669_c1
781 nmdc:mga06z11_1006_c1
782 nmdc:mga04h51_8447_c1
783 Ga0500640_035523
784 Ga0500654_005221
785 Ga0500560_010256
786 Ga0500569_000425
787 Ga0500572_048239
788 Ga0500621_072033
789 Ga0500628_000581
790 Ga0500658_0023434
791 Ga0500573_0018653
792 Ga0500573_0020538
793 Ga0500600_0050721
794 Ga0500633_0001177
795 Ga0500656_000145
796 Ga0500587_000596
797 Ga0501084_0001951
798 Ga0466962_0002407
799 Ga0466962_0006410
800 Ga0466962_0013291
801 Ga0530510_0017331
802 2547411673
803 2554258088
804 2585300155
805 2585308686
806 2585318796
807 2616695336
808 2616904032
809 2643765659
810 2643898571
811 2643948225
812 2644173700
813 2644264066
814 2644388828
815 2644406488
816 2644429698
817 2644436945
818 2644459771
819 2644628676
820 2784588413
821 2785343562
822 2785369248
823 2786670383
824 2793980392
825 2804847252
826 2808841839
827 2808920384
828 2809232014
829 2811848779
830 2812358411
831 2812480755
832 2819697892
833 2852636906
834 2862179591
835 2862285448
836 2862296412
837 2862514596
838 2862579426
839 2863404941
840 2867349541
841 2867430603
842 2873155954
843 2875394343
844 2877681302
845 2912720292
846 2912724516
847 2912760476
848 2918504332
849 2919469717
850 2935392601
851 2946050261
852 2946067468
853 2946075719
854 2947229535
855 2954007725
856 2954386445
857 2954676729
858 2954687437
859 2954697126
860 2954705010
861 2954716428
862 2954726372
863 2954735438
864 2954745297
865 2954754293
866 2954764271
867 2966602752
868 2990046874
869 2990068196
870 2990089708
871 2995468378
872 2997601008
873 3006324298
874 3006394554
875 3006429115
876 3006496261
877 8008485674
878 8008567866
879 8008579028
880 8023628833
881 8025415939
882 8025480074
883 8025530148
884 8025536650
885 8033689094
886 8047896637
887 8048134664
888 8048362298
889 8048373650
890 8048384592
891 8054164130
892 8056450379
893 8056668819
894 8056833699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

118

366

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.8067 34 315
4ymk-assembly2.cif.gz_D crystal structure of stearoyl-coenzyme a desaturase 1 0.7568 18 325
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.7447 34 315
4ymk-assembly2.cif.gz_D crystal structure of stearoyl-coenzyme a desaturase 1 0.7284 18 325
6ukj-assembly1.cif.gz_A single-particle cryo-em structure of plasmodium falciparum chloroquine resistance transporter (pfcrt) 7g8 isoform 0.2512 35 300
ID Description Score Start End Superfamily
af_P0ADJ8_1_145_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3287 29 256 1.20.1250.20
af_P0ADJ8_1_145_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3107 29 256 1.20.1250.20
af_A0A1D6MTR7_293_503_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3049 59 298 1.20.1250.20
4zyrA01 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.297 60 261 1.20.1250.20
4zyrA01 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2881 60 261 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0F4JER7-F1-model_v4 deleted 0.9175 19 315
AF-A0A178WS96-F1-model_v4 Fatty acid desaturase 0.9109 26 315 GO:0006631
GO:0016020
GO:0016717
AF-A0A3N1H7R4-F1-model_v4 Stearoyl-CoA desaturase (Delta-9 desaturase) 0.9105 27 315 GO:0006631
GO:0016020
GO:0016717
AF-A0A1H5RJE6-F1-model_v4 Stearoyl-CoA desaturase (Delta-9 desaturase) 0.907 27 315 GO:0006631
GO:0016020
GO:0016717
AF-A0A4V6PCI6-F1-model_v4 Acyl-CoA desaturase 0.9062 27 315 GO:0006631
GO:0016020
GO:0016717

Map