F445892

General Info

Members Datasets Scaffolds Average Seq Length
447 286 894 409

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100169146|Ga0070713_1001691462
Length 390
Sequence MNYSDFFIAAMTRLRSERRYRVFADLERIAGRFPQAIWHSPQGKKNVVIWCSNDYLGMGQHPKVIGAMVETATRMGTGAGGTRNIAGNNHPLVELERELTDLHGKEAALVFTSGYISNETGISTLARQMPNCLILSDALNHNSMIEGVRQAHCEKQIFRHNDMLHLEVLLAATAPDRPKLIVFESLYSMDGDVAPVNRICDLAERYGAMTYIDEVHAVGMYGPRGGGISVIEGTLAKAFGCIGGYIAGSHIVIDTVRSYAPGFIFTTALPPAVCAAXXXAIRHLKTSQWERERLQDRAARTPVMHSPSHIVPVFVGDPARCKEASDLLLADHNIYIQPINYPTVPKGAERLRITPSPYHDDKLIDALAEALVDVWQRLNLPTTQHVLAAE

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
65 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
133 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
134 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
135 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
268 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
269 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
270 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
273 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
274 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
275 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
276 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
277 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
278 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
279 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
280 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
281 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
282 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
283 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
284 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
285 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
286 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.97
Metatranscriptomes 0
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 3.36
Rhizoplane 8.28
Rhizosphere 77.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100169146 3300005436 Bacteria 1957
2 JGI24743J22301_10000634 3300001991 Bacteria 4283
3 JGI24750J21931_1001530 3300002070 Bacteria 2847
4 JGI24744J21845_10000126 3300002077 Bacteria 10663
5 JGI24033J26618_1002027 3300002155 Bacteria 2037
6 JGI24034J26672_10001317 3300002239 Bacteria 3274
7 Ga0065712_10013894 3300005290 Bacteria 2291
8 Ga0065715_10009858 3300005293 Bacteria 2279
9 Ga0070683_100015249 3300005329 Bacteria 6747
10 Ga0070670_100025093 3300005331 Bacteria 5128
11 Ga0070670_100053731 3300005331 Bacteria 3459
12 Ga0068868_100022773 3300005338 Bacteria 4734
13 Ga0070691_10038165 3300005341 Bacteria 2268
14 Ga0070687_100006358 3300005343 Bacteria 4837
15 Ga0070668_100119147 3300005347 Bacteria 2108
16 Ga0070675_100035508 3300005354 Bacteria 4051
17 Ga0070671_100004814 3300005355 Bacteria 10733
18 Ga0070671_100013416 3300005355 Bacteria 6606
19 Ga0070673_100063892 3300005364 Bacteria 2930
20 Ga0070709_10000143 3300005434 Bacteria 47770
21 Ga0070709_10003829 3300005434 Bacteria 8095
22 Ga0070709_10057692 3300005434 Bacteria 2460
23 Ga0070714_100149350 3300005435 Bacteria 2104
24 Ga0070714_100200008 3300005435 Bacteria 1827
25 Ga0070713_100001974 3300005436 Bacteria 13237
26 Ga0070713_100055014 3300005436 Bacteria 3305
27 Ga0070710_10000126 3300005437 Bacteria 35287
28 Ga0070710_10001107 3300005437 Bacteria 12743
29 Ga0070711_100000463 3300005439 Bacteria 21241
30 Ga0070711_100008964 3300005439 Bacteria 6139
31 Ga0070711_100111225 3300005439 Bacteria 2011
32 Ga0070705_100033299 3300005440 Bacteria 2872
33 Ga0070662_100041594 3300005457 Bacteria 3279
34 Ga0070662_100200248 3300005457 Bacteria 1584
35 Ga0070681_10146242 3300005458 Bacteria 2292
36 Ga0068867_100012530 3300005459 Bacteria 5999
37 Ga0070685_10001346 3300005466 Bacteria 12887
38 Ga0070698_100182632 3300005471 Bacteria 2036
39 Ga0070698_100282819 3300005471 Bacteria 1590
40 Ga0070699_100183627 3300005518 Bacteria 1857
41 Ga0070679_100098794 3300005530 Bacteria 2906
42 Ga0070684_100018253 3300005535 Bacteria 5776
43 Ga0070672_100035749 3300005543 Bacteria 3777
44 Ga0070672_100276418 3300005543 Bacteria 1419
45 Ga0070686_100097812 3300005544 Bacteria 1976
46 Ga0070693_100068772 3300005547 Bacteria 2079
47 Ga0070665_100171486 3300005548 Bacteria 2170
48 Ga0070704_100069555 3300005549 Bacteria 2551
49 Ga0068854_100012312 3300005578 Bacteria 5598
50 Ga0068856_100023121 3300005614 Bacteria 6046
51 Ga0068856_100162595 3300005614 Bacteria 2244
52 Ga0070702_100001073 3300005615 Bacteria 10909
53 Ga0068852_100032897 3300005616 Bacteria 4299
54 Ga0068866_10003102 3300005718 Bacteria 6846
55 Ga0068861_100034855 3300005719 Bacteria 3724
56 Ga0068870_10002209 3300005840 Bacteria 8065
57 Ga0068863_100074941 3300005841 Bacteria 3202
58 Ga0068858_100013035 3300005842 Bacteria 7842
59 Ga0068860_100008490 3300005843 Bacteria 10238
60 Ga0068862_100022950 3300005844 Bacteria 5224
61 Ga0081455_10001067 3300005937 Bacteria 34511
62 Ga0081455_10014128 3300005937 Bacteria 7849
63 Ga0081455_10019796 3300005937 Bacteria 6356
64 Ga0081455_10037781 3300005937 Bacteria 4282
65 Ga0081540_1000190 3300005983 Bacteria 63614
66 Ga0081540_1000195 3300005983 Bacteria 62863
67 Ga0081540_1000981 3300005983 Bacteria 25742
68 Ga0081540_1001153 3300005983 Bacteria 23273
69 Ga0081540_1001429 3300005983 Bacteria 20644
70 Ga0081540_1001458 3300005983 Bacteria 20433
71 Ga0081540_1003186 3300005983 Bacteria 13060
72 Ga0081540_1004038 3300005983 Bacteria 11365
73 Ga0081540_1004120 3300005983 Bacteria 11225
74 Ga0081540_1005046 3300005983 Bacteria 9907
75 Ga0081540_1005679 3300005983 Bacteria 9270
76 Ga0081540_1016849 3300005983 Bacteria 4551
77 Ga0081540_1055618 3300005983 Bacteria 1927
78 Ga0070717_10026354 3300006028 Bacteria 4636
79 Ga0075363_100069596 3300006048 Bacteria 1909
80 Ga0075432_10008363 3300006058 Bacteria 3528
81 Ga0070715_10001258 3300006163 Bacteria 7263
82 Ga0070712_100005765 3300006175 Bacteria 7654
83 Ga0070712_100079428 3300006175 Bacteria 2371
84 Ga0070712_100082154 3300006175 Bacteria 2337
85 Ga0070712_100152387 3300006175 Bacteria 1776
86 Ga0075362_10074706 3300006177 Bacteria 1554
87 Ga0075427_10000476 3300006194 Bacteria 4588
88 Ga0075427_10002698 3300006194 Bacteria 2404
89 Ga0097621_100019246 3300006237 Bacteria 5237
90 Ga0075428_100010708 3300006844 Bacteria 10193
91 Ga0075428_100096000 3300006844 Bacteria 3231
92 Ga0075428_100129705 3300006844 Bacteria 2743
93 Ga0075430_100000056 3300006846 Bacteria 59280
94 Ga0075430_100001587 3300006846 Bacteria 18569
95 Ga0075431_100006692 3300006847 Bacteria 11448
96 Ga0075431_100117613 3300006847 Bacteria 2743
97 Ga0075433_10000929 3300006852 Bacteria 20656
98 Ga0075433_10005204 3300006852 Bacteria 10194
99 Ga0075434_100000905 3300006871 Bacteria 23774
100 Ga0075434_100009614 3300006871 Bacteria 9030
101 Ga0075434_100030323 3300006871 Bacteria 5325
102 Ga0075434_100033311 3300006871 Bacteria 5084
103 Ga0075429_100000836 3300006880 Bacteria 24175
104 Ga0075429_100031581 3300006880 Bacteria 4602
105 Ga0068865_100019567 3300006881 Bacteria 4382
106 Ga0099824_1026689 3300006942 Bacteria 2925
107 Ga0099823_1000409 3300006944 Bacteria 27729
108 Ga0075435_100059060 3300007076 Bacteria 3108
109 Ga0075435_100084227 3300007076 Bacteria 2616
110 Ga0099795_10004345 3300007788 Bacteria 3645
111 Ga0105250_10023291 3300009092 Bacteria 2495
112 Ga0111539_10000250 3300009094 Bacteria 64548
113 Ga0111539_10049281 3300009094 Bacteria 5024
114 Ga0111539_10121594 3300009094 Bacteria 3059
115 Ga0111539_10177392 3300009094 Bacteria 2489
116 Ga0105245_10042228 3300009098 Bacteria 4068
117 Ga0105245_10362531 3300009098 Bacteria 1439
118 Ga0105247_10004705 3300009101 Bacteria 8695
119 Ga0105247_10155597 3300009101 Bacteria 1510
120 Ga0114129_10001510 3300009147 Bacteria 31467
121 Ga0114129_10041632 3300009147 Bacteria 6471
122 Ga0114129_10104002 3300009147 Bacteria 3924
123 Ga0114129_10425416 3300009147 Bacteria 1746
124 Ga0114129_10555076 3300009147 Bacteria 1493
125 Ga0105242_10158962 3300009176 Bacteria 1976
126 Ga0105248_10003989 3300009177 Bacteria 16319
127 Ga0105248_10031688 3300009177 Bacteria 5906
128 Ga0105237_10064639 3300009545 Bacteria 3654
129 Ga0105249_10058280 3300009553 Bacteria 3540
130 Ga0105239_10041319 3300010375 Bacteria 5054
131 Ga0157374_10012668 3300013296 Bacteria 7344
132 Ga0157378_10025627 3300013297 Bacteria 5191
133 Ga0157378_10270712 3300013297 Bacteria 1633
134 Ga0163162_10206396 3300013306 Bacteria 2094
135 Ga0157375_10013064 3300013308 Bacteria 7380
136 Ga0157375_10164054 3300013308 Bacteria 2365
137 Ga0163163_10027208 3300014325 Bacteria 5476
138 Ga0163163_10132818 3300014325 Bacteria 2529
139 Ga0157380_10036689 3300014326 Bacteria 3794
140 Ga0157377_10013536 3300014745 Bacteria 4130
141 Ga0157379_10004245 3300014968 Bacteria 12235
142 Ga0157379_10019444 3300014968 Bacteria 5999
143 Ga0157379_10099939 3300014968 Bacteria 2605
144 Ga0157376_10083590 3300014969 Bacteria 2747
145 Ga0157376_10234115 3300014969 Bacteria 1707
146 Ga0163161_10031582 3300017792 Bacteria 3774
147 Ga0213874_10010431 3300021377 Bacteria 2326
148 Ga0213875_10000009 3300021388 Bacteria 451129
149 Ga0213875_10000051 3300021388 Bacteria 142260
150 Ga0207696_1016252 3300025711 Bacteria 2495
151 Ga0207692_10000587 3300025898 Bacteria 12889
152 Ga0207692_10040444 3300025898 Bacteria 2300
153 Ga0207642_10036729 3300025899 Bacteria 2105
154 Ga0207710_10012524 3300025900 Bacteria 3569
155 Ga0207688_10000156 3300025901 Bacteria 29285
156 Ga0207647_10026809 3300025904 Bacteria 3764
157 Ga0207647_10095958 3300025904 Bacteria 1765
158 Ga0207685_10004394 3300025905 Bacteria 3577
159 Ga0207699_10000213 3300025906 Bacteria 34254
160 Ga0207699_10089671 3300025906 Bacteria 1928
161 Ga0207645_10003289 3300025907 Bacteria 12326
162 Ga0207645_10044921 3300025907 Bacteria 2825
163 Ga0207643_10001560 3300025908 Bacteria 13032
164 Ga0207707_10055580 3300025912 Bacteria 3443
165 Ga0207693_10002065 3300025915 Bacteria 17553
166 Ga0207693_10008230 3300025915 Bacteria 8538
167 Ga0207693_10095758 3300025915 Bacteria 2327
168 Ga0207693_10112413 3300025915 Bacteria 2136
169 Ga0207693_10143263 3300025915 Bacteria 1879
170 Ga0207663_10000304 3300025916 Bacteria 21354
171 Ga0207663_10006960 3300025916 Bacteria 5829
172 Ga0207662_10000800 3300025918 Bacteria 14489
173 Ga0207657_10081201 3300025919 Bacteria 2724
174 Ga0207657_10246266 3300025919 Bacteria 1426
175 Ga0207650_10001263 3300025925 Bacteria 18372
176 Ga0207687_10016885 3300025927 Bacteria 4799
177 Ga0207700_10066743 3300025928 Bacteria 2751
178 Ga0207664_10207049 3300025929 Bacteria 1696
179 Ga0207644_10004720 3300025931 Bacteria 8852
180 Ga0207644_10041829 3300025931 Bacteria 3244
181 Ga0207690_10015159 3300025932 Bacteria 4667
182 Ga0207706_10014012 3300025933 Bacteria 7270
183 Ga0207706_10055941 3300025933 Bacteria 3479
184 Ga0207709_10008238 3300025935 Bacteria 5774
185 Ga0207670_10001387 3300025936 Bacteria 12739
186 Ga0207669_10027598 3300025937 Bacteria 3111
187 Ga0207704_10018326 3300025938 Bacteria 3652
188 Ga0207704_10129905 3300025938 Bacteria 1742
189 Ga0207665_10000607 3300025939 Bacteria 24080
190 Ga0207691_10010809 3300025940 Bacteria 8761
191 Ga0207711_10044631 3300025941 Bacteria 3784
192 Ga0207689_10087580 3300025942 Bacteria 2558
193 Ga0207679_10032224 3300025945 Bacteria 3676
194 Ga0207712_10135248 3300025961 Bacteria 1884
195 Ga0207668_10000974 3300025972 Bacteria 17209
196 Ga0207668_10048370 3300025972 Bacteria 2918
197 Ga0207677_10007265 3300026023 Bacteria 6110
198 Ga0207703_10003233 3300026035 Bacteria 13701
199 Ga0207678_10013631 3300026067 Bacteria 7139
200 Ga0207641_10002012 3300026088 Bacteria 19376
201 Ga0207648_10001020 3300026089 Bacteria 31538
202 Ga0207676_10023770 3300026095 Bacteria 4527
203 Ga0207675_100002318 3300026118 Bacteria 18901
204 Ga0207675_100008279 3300026118 Bacteria 9796
205 Ga0207683_10106765 3300026121 Bacteria 2504
206 Ga0207698_10062331 3300026142 Bacteria 2911
207 Ga0209389_1000111 3300027296 Bacteria 72517
208 Ga0209489_100220 3300027361 Bacteria 95167
209 Ga0209700_100041 3300027363 Bacteria 168380
210 Ga0209179_1004958 3300027512 Bacteria 2049
211 Ga0209971_1009623 3300027682 Bacteria 2289
212 Ga0207428_10000111 3300027907 Bacteria 111333
213 Ga0207428_10019901 3300027907 Bacteria 5716
214 Ga0207428_10098951 3300027907 Bacteria 2256
215 Ga0207428_10127617 3300027907 Bacteria 1947
216 Ga0268265_10007712 3300028380 Bacteria 7261
217 Ga0268264_10000633 3300028381 Bacteria 41830
218 Ga0268264_10009845 3300028381 Bacteria 7912
219 Ga0268264_10019768 3300028381 Bacteria 5501
220 Ga0268264_10055388 3300028381 Bacteria 3313
221 Ga0265334_10013317 3300028573 Bacteria 3445
222 Ga0265338_10028366 3300028800 Bacteria 5584
223 Ga0265332_10010385 3300031238 Bacteria 4144
224 Ga0265325_10015892 3300031241 Bacteria 4220
225 Ga0265339_10000033 3300031249 Bacteria 130595
226 Ga0265339_10066247 3300031249 Bacteria 1934
227 Ga0265331_10024786 3300031250 Bacteria 3031
228 Ga0307509_10004428 3300031507 Bacteria 20293
229 Ga0265313_10000049 3300031595 Bacteria 111617
230 Ga0307508_10000001 3300031616 Bacteria 553635
231 Ga0307508_10053792 3300031616 Bacteria 3571
232 Ga0265314_10053123 3300031711 Bacteria 2812
233 Ga0265342_10006685 3300031712 Bacteria 8551
234 Ga0265342_10017386 3300031712 Bacteria 4679
235 Ga0307516_10070518 3300031730 Bacteria 3358
236 Ga0307516_10209731 3300031730 Bacteria 1663
237 Ga0307507_10021477 3300033179 Bacteria 7181
238 Ga0307507_10041726 3300033179 Bacteria 4586
239 Ga0373926_0007197 3300035083 Bacteria 3709
240 Ga0373944_0001902 3300035089 Bacteria 5280
241 Ga0373923_0047136 3300035111 Bacteria 1795
242 Ga0373945_0010017 3300035116 Bacteria 3115
243 Ga0373953_0008568 3300035117 Bacteria 3478
244 Ga0373954_0026799 3300035118 Bacteria 2643
245 Ga0373956_0005286 3300035119 Bacteria 5168
246 Ga0373956_0007112 3300035119 Bacteria 4503
247 Ga0373943_0003237 3300035170 Bacteria 7390
248 Ga0373943_0021846 3300035170 Bacteria 2958
249 Ga0373946_0018987 3300035171 Bacteria 2644
250 Ga0373927_0040821 3300035695 Bacteria 3009
251 Ga0373933_0000260 3300035724 Bacteria 34773
252 Ga0373933_0006205 3300035724 Bacteria 6503
253 Ga0373947_0013561 3300035725 Bacteria 4669
254 Ga0373937_0022045 3300036401 Bacteria 5721
255 Ga0373937_0058642 3300036401 Bacteria 3536
256 Ga0373925_0187201 3300037068 Bacteria 1641
257 Ga0436364_0404737 3300037853 Bacteria 51038
258 Ga0436364_0533263 3300037853 Bacteria 2148
259 Ga0436364_1006055 3300037853 Bacteria 1951
260 Ga0436364_1179546 3300037853 Bacteria 2359
261 Ga0436364_1201245 3300037853 Bacteria 33298
262 Ga0436365_0142727 3300039437 Bacteria 1748
263 Ga0436360_0814153 3300039438 Bacteria 1266
264 Ga0436363_0361553 3300039450 Bacteria 3403
265 Ga0436363_1104415 3300039450 Bacteria 7573
266 Ga0439440_0025500 3300042993 Bacteria 1362
267 Ga0495592_0005951 3300046454 Bacteria 9062
268 Ga0495592_0033262 3300046454 Bacteria 3889
269 Ga0495603_0002911 3300046455 Bacteria 10127
270 Ga0495603_0006879 3300046455 Bacteria 6824
271 Ga0495590_0043577 3300046457 Bacteria 1565
272 Ga0495629_0054544 3300046459 Bacteria 2795
273 Ga0495641_0017455 3300046461 Bacteria 3740
274 Ga0495651_0003880 3300046462 Bacteria 11434
275 Ga0495653_0009261 3300046463 Bacteria 8056
276 Ga0495653_0009512 3300046463 Bacteria 7950
277 Ga0495580_0034380 3300046472 Bacteria 3649
278 Ga0495584_0030569 3300046491 Bacteria 2727
279 Ga0495584_0089193 3300046491 Bacteria 1555
280 Ga0495594_0025417 3300046499 Bacteria 3183
281 Ga0495594_0054422 3300046499 Bacteria 2205
282 Ga0495608_0001827 3300046511 Bacteria 15194
283 Ga0495608_0007303 3300046511 Bacteria 7810
284 Ga0495618_0000816 3300046514 Bacteria 21684
285 Ga0495630_0034922 3300046517 Bacteria 3756
286 Ga0495644_0012056 3300046523 Bacteria 3323
287 Ga0495644_0020164 3300046523 Bacteria 2544
288 Ga0495652_0023615 3300046529 Bacteria 5450
289 Ga0495640_0033455 3300046533 Bacteria 3650
290 Ga0495587_0006212 3300046536 Bacteria 7794
291 Ga0495587_0012358 3300046536 Bacteria 5376
292 Ga0495598_0004398 3300046537 Bacteria 3047
293 Ga0495667_0016204 3300046559 Bacteria 5033
294 Ga0495656_0004243 3300046615 Bacteria 4894
295 Ga0495635_0029045 3300046663 Bacteria 3844
296 Ga0495657_0002009 3300046675 Bacteria 17316
297 Ga0495657_0006613 3300046675 Bacteria 9055
298 Ga0495599_0001982 3300046678 Bacteria 11853
299 Ga0495599_0007163 3300046678 Bacteria 6751
300 Ga0495623_0001531 3300046679 Bacteria 15616
301 Ga0495623_0022606 3300046679 Bacteria 4060
302 Ga0495646_0074417 3300046680 Bacteria 1993
303 Ga0495658_0005039 3300046683 Bacteria 6490
304 Ga0495624_0005784 3300046690 Bacteria 8855
305 Ga0495600_0025770 3300046809 Bacteria 3790
306 Ga0495581_0040933 3300047315 Bacteria 2681
307 Ga0495604_0009734 3300047317 Bacteria 7601
308 Ga0495604_0039778 3300047317 Bacteria 3694
309 Ga0495676_0029419 3300047321 Bacteria 4677
310 Ga0495676_0049555 3300047321 Bacteria 3375
311 Ga0495680_0017126 3300047322 Bacteria 6201
312 Ga0495675_0002532 3300047444 Bacteria 10937
313 Ga0495675_0007409 3300047444 Bacteria 6755
314 Ga0495684_0029683 3300047471 Bacteria 4196
315 Ga0495684_0096893 3300047471 Bacteria 2232
316 Ga0495684_0097693 3300047471 Bacteria 2221
317 Ga0495602_0002195 3300048088 Bacteria 19715
318 Ga0495602_0027478 3300048088 Bacteria 5466
319 Ga0496100_0163413 3300048903 Bacteria 1598
320 Ga0496100_0185592 3300048903 Bacteria 1506
321 Ga0496101_0001815 3300048904 Bacteria 12856
322 Ga0496101_0039519 3300048904 Bacteria 3356
323 Ga0496102_0011376 3300048905 Bacteria 7669
324 Ga0496102_0036560 3300048905 Bacteria 4424
325 Ga0496102_0060060 3300048905 Bacteria 3478
326 Ga0496102_0061560 3300048905 Bacteria 3435
327 Ga0496102_0078381 3300048905 Bacteria 3041
328 Ga0496103_0001267 3300048906 Bacteria 17240
329 Ga0496103_0101497 3300048906 Bacteria 1821
330 Ga0496104_0005191 3300048907 Bacteria 11386
331 Ga0496104_0019169 3300048907 Bacteria 6254
332 Ga0496104_0031479 3300048907 Bacteria 4934
333 Ga0496104_0065055 3300048907 Bacteria 3459
334 Ga0496105_0000247 3300048908 Bacteria 36346
335 Ga0496105_0001679 3300048908 Bacteria 15785
336 Ga0496106_0001062 3300048909 Bacteria 20263
337 Ga0496106_0001280 3300048909 Bacteria 18862
338 Ga0496106_0006253 3300048909 Bacteria 8816
339 Ga0496106_0064448 3300048909 Bacteria 2788
340 Ga0496107_0000498 3300048910 Bacteria 21676
341 Ga0496108_0005625 3300048911 Bacteria 10143
342 Ga0496109_0000339 3300048912 Bacteria 43633
343 Ga0496109_0002717 3300048912 Bacteria 14825
344 Ga0496110_0042127 3300048913 Bacteria 3984
345 Ga0496110_0048276 3300048913 Bacteria 3731
346 Ga0496111_0001112 3300048914 Bacteria 14905
347 Ga0496111_0007250 3300048914 Bacteria 7255
348 Ga0496112_0000893 3300048915 Bacteria 21474
349 Ga0496112_0077333 3300048915 Bacteria 3291
350 Ga0496112_0116294 3300048915 Bacteria 2645
351 Ga0496113_0000024 3300048916 Bacteria 66142
352 Ga0496113_0000213 3300048916 Bacteria 27185
353 Ga0496114_0170460 3300048917 Bacteria 1896
354 Ga0496115_0011083 3300048918 Bacteria 6755
355 Ga0496115_0074728 3300048918 Bacteria 2752
356 Ga0496116_0119259 3300048919 Bacteria 1531
357 Ga0496117_0008319 3300048920 Bacteria 9873
358 Ga0496118_0001458 3300048921 Bacteria 35562
359 Ga0496121_0000146 3300048924 Bacteria 154459
360 Ga0496121_0000881 3300048924 Bacteria 54361
361 Ga0496121_0007361 3300048924 Bacteria 13306
362 Ga0496124_0009204 3300048927 Bacteria 10188
363 Ga0496125_0129673 3300048928 Bacteria 1778
364 Ga0496126_0024346 3300048929 Bacteria 5846
365 Ga0496126_0135192 3300048929 Bacteria 2127
366 Ga0501034_0003462 3300049571 Bacteria 17971
367 Ga0501034_0243386 3300049571 Bacteria 1744
368 Ga0501036_0001626 3300049572 Bacteria 17386
369 Ga0501036_0437766 3300049572 Bacteria 1090
370 Ga0501037_0010257 3300049573 Bacteria 6875
371 Ga0501038_0073234 3300049574 Bacteria 2901
372 Ga0501041_0016762 3300049577 Bacteria 4360
373 Ga0501043_0002131 3300049579 Bacteria 16886
374 Ga0501046_0015303 3300049580 Bacteria 6451
375 Ga0501046_0167968 3300049580 Bacteria 1648
376 Ga0501047_0000161 3300049581 Bacteria 81928
377 Ga0501047_0018600 3300049581 Bacteria 6661
378 Ga0501048_0001687 3300049582 Bacteria 16834
379 Ga0501070_0017045 3300049586 Bacteria 6096
380 Ga0501071_0050515 3300049587 Bacteria 2995
381 Ga0501072_0018932 3300049588 Bacteria 5314
382 Ga0501073_0043888 3300049589 Bacteria 3152
383 Ga0501074_0003607 3300049590 Bacteria 10993
384 Ga0501075_0117656 3300049591 Bacteria 2020
385 Ga0501076_0013341 3300049592 Bacteria 6161
386 Ga0501077_0059218 3300049593 Bacteria 2431
387 Ga0501081_0036473 3300049743 Bacteria 3353
388 Ga0501083_0006827 3300049744 Bacteria 8101
389 Ga0501035_0118565 3300049822 Bacteria 2315
390 Ga0501044_0001758 3300049823 Bacteria 25308
391 Ga0501045_0119821 3300049824 Bacteria 1954
392 Ga0501045_0126220 3300049824 Bacteria 1901
393 nmdc:mga03n38_56304_c1 3300050490 Bacteria 1774
394 nmdc:mga0yw44_1337_c1 3300050492 Bacteria 9760
395 nmdc:mga0yw44_48675_c1 3300050492 Bacteria 2556
396 nmdc:mga06z11_68822_c1 3300050494 Bacteria 1867
397 nmdc:mga05p37_138871_c1 3300050507 Bacteria 2978
398 nmdc:mga05p37_16462_c1 3300050507 Bacteria 8908
399 nmdc:mga05p37_199485_c1 3300050507 Bacteria 2424
400 nmdc:mga05p37_419369_c1 3300050507 Bacteria 1558
401 nmdc:mga05p37_59_c1 3300050507 Bacteria 95449
402 nmdc:mga05p37_63034_c2 3300050507 Bacteria 2743
403 nmdc:mga09592_1815_c1 3300050508 Bacteria 17135
404 nmdc:mga09592_38994_c1 3300050508 Bacteria 3990
405 nmdc:mga0qj67_14_c1 3300050509 Bacteria 124768
406 nmdc:mga0qj67_4255_c1 3300050509 Bacteria 10370
407 nmdc:mga0qj67_796_c1 3300050509 Bacteria 21481
408 nmdc:mga06r32_252_c1 3300050510 Bacteria 44145
409 nmdc:mga08y16_294734_c1 3300050511 Bacteria 1672
410 nmdc:mga08y16_30925_c1 3300050511 Bacteria 5630
411 nmdc:mga08y16_56547_c1 3300050511 Bacteria 4099
412 nmdc:mga08y16_95167_c1 3300050511 Bacteria 3102
413 nmdc:mga0n895_110022_c1 3300050512 Bacteria 2771
414 nmdc:mga0n895_167530_c1 3300050512 Bacteria 2229
415 nmdc:mga0n895_247_c1 3300050512 Bacteria 34608
416 nmdc:mga0n895_88790_c1 3300050512 Bacteria 3091
417 nmdc:mga0rr50_227222_c1 3300050513 Bacteria 1543
418 nmdc:mga0rr50_32503_c1 3300050513 Bacteria 3719
419 nmdc:mga0a205_23_c1 3300050515 Bacteria 88424
420 nmdc:mga0a205_4401_c1 3300050515 Bacteria 12636
421 nmdc:mga0sz30_11235_c1 3300050516 Bacteria 3452
422 Ga0500635_0006421 3300053080 Bacteria 3140
423 Ga0495595_0001035 3300053084 Bacteria 10717
424 Ga0495619_0042916 3300053085 Bacteria 2963
425 Ga0500641_0010807 3300053096 Bacteria 3307
426 Ga0500573_0069941 3300053140 Bacteria 2002
427 Ga0500636_0017626 3300053177 Bacteria 4221
428 Ga0500637_0023336 3300053178 Bacteria 3381
429 Ga0501084_0198780 3300054114 Bacteria 1691
430 2513722480 2513237104 Bacteria 10034502
431 2513893772 2513237141 Bacteria 8496279
432 2881667077 2881665667 Bacteria 8175609
433 2885412086 2885409591 Bacteria 9235467
434 2889038559 2889033259 Bacteria 9099371
435 2903749800 2903748898 Bacteria 9972761
436 2903752871 2903748898 Bacteria 9972761
437 2904695302 2904690495 Bacteria 9412302
438 2904695343 2904690495 Bacteria 9412302
439 2906637257 2906635258 Bacteria 8601019
440 2932793799 2932784394 Bacteria 9704911
441 2935978852 2935975950 Bacteria 8347125
442 2935993718 2935992306 Bacteria 9802711
443 3005714704 3005710791 Bacteria 7622528
444 8045867388 8045864390 Bacteria 5043873
445 8046768289 8046767195 Bacteria 7547379
446 8046773606 8046767195 Bacteria 7547379
447 8057582573 8057575449 Bacteria 7367519
448 Ga0070713_100169146
449 JGI24743J22301_10000634
450 JGI24750J21931_1001530
451 JGI24744J21845_10000126
452 JGI24033J26618_1002027
453 JGI24034J26672_10001317
454 Ga0065712_10013894
455 Ga0065715_10009858
456 Ga0070683_100015249
457 Ga0070670_100025093
458 Ga0070670_100053731
459 Ga0068868_100022773
460 Ga0070691_10038165
461 Ga0070687_100006358
462 Ga0070668_100119147
463 Ga0070675_100035508
464 Ga0070671_100004814
465 Ga0070671_100013416
466 Ga0070673_100063892
467 Ga0070709_10000143
468 Ga0070709_10003829
469 Ga0070709_10057692
470 Ga0070714_100149350
471 Ga0070714_100200008
472 Ga0070713_100001974
473 Ga0070713_100055014
474 Ga0070710_10000126
475 Ga0070710_10001107
476 Ga0070711_100000463
477 Ga0070711_100008964
478 Ga0070711_100111225
479 Ga0070705_100033299
480 Ga0070662_100041594
481 Ga0070662_100200248
482 Ga0070681_10146242
483 Ga0068867_100012530
484 Ga0070685_10001346
485 Ga0070698_100182632
486 Ga0070698_100282819
487 Ga0070699_100183627
488 Ga0070679_100098794
489 Ga0070684_100018253
490 Ga0070672_100035749
491 Ga0070672_100276418
492 Ga0070686_100097812
493 Ga0070693_100068772
494 Ga0070665_100171486
495 Ga0070704_100069555
496 Ga0068854_100012312
497 Ga0068856_100023121
498 Ga0068856_100162595
499 Ga0070702_100001073
500 Ga0068852_100032897
501 Ga0068866_10003102
502 Ga0068861_100034855
503 Ga0068870_10002209
504 Ga0068863_100074941
505 Ga0068858_100013035
506 Ga0068860_100008490
507 Ga0068862_100022950
508 Ga0081455_10001067
509 Ga0081455_10014128
510 Ga0081455_10019796
511 Ga0081455_10037781
512 Ga0081540_1000190
513 Ga0081540_1000195
514 Ga0081540_1000981
515 Ga0081540_1001153
516 Ga0081540_1001429
517 Ga0081540_1001458
518 Ga0081540_1003186
519 Ga0081540_1004038
520 Ga0081540_1004120
521 Ga0081540_1005046
522 Ga0081540_1005679
523 Ga0081540_1016849
524 Ga0081540_1055618
525 Ga0070717_10026354
526 Ga0075363_100069596
527 Ga0075432_10008363
528 Ga0070715_10001258
529 Ga0070712_100005765
530 Ga0070712_100079428
531 Ga0070712_100082154
532 Ga0070712_100152387
533 Ga0075362_10074706
534 Ga0075427_10000476
535 Ga0075427_10002698
536 Ga0097621_100019246
537 Ga0075428_100010708
538 Ga0075428_100096000
539 Ga0075428_100129705
540 Ga0075430_100000056
541 Ga0075430_100001587
542 Ga0075431_100006692
543 Ga0075431_100117613
544 Ga0075433_10000929
545 Ga0075433_10005204
546 Ga0075434_100000905
547 Ga0075434_100009614
548 Ga0075434_100030323
549 Ga0075434_100033311
550 Ga0075429_100000836
551 Ga0075429_100031581
552 Ga0068865_100019567
553 Ga0099824_1026689
554 Ga0099823_1000409
555 Ga0075435_100059060
556 Ga0075435_100084227
557 Ga0099795_10004345
558 Ga0105250_10023291
559 Ga0111539_10000250
560 Ga0111539_10049281
561 Ga0111539_10121594
562 Ga0111539_10177392
563 Ga0105245_10042228
564 Ga0105245_10362531
565 Ga0105247_10004705
566 Ga0105247_10155597
567 Ga0114129_10001510
568 Ga0114129_10041632
569 Ga0114129_10104002
570 Ga0114129_10425416
571 Ga0114129_10555076
572 Ga0105242_10158962
573 Ga0105248_10003989
574 Ga0105248_10031688
575 Ga0105237_10064639
576 Ga0105249_10058280
577 Ga0105239_10041319
578 Ga0157374_10012668
579 Ga0157378_10025627
580 Ga0157378_10270712
581 Ga0163162_10206396
582 Ga0157375_10013064
583 Ga0157375_10164054
584 Ga0163163_10027208
585 Ga0163163_10132818
586 Ga0157380_10036689
587 Ga0157377_10013536
588 Ga0157379_10004245
589 Ga0157379_10019444
590 Ga0157379_10099939
591 Ga0157376_10083590
592 Ga0157376_10234115
593 Ga0163161_10031582
594 Ga0213874_10010431
595 Ga0213875_10000009
596 Ga0213875_10000051
597 Ga0207696_1016252
598 Ga0207692_10000587
599 Ga0207692_10040444
600 Ga0207642_10036729
601 Ga0207710_10012524
602 Ga0207688_10000156
603 Ga0207647_10026809
604 Ga0207647_10095958
605 Ga0207685_10004394
606 Ga0207699_10000213
607 Ga0207699_10089671
608 Ga0207645_10003289
609 Ga0207645_10044921
610 Ga0207643_10001560
611 Ga0207707_10055580
612 Ga0207693_10002065
613 Ga0207693_10008230
614 Ga0207693_10095758
615 Ga0207693_10112413
616 Ga0207693_10143263
617 Ga0207663_10000304
618 Ga0207663_10006960
619 Ga0207662_10000800
620 Ga0207657_10081201
621 Ga0207657_10246266
622 Ga0207650_10001263
623 Ga0207687_10016885
624 Ga0207700_10066743
625 Ga0207664_10207049
626 Ga0207644_10004720
627 Ga0207644_10041829
628 Ga0207690_10015159
629 Ga0207706_10014012
630 Ga0207706_10055941
631 Ga0207709_10008238
632 Ga0207670_10001387
633 Ga0207669_10027598
634 Ga0207704_10018326
635 Ga0207704_10129905
636 Ga0207665_10000607
637 Ga0207691_10010809
638 Ga0207711_10044631
639 Ga0207689_10087580
640 Ga0207679_10032224
641 Ga0207712_10135248
642 Ga0207668_10000974
643 Ga0207668_10048370
644 Ga0207677_10007265
645 Ga0207703_10003233
646 Ga0207678_10013631
647 Ga0207641_10002012
648 Ga0207648_10001020
649 Ga0207676_10023770
650 Ga0207675_100002318
651 Ga0207675_100008279
652 Ga0207683_10106765
653 Ga0207698_10062331
654 Ga0209389_1000111
655 Ga0209489_100220
656 Ga0209700_100041
657 Ga0209179_1004958
658 Ga0209971_1009623
659 Ga0207428_10000111
660 Ga0207428_10019901
661 Ga0207428_10098951
662 Ga0207428_10127617
663 Ga0268265_10007712
664 Ga0268264_10000633
665 Ga0268264_10009845
666 Ga0268264_10019768
667 Ga0268264_10055388
668 Ga0265334_10013317
669 Ga0265338_10028366
670 Ga0265332_10010385
671 Ga0265325_10015892
672 Ga0265339_10000033
673 Ga0265339_10066247
674 Ga0265331_10024786
675 Ga0307509_10004428
676 Ga0265313_10000049
677 Ga0307508_10000001
678 Ga0307508_10053792
679 Ga0265314_10053123
680 Ga0265342_10006685
681 Ga0265342_10017386
682 Ga0307516_10070518
683 Ga0307516_10209731
684 Ga0307507_10021477
685 Ga0307507_10041726
686 Ga0373926_0007197
687 Ga0373944_0001902
688 Ga0373923_0047136
689 Ga0373945_0010017
690 Ga0373953_0008568
691 Ga0373954_0026799
692 Ga0373956_0005286
693 Ga0373956_0007112
694 Ga0373943_0003237
695 Ga0373943_0021846
696 Ga0373946_0018987
697 Ga0373927_0040821
698 Ga0373933_0000260
699 Ga0373933_0006205
700 Ga0373947_0013561
701 Ga0373937_0022045
702 Ga0373937_0058642
703 Ga0373925_0187201
704 Ga0436364_0404737
705 Ga0436364_0533263
706 Ga0436364_1006055
707 Ga0436364_1179546
708 Ga0436364_1201245
709 Ga0436365_0142727
710 Ga0436360_0814153
711 Ga0436363_0361553
712 Ga0436363_1104415
713 Ga0439440_0025500
714 Ga0495592_0005951
715 Ga0495592_0033262
716 Ga0495603_0002911
717 Ga0495603_0006879
718 Ga0495590_0043577
719 Ga0495629_0054544
720 Ga0495641_0017455
721 Ga0495651_0003880
722 Ga0495653_0009261
723 Ga0495653_0009512
724 Ga0495580_0034380
725 Ga0495584_0030569
726 Ga0495584_0089193
727 Ga0495594_0025417
728 Ga0495594_0054422
729 Ga0495608_0001827
730 Ga0495608_0007303
731 Ga0495618_0000816
732 Ga0495630_0034922
733 Ga0495644_0012056
734 Ga0495644_0020164
735 Ga0495652_0023615
736 Ga0495640_0033455
737 Ga0495587_0006212
738 Ga0495587_0012358
739 Ga0495598_0004398
740 Ga0495667_0016204
741 Ga0495656_0004243
742 Ga0495635_0029045
743 Ga0495657_0002009
744 Ga0495657_0006613
745 Ga0495599_0001982
746 Ga0495599_0007163
747 Ga0495623_0001531
748 Ga0495623_0022606
749 Ga0495646_0074417
750 Ga0495658_0005039
751 Ga0495624_0005784
752 Ga0495600_0025770
753 Ga0495581_0040933
754 Ga0495604_0009734
755 Ga0495604_0039778
756 Ga0495676_0029419
757 Ga0495676_0049555
758 Ga0495680_0017126
759 Ga0495675_0002532
760 Ga0495675_0007409
761 Ga0495684_0029683
762 Ga0495684_0096893
763 Ga0495684_0097693
764 Ga0495602_0002195
765 Ga0495602_0027478
766 Ga0496100_0163413
767 Ga0496100_0185592
768 Ga0496101_0001815
769 Ga0496101_0039519
770 Ga0496102_0011376
771 Ga0496102_0036560
772 Ga0496102_0060060
773 Ga0496102_0061560
774 Ga0496102_0078381
775 Ga0496103_0001267
776 Ga0496103_0101497
777 Ga0496104_0005191
778 Ga0496104_0019169
779 Ga0496104_0031479
780 Ga0496104_0065055
781 Ga0496105_0000247
782 Ga0496105_0001679
783 Ga0496106_0001062
784 Ga0496106_0001280
785 Ga0496106_0006253
786 Ga0496106_0064448
787 Ga0496107_0000498
788 Ga0496108_0005625
789 Ga0496109_0000339
790 Ga0496109_0002717
791 Ga0496110_0042127
792 Ga0496110_0048276
793 Ga0496111_0001112
794 Ga0496111_0007250
795 Ga0496112_0000893
796 Ga0496112_0077333
797 Ga0496112_0116294
798 Ga0496113_0000024
799 Ga0496113_0000213
800 Ga0496114_0170460
801 Ga0496115_0011083
802 Ga0496115_0074728
803 Ga0496116_0119259
804 Ga0496117_0008319
805 Ga0496118_0001458
806 Ga0496121_0000146
807 Ga0496121_0000881
808 Ga0496121_0007361
809 Ga0496124_0009204
810 Ga0496125_0129673
811 Ga0496126_0024346
812 Ga0496126_0135192
813 Ga0501034_0003462
814 Ga0501034_0243386
815 Ga0501036_0001626
816 Ga0501036_0437766
817 Ga0501037_0010257
818 Ga0501038_0073234
819 Ga0501041_0016762
820 Ga0501043_0002131
821 Ga0501046_0015303
822 Ga0501046_0167968
823 Ga0501047_0000161
824 Ga0501047_0018600
825 Ga0501048_0001687
826 Ga0501070_0017045
827 Ga0501071_0050515
828 Ga0501072_0018932
829 Ga0501073_0043888
830 Ga0501074_0003607
831 Ga0501075_0117656
832 Ga0501076_0013341
833 Ga0501077_0059218
834 Ga0501081_0036473
835 Ga0501083_0006827
836 Ga0501035_0118565
837 Ga0501044_0001758
838 Ga0501045_0119821
839 Ga0501045_0126220
840 nmdc:mga03n38_56304_c1
841 nmdc:mga0yw44_1337_c1
842 nmdc:mga0yw44_48675_c1
843 nmdc:mga06z11_68822_c1
844 nmdc:mga05p37_138871_c1
845 nmdc:mga05p37_16462_c1
846 nmdc:mga05p37_199485_c1
847 nmdc:mga05p37_419369_c1
848 nmdc:mga05p37_59_c1
849 nmdc:mga05p37_63034_c2
850 nmdc:mga09592_1815_c1
851 nmdc:mga09592_38994_c1
852 nmdc:mga0qj67_14_c1
853 nmdc:mga0qj67_4255_c1
854 nmdc:mga0qj67_796_c1
855 nmdc:mga06r32_252_c1
856 nmdc:mga08y16_294734_c1
857 nmdc:mga08y16_30925_c1
858 nmdc:mga08y16_56547_c1
859 nmdc:mga08y16_95167_c1
860 nmdc:mga0n895_110022_c1
861 nmdc:mga0n895_167530_c1
862 nmdc:mga0n895_247_c1
863 nmdc:mga0n895_88790_c1
864 nmdc:mga0rr50_227222_c1
865 nmdc:mga0rr50_32503_c1
866 nmdc:mga0a205_23_c1
867 nmdc:mga0a205_4401_c1
868 nmdc:mga0sz30_11235_c1
869 Ga0500635_0006421
870 Ga0495595_0001035
871 Ga0495619_0042916
872 Ga0500641_0010807
873 Ga0500573_0069941
874 Ga0500636_0017626
875 Ga0500637_0023336
876 Ga0501084_0198780
877 2513722480
878 2513893772
879 2881667077
880 2885412086
881 2889038559
882 2903749800
883 2903752871
884 2904695302
885 2904695343
886 2906637257
887 2932793799
888 2935978852
889 2935993718
890 3005714704
891 8045867388
892 8046768289
893 8046773606
894 8057582573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

45

371

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5txt-assembly3.cif.gz_E structure of asymmetric apo/holo alas dimer from s. cerevisiae 0.9611 47 401
5txt-assembly2.cif.gz_D structure of asymmetric apo/holo alas dimer from s. cerevisiae 0.9608 47 401
7x98-assembly2.cif.gz_D 5-aminolevulinate synthase hema from rhodopseudomonas palustris 0.9523 1 399
7x98-assembly2.cif.gz_D 5-aminolevulinate synthase hema from rhodopseudomonas palustris 0.95 1 399
8guh-assembly1.cif.gz_A serine palmitoyltransferase from sphingobacterium multivorum complexed with tris 0.9381 12 398
ID Description Score Start End Superfamily
af_P13196_493_597_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9893 301 396 3.90.1150.10
af_Q8I4X1_515_606_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9888 301 388 3.90.1150.10
af_O94069_405_493_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9851 301 386 3.90.1150.10
af_P09950_130_384_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9643 62 293 3.40.640.10
af_I1JW06_395_456_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9634 327 388 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A3D5UXG3-F1-model_v4 5-aminolevulinate synthase (EC 2.3.1.37) 0.991 309 403 GO:0003870
GO:0006783
GO:0030170
AF-A0A537RIS6-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9867 87 200 GO:0008483
GO:0009058
GO:0030170
AF-B4QBF5-F1-model_v4 GD11815 0.9828 317 401 GO:0003870
GO:0005739
GO:0006783
GO:0030170
GO:0040003
GO:0042541
GO:0048821
AF-A0A7V0RI05-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9809 319 403 GO:0003870
GO:0006783
GO:0008483
GO:0030170
AF-A0A2J8P8I3-F1-model_v4 ALAS1 isoform 6 0.9805 301 397 GO:0009058
GO:0030170

Map