metagRoot

F445829

General Info

Members	Datasets	Scaffolds	Average Seq Length
446	329	380	356

Family's Representative Sequence

Representative Sequence	3300053140\|Ga0500573_0007498\|Ga0500573_0007498_2611_3762
Length	383
Sequence	LYRGNSDRADSVGPDNDFFAARHFFHRQPRIALVVGASGIGGSALTDQLAGEGWQVLALSRRPGRDQAGVTWISADLRSADDLARVLGPQRPTHVFFTAWARQATEQENIEVNGGMVRDLLAALAHARVEHVSLVTGLKHYLGPFEAYGQGEMPDTPFHEDEPRLDSPNFYYAQEDALFAAAAQQGFTWSVHRSHTVIGHAVGNLMNMGLTLAVYASICKELGKPFIFPGSEMQWNGVTDMTDATILADQMIWAATSDAGSNEAFNVVNGDIFRWRWMWTKLADYFGVEPVGPESDPQPLEEQMAGIAEVWAMIARQNGLVESDVSRLASWWHTDADLGRQIEVVTDISKSRLAGFTSHHRTVDSFTSLFDRYRDERLIPAAK

Samples

	Sample ID	Description	Type	Environment
1	2545555834	Methylobacterium sp. WSM2598	Isolate	Nodule
2	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
3	2690315906	Arthrobacter sp. OY3WO11	Isolate	Unclassified
4	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
5	2728369276	Kineococcus rhizosphaerae DSM 19711	Isolate	Rhizosphere
6	2751185788	Curtobacterium pusillum AA3	Isolate	Unclassified
7	2773857758	Microbacterium chocolatum 1320	Isolate	Unclassified
8	2808606357	Arthrobacter sp. SLBN-122	Isolate	Unclassified
9	2808606360	Arthrobacter sp. SLBN-112	Isolate	Unclassified
10	2808606366	Arthrobacter sp. SLBN-83	Isolate	Unclassified
11	2808606370	Arthrobacter sp. SLBN-100	Isolate	Unclassified
12	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
13	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
14	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
15	2808606700	Arthrobacter agilis UMCV2	Isolate	Rhizosphere
16	2811994871	Arthrobacter sp. SLBN-179	Isolate	Unclassified
17	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
18	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
19	2844852863	Herbiconiux flava DSM 26474	Isolate	Rhizosphere
20	2852677369	Pseudoclavibacter sp. JAI123	Isolate	Rhizosphere
21	2857720070	Microbacterium sp. R-72113	Isolate	Unclassified
22	2857729791	Plantibacter sp. R-72288	Isolate	Unclassified
23	2870622029	Conyzicola lurida DSM 105784	Isolate	Unclassified
24	2902330777	Methylobacterium sp. 2A	Isolate	Unclassified
25	2904430863	Curtobacterium oceanosedimentum 1519	Isolate	Rhizosphere
26	2904434214	Robbsia andropogonis 1567	Isolate	Rhizosphere
27	2904501621	Curtobacterium sp. 1909	Isolate	Unclassified
28	2905926851	Arthrobacter sedimenti MIC A30	Isolate	Rhizosphere
29	2908674828	Curtobacterium sp. 1517	Isolate	Rhizosphere
30	2908678064	Microbacterium sp. 1518	Isolate	Rhizosphere
31	2909074476	Curtobacterium sp. 1310	Isolate	Rhizosphere
32	2919039151	Curtobacterium sp. 260	Isolate	Rhizosphere
33	2919042368	Curtobacterium sp. 320	Isolate	Rhizosphere
34	2919069694	Microbacterium sp. 1154	Isolate	Unclassified
35	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
36	2919391150	Arthrobacter ipis 2973	Isolate	Unclassified
37	2919446982	Phycicoccus sp. 3266	Isolate	Rhizosphere
38	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
39	2920879853	Kocuria salina CV6	Isolate	Unclassified
40	2928104781	Curtobacterium sp. 1544	Isolate	Rhizosphere
41	2928121344	Plantibacter flavus 1756	Isolate	Rhizosphere
42	2928500415	Curtobacterium oceanosedimentum 1257	Isolate	Rhizosphere
43	2939598168	Arthrobacter sp. 754	Isolate	Rhizosphere
44	2939657138	Conyzicola nivalis 2857	Isolate	Rhizosphere
45	2945916053	Arthrobacter ulcerisalmonis W1I2	Isolate	Rhizosphere
46	2945956166	Arthrobacter globiformus W2I3	Isolate	Rhizosphere
47	2946003308	Arthrobacter agilis W3I6	Isolate	Rhizosphere
48	2946027586	Pseudomonas sp. W4I3	Isolate	Rhizosphere
49	2946037020	Arthrobacter sp. W4I7	Isolate	Rhizosphere
50	2964326757	Planctomonas psychrotolerans J5903	Isolate	Rhizosphere
51	2966921586	Rathayibacter agropyri 617	Isolate	Rhizosphere
52	2966924647	Frigoribacterium sp. 2355	Isolate	Rhizosphere
53	2974302888	Pseudarthrobacter sp. SORGH_AS 212	Isolate	Unclassified
54	2974315732	Rhodococcus sp. SORGH_AS 301	Isolate	Unclassified
55	2977228692	Microbacterium sp. SORGH_AS 421	Isolate	Unclassified
56	2977236895	Microbacterium testaceum SORGH_AS 426	Isolate	Unclassified
57	2977264416	Microbacterium testaceum SORGH_AS 594	Isolate	Unclassified
58	2984523437	Rhodococcus sp. SORGH_AS303	Isolate	Aerial Root
59	2984542743	Microbacterium sp. SORGH_AS454	Isolate	Aerial Root
60	2984551494	Curtobacterium sp. SORGH_AS776	Isolate	Aerial Root
61	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
62	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
63	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
64	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
65	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
66	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
67	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
68	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
69	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
70	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
71	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
72	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
73	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
74	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
75	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
76	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
77	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
78	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
79	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
80	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
81	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
82	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
83	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
84	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
85	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
86	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
87	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
88	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
89	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
90	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
91	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
92	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
93	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
94	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
95	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
96	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
97	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
98	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
99	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
100	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
101	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
102	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
103	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
104	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
105	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
106	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
107	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
108	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
109	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
110	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
111	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
112	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
113	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
114	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
115	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
116	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
117	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
118	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
119	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
120	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
121	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
122	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
123	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
124	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
125	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
126	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
127	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
128	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
129	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
130	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
131	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
132	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
133	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
134	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
135	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
136	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
137	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
138	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
139	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
140	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
141	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
142	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
143	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
144	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
145	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
146	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
147	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
148	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
149	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
150	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
151	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
152	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
153	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
154	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
155	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
206	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
207	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
210	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
211	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
212	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
213	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
214	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
215	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
216	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
217	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
218	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
219	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
220	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
221	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
222	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
223	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
224	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
225	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
226	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
227	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
228	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
229	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
230	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
231	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
232	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
233	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
234	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
235	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
236	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
237	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
238	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
239	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
240	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
241	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
242	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
243	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
244	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
245	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
246	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
247	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
248	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
249	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
250	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
251	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
252	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
253	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
254	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
255	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
256	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
257	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
258	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
259	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
260	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
261	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
262	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
263	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
264	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
265	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
266	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
267	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
268	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
269	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
270	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
271	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
272	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
273	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
274	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
275	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
276	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
277	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
278	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
279	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
280	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
281	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
282	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
283	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
284	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
285	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
286	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
287	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
288	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
289	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
290	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
291	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
292	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
293	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
294	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
295	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
296	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
297	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
298	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
299	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
300	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
301	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
302	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
303	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
304	3300049673	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought	Metagenome	Rhizosphere
305	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
306	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
307	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
308	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
309	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
310	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
311	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
312	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
313	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
314	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
315	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
316	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
317	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
318	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
319	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
320	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
321	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
322	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
323	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
324	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
325	641522639	Methylobacterium sp. 4-46	Isolate	Nodule
326	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
327	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
328	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
329	8057345674	Herbiconiux aconitum CPCC 205763	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	84.53
Metatranscriptomes	0.67
Isolates	14.8

Biome Distribution

Category	Percentage (%)
Aerial Root	0.67
Bulb	0
Endosphere	4.26
Nodule	0.9
Rhizoplane	9.87
Rhizosphere	72.65
Stem	0
Stem Tuber	0
Unclassified	11.66

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25156J39149_1000339	3300002705	Bacteria	30576
2	Ga0055542_1005251	3300003762	Bacteria	2961
3	Ga0065704_10072315	3300005289	Bacteria	8747
4	Ga0070658_10020514	3300005327	Bacteria	5297
5	Ga0070676_10188290	3300005328	Bacteria	1346
6	Ga0070683_100006108	3300005329	Bacteria	10096
7	Ga0070690_100017023	3300005330	Bacteria	4364
8	Ga0070670_100006895	3300005331	Bacteria	9629
9	Ga0068869_100006569	3300005334	Bacteria	7378
10	Ga0070666_10018943	3300005335	Bacteria	4435
11	Ga0070666_10043182	3300005335	Bacteria	3018
12	Ga0070680_100005605	3300005336	Bacteria	9508
13	Ga0070682_100001587	3300005337	Bacteria	12664
14	Ga0070660_100264334	3300005339	Bacteria	1405
15	Ga0070689_100186851	3300005340	Bacteria	1686
16	Ga0070691_10008139	3300005341	Bacteria	4801
17	Ga0070668_100067256	3300005347	Bacteria	2783
18	Ga0070669_100072697	3300005353	Bacteria	2546
19	Ga0070675_100102774	3300005354	Bacteria	2408
20	Ga0070671_100008158	3300005355	Bacteria	8383
21	Ga0070674_100012705	3300005356	Bacteria	5178
22	Ga0070673_100037897	3300005364	Bacteria	3677
23	Ga0070667_100038738	3300005367	Bacteria	3997
24	Ga0070667_100194637	3300005367	Bacteria	1797
25	Ga0070709_10015233	3300005434	Bacteria	4369
26	Ga0070714_100044523	3300005435	Bacteria	3758
27	Ga0070714_100171496	3300005435	Bacteria	1969
28	Ga0070713_100005304	3300005436	Bacteria	8791
29	Ga0070701_10014833	3300005438	Bacteria	3582
30	Ga0070711_100040835	3300005439	Bacteria	3131
31	Ga0070700_100238499	3300005441	Bacteria	1298
32	Ga0070663_100002768	3300005455	Bacteria	9944
33	Ga0070678_100001715	3300005456	Bacteria	11772
34	Ga0070678_100152046	3300005456	Bacteria	1865
35	Ga0070681_10014719	3300005458	Bacteria	7779
36	Ga0068867_100083859	3300005459	Bacteria	2406
37	Ga0070685_10094045	3300005466	Bacteria	1820
38	Ga0070679_100459413	3300005530	Bacteria	1218
39	Ga0070684_100268176	3300005535	Bacteria	1562
40	Ga0070672_100065808	3300005543	Bacteria	2868
41	Ga0070665_100008406	3300005548	Bacteria	10442
42	Ga0070665_100057895	3300005548	Bacteria	3885
43	Ga0068855_100127592	3300005563	Bacteria	2908
44	Ga0070664_100012261	3300005564	Bacteria	6966
45	Ga0068854_100043393	3300005578	Bacteria	3187
46	Ga0068856_100098097	3300005614	Bacteria	2920
47	Ga0070702_100001844	3300005615	Bacteria	8832
48	Ga0068852_100001162	3300005616	Bacteria	17416
49	Ga0068852_100011762	3300005616	Bacteria	6607
50	Ga0068859_100026040	3300005617	Bacteria	5869
51	Ga0068864_100017114	3300005618	Bacteria	6044
52	Ga0068864_100021877	3300005618	Bacteria	5360
53	Ga0068866_10031604	3300005718	Bacteria	2552
54	Ga0068861_100059406	3300005719	Bacteria	2927
55	Ga0068851_10000015	3300005834	Bacteria	145191
56	Ga0068851_10024545	3300005834	Bacteria	2952
57	Ga0068870_10001039	3300005840	Bacteria	10956
58	Ga0068863_100017518	3300005841	Bacteria	6867
59	Ga0068858_100009829	3300005842	Bacteria	9101
60	Ga0068862_100062265	3300005844	Bacteria	3208
61	Ga0081539_10000057	3300005985	Bacteria	256264
62	Ga0081539_10002416	3300005985	Bacteria	26398
63	Ga0081539_10012305	3300005985	Bacteria	6618
64	Ga0075432_10019646	3300006058	Bacteria	2309
65	Ga0097621_100047542	3300006237	Bacteria	3478
66	Ga0075428_100077791	3300006844	Bacteria	3621
67	Ga0075431_100092726	3300006847	Bacteria	3117
68	Ga0075433_10003899	3300006852	Bacteria	11546
69	Ga0075434_100029575	3300006871	Bacteria	5390
70	Ga0075429_100032110	3300006880	Bacteria	4564
71	Ga0075436_100002363	3300006914	Bacteria	13028
72	Ga0097620_100026039	3300006931	Bacteria	5869
73	Ga0075435_100003586	3300007076	Bacteria	10549
74	Ga0105251_10000842	3300009011	Bacteria	27494
75	Ga0105251_10013950	3300009011	Bacteria	4467
76	Ga0105250_10017182	3300009092	Bacteria	2941
77	Ga0105240_10079123	3300009093	Bacteria	4046
78	Ga0111539_10014262	3300009094	Bacteria	9927
79	Ga0105245_10010913	3300009098	Bacteria	7903
80	Ga0105247_10006743	3300009101	Bacteria	7085
81	Ga0105247_10086411	3300009101	Bacteria	1985
82	Ga0114129_10040041	3300009147	Bacteria	6609
83	Ga0105243_10042801	3300009148	Bacteria	3547
84	Ga0105241_10005951	3300009174	Bacteria	8993
85	Ga0105248_10035149	3300009177	Bacteria	5606
86	Ga0105237_10001195	3300009545	Bacteria	34741
87	Ga0105238_10000985	3300009551	Bacteria	29112
88	Ga0105238_10010085	3300009551	Bacteria	9475
89	Ga0105249_10114808	3300009553	Bacteria	2550
90	Ga0105239_10026930	3300010375	Bacteria	6328
91	Ga0105239_10080819	3300010375	Bacteria	3576
92	Ga0105246_10022108	3300011119	Bacteria	4102
93	Ga0157373_10021715	3300013100	Bacteria	4658
94	Ga0157370_10062805	3300013104	Bacteria	3522
95	Ga0157370_10076505	3300013104	Bacteria	3153
96	Ga0157369_10009353	3300013105	Bacteria	11208
97	Ga0157369_10337090	3300013105	Bacteria	1567
98	Ga0157378_10058521	3300013297	Bacteria	3437
99	Ga0163162_10076528	3300013306	Bacteria	3409
100	Ga0157372_10009603	3300013307	Bacteria	10282
101	Ga0157372_10191669	3300013307	Bacteria	2368
102	Ga0157375_10040811	3300013308	Bacteria	4476
103	Ga0157375_10464443	3300013308	Bacteria	1431
104	Ga0163163_10009649	3300014325	Bacteria	8633
105	Ga0157379_10079442	3300014968	Bacteria	2938
106	Ga0182006_1001126	3300015261	Bacteria	16985
107	Ga0163161_10055725	3300017792	Bacteria	2870
108	Ga0206354_10041880	3300020081	Bacteria	2037
109	Ga0206354_11374799	3300020081	Bacteria	1830
110	Ga0206353_10971666	3300020082	Bacteria	3276
111	Ga0209437_100032	3300025233	Bacteria	520075
112	Ga0209148_1004441	3300025254	Bacteria	3461
113	Ga0207697_10014980	3300025315	Bacteria	3209
114	Ga0207656_10000001	3300025321	Bacteria	1323684
115	Ga0207655_1007620	3300025728	Bacteria	6992
116	Ga0207655_1040915	3300025728	Bacteria	1993
117	Ga0207713_1000011	3300025735	Bacteria	507224
118	Ga0207682_10003456	3300025893	Bacteria	6861
119	Ga0207688_10004596	3300025901	Bacteria	7515
120	Ga0207680_10021600	3300025903	Bacteria	3485
121	Ga0207699_10005008	3300025906	Bacteria	6335
122	Ga0207645_10053292	3300025907	Bacteria	2585
123	Ga0207645_10188367	3300025907	Bacteria	1355
124	Ga0207643_10000594	3300025908	Bacteria	22954
125	Ga0207705_10008467	3300025909	Bacteria	7509
126	Ga0207705_10017388	3300025909	Bacteria	5150
127	Ga0207654_10001922	3300025911	Bacteria	10783
128	Ga0207695_10163164	3300025913	Bacteria	2158
129	Ga0207671_10000001	3300025914	Bacteria	1318881
130	Ga0207693_10009609	3300025915	Bacteria	7876
131	Ga0207663_10007387	3300025916	Bacteria	5695
132	Ga0207660_10004032	3300025917	Bacteria	9582
133	Ga0207657_10011837	3300025919	Bacteria	8636
134	Ga0207649_10001959	3300025920	Bacteria	11738
135	Ga0207652_10018869	3300025921	Bacteria	5661
136	Ga0207694_10000052	3300025924	Bacteria	157700
137	Ga0207650_10001016	3300025925	Bacteria	21075
138	Ga0207659_10003036	3300025926	Bacteria	10016
139	Ga0207700_10349340	3300025928	Bacteria	1287
140	Ga0207664_10057802	3300025929	Bacteria	3084
141	Ga0207644_10000953	3300025931	Bacteria	18459
142	Ga0207690_10032399	3300025932	Bacteria	3354
143	Ga0207706_10070419	3300025933	Bacteria	3076
144	Ga0207709_10024558	3300025935	Bacteria	3442
145	Ga0207669_10004387	3300025937	Bacteria	6205
146	Ga0207691_10000652	3300025940	Bacteria	34259
147	Ga0207691_10022729	3300025940	Bacteria	5912
148	Ga0207691_10066275	3300025940	Bacteria	3267
149	Ga0207711_10033529	3300025941	Bacteria	4346
150	Ga0207711_10193439	3300025941	Bacteria	1854
151	Ga0207711_10339077	3300025941	Bacteria	1391
152	Ga0207689_10001431	3300025942	Bacteria	22792
153	Ga0207689_10014654	3300025942	Bacteria	6659
154	Ga0207661_10000322	3300025944	Bacteria	30526
155	Ga0207661_10183267	3300025944	Bacteria	1831
156	Ga0207679_10003328	3300025945	Bacteria	9926
157	Ga0207712_10070082	3300025961	Bacteria	2518
158	Ga0207668_10060188	3300025972	Bacteria	2664
159	Ga0207668_10083995	3300025972	Bacteria	2319
160	Ga0207668_10116723	3300025972	Bacteria	2013
161	Ga0207640_10088990	3300025981	Bacteria	2133
162	Ga0207658_10021814	3300025986	Bacteria	4451
163	Ga0207677_10002359	3300026023	Bacteria	9901
164	Ga0207678_10001818	3300026067	Bacteria	19546
165	Ga0207708_10114530	3300026075	Bacteria	2096
166	Ga0207708_10129183	3300026075	Bacteria	1974
167	Ga0207702_10001992	3300026078	Bacteria	19810
168	Ga0207702_10004459	3300026078	Bacteria	12440
169	Ga0207641_10018686	3300026088	Bacteria	5683
170	Ga0207648_10242148	3300026089	Bacteria	1606
171	Ga0207676_10000896	3300026095	Bacteria	23105
172	Ga0207674_10014697	3300026116	Bacteria	8633
173	Ga0207674_10024655	3300026116	Bacteria	6423
174	Ga0207675_100050902	3300026118	Bacteria	3865
175	Ga0207675_100139175	3300026118	Bacteria	2305
176	Ga0207683_10001721	3300026121	Bacteria	19553
177	Ga0207683_10056282	3300026121	Bacteria	3449
178	Ga0207698_10000510	3300026142	Bacteria	22589
179	Ga0209281_1002595	3300027111	Bacteria	6985
180	Ga0209281_1019483	3300027111	Bacteria	1340
181	Ga0207428_10004514	3300027907	Bacteria	13204
182	Ga0268266_10024347	3300028379	Bacteria	5149
183	Ga0268264_10280595	3300028381	Bacteria	1560
184	Ga0307515_10002934	3300028794	Bacteria	36177
185	Ga0265332_10005385	3300031238	Bacteria	5907
186	Ga0307408_100004233	3300031548	Bacteria	9768
187	Ga0307408_100087206	3300031548	Bacteria	2347
188	Ga0307405_10025403	3300031731	Bacteria	3400
189	Ga0307410_10112891	3300031852	Bacteria	1969
190	Ga0307410_10175676	3300031852	Bacteria	1618
191	Ga0307410_10196393	3300031852	Bacteria	1538
192	Ga0307406_10184082	3300031901	Bacteria	1523
193	Ga0307412_10016969	3300031911	Bacteria	4350
194	Ga0307412_10050990	3300031911	Bacteria	2733
195	Ga0307416_100095845	3300032002	Bacteria	2564
196	Ga0307416_100161917	3300032002	Bacteria	2069
197	Ga0307416_100318224	3300032002	Bacteria	1556
198	Ga0307411_10010305	3300032005	Bacteria	4974
199	Ga0307415_100233341	3300032126	Bacteria	1483
200	Ga0373944_0083574	3300035089	Bacteria	1058
201	Ga0373949_0000785	3300035090	Bacteria	10221
202	Ga0373936_0000006	3300035113	Bacteria	318697
203	Ga0373956_0031192	3300035119	Bacteria	2334
204	Ga0373924_0064198	3300035410	Bacteria	1541
205	Ga0395899_0014768	3300037312	Bacteria	5960
206	Ga0439438_000012	3300041405	Bacteria	132114
207	Ga0439438_001086	3300041405	Bacteria	12156
208	Ga0439438_002632	3300041405	Bacteria	7584
209	Ga0439447_033322	3300041407	Bacteria	1284
210	Ga0439432_000435	3300042006	Bacteria	15539
211	Ga0439452_000024	3300042010	Bacteria	230396
212	Ga0439452_000072	3300042010	Bacteria	88574
213	Ga0439456_003655	3300042013	Bacteria	3126
214	Ga0439456_011319	3300042013	Bacteria	1844
215	Ga0439463_025593	3300042016	Bacteria	1481
216	Ga0450911_000060	3300042115	Bacteria	44515
217	Ga0450906_000025	3300042145	Bacteria	27046
218	Ga0466965_0051882	3300044683	Bacteria	2036
219	Ga0466965_0124930	3300044683	Bacteria	1331
220	Ga0466970_0034035	3300044765	Bacteria	2695
221	Ga0466960_0105527	3300044901	Bacteria	1456
222	Ga0495617_000440	3300046452	Bacteria	22428
223	Ga0495627_000528	3300046453	Bacteria	31638
224	Ga0495592_0163091	3300046454	Bacteria	1532
225	Ga0495590_0000359	3300046457	Bacteria	23312
226	Ga0495591_001413	3300046458	Bacteria	14966
227	Ga0495629_0000033	3300046459	Bacteria	120105
228	Ga0495651_0004073	3300046462	Bacteria	11176
229	Ga0495653_0238763	3300046463	Bacteria	1212
230	Ga0495650_0000781	3300046471	Bacteria	39109
231	Ga0495662_0031438	3300046476	Bacteria	2564
232	Ga0495584_0074869	3300046491	Bacteria	1702
233	Ga0495607_0002787	3300046501	Bacteria	13917
234	Ga0495606_0001751	3300046507	Bacteria	27860
235	Ga0495606_0002211	3300046507	Bacteria	23291
236	Ga0495606_0033177	3300046507	Bacteria	3564
237	Ga0495610_0016172	3300046512	Bacteria	4308
238	Ga0495616_0027586	3300046513	Bacteria	3012
239	Ga0495628_0000176	3300046516	Bacteria	56169
240	Ga0495632_0000208	3300046519	Bacteria	59436
241	Ga0495632_0015450	3300046519	Bacteria	4279
242	Ga0495632_0024566	3300046519	Bacteria	3198
243	Ga0495643_0005398	3300046522	Bacteria	8654
244	Ga0495643_0005677	3300046522	Bacteria	8363
245	Ga0495643_0046625	3300046522	Bacteria	2349
246	Ga0495652_0021834	3300046529	Bacteria	5689
247	Ga0495654_0000399	3300046530	Bacteria	37187
248	Ga0495654_0001333	3300046530	Bacteria	17189
249	Ga0495654_0068055	3300046530	Bacteria	1693
250	Ga0495640_0206274	3300046533	Bacteria	1244
251	Ga0495587_0111243	3300046536	Bacteria	1573
252	Ga0495597_0000253	3300046542	Bacteria	48591
253	Ga0495597_0006591	3300046542	Bacteria	5990
254	Ga0495622_0000083	3300046557	Bacteria	84580
255	Ga0495656_0007665	3300046615	Bacteria	3826
256	Ga0495588_0005790	3300046674	Bacteria	5525
257	Ga0495588_0017420	3300046674	Bacteria	3489
258	Ga0495588_0045798	3300046674	Bacteria	2243
259	Ga0495657_0018780	3300046675	Bacteria	4997
260	Ga0495669_0012101	3300046684	Bacteria	3667
261	Ga0495670_0083873	3300046691	Bacteria	1626
262	Ga0495671_0000194	3300046692	Bacteria	53224
263	Ga0495671_0089920	3300046692	Bacteria	1503
264	Ga0495600_0168057	3300046809	Bacteria	1416
265	Ga0495660_0000626	3300046810	Bacteria	27710
266	Ga0495581_0007410	3300047315	Bacteria	6345
267	Ga0495581_0039544	3300047315	Bacteria	2730
268	Ga0495581_0269085	3300047315	Bacteria	996
269	Ga0495672_0000213	3300047320	Bacteria	82925
270	Ga0495672_0005973	3300047320	Bacteria	9536
271	Ga0495680_0015720	3300047322	Bacteria	6518
272	Ga0495680_0046718	3300047322	Bacteria	3412
273	Ga0495683_0000013	3300047323	Bacteria	200428
274	Ga0495683_0001852	3300047323	Bacteria	13275
275	Ga0495683_0044142	3300047323	Bacteria	2242
276	Ga0495675_0035660	3300047444	Bacteria	3176
277	Ga0495677_0073002	3300047445	Bacteria	1280
278	Ga0495673_0000227	3300047469	Bacteria	83114
279	Ga0495673_0001804	3300047469	Bacteria	16208
280	Ga0495686_0002705	3300047472	Bacteria	16230
281	Ga0495602_0001974	3300048088	Bacteria	20587
282	Ga0495602_0021879	3300048088	Bacteria	6277
283	Ga0496100_0045738	3300048903	Bacteria	2810
284	Ga0496100_0046720	3300048903	Bacteria	2786
285	Ga0496101_0023982	3300048904	Bacteria	4220
286	Ga0496101_0042810	3300048904	Bacteria	3233
287	Ga0496101_0094553	3300048904	Bacteria	2228
288	Ga0496102_0004715	3300048905	Bacteria	11542
289	Ga0496102_0007064	3300048905	Bacteria	9583
290	Ga0496102_0030896	3300048905	Bacteria	4798
291	Ga0496102_0064712	3300048905	Bacteria	3350
292	Ga0496102_0078263	3300048905	Bacteria	3044
293	Ga0496102_0302991	3300048905	Bacteria	1506
294	Ga0496103_0030496	3300048906	Bacteria	3281
295	Ga0496103_0039571	3300048906	Bacteria	2898
296	Ga0496103_0081398	3300048906	Bacteria	2037
297	Ga0496104_0064304	3300048907	Bacteria	3480
298	Ga0496105_0030999	3300048908	Bacteria	4383
299	Ga0496105_0055395	3300048908	Bacteria	3274
300	Ga0496106_0004071	3300048909	Bacteria	10903
301	Ga0496106_0009066	3300048909	Bacteria	7355
302	Ga0496106_0338289	3300048909	Bacteria	1208
303	Ga0496106_0365809	3300048909	Bacteria	1159
304	Ga0496107_0003209	3300048910	Bacteria	10881
305	Ga0496107_0084175	3300048910	Bacteria	2320
306	Ga0496107_0181362	3300048910	Bacteria	1563
307	Ga0496108_0004435	3300048911	Bacteria	11297
308	Ga0496108_0105999	3300048911	Bacteria	2400
309	Ga0496108_0115126	3300048911	Bacteria	2302
310	Ga0496108_0239864	3300048911	Bacteria	1577
311	Ga0496109_0009329	3300048912	Bacteria	8361
312	Ga0496109_0168462	3300048912	Bacteria	2054
313	Ga0496110_0006184	3300048913	Bacteria	9449
314	Ga0496110_0006196	3300048913	Bacteria	9440
315	Ga0496110_0008070	3300048913	Bacteria	8451
316	Ga0496110_0016105	3300048913	Bacteria	6234
317	Ga0496110_0078936	3300048913	Bacteria	2930
318	Ga0496110_0134544	3300048913	Bacteria	2233
319	Ga0496111_0002466	3300048914	Bacteria	11164
320	Ga0496111_0002672	3300048914	Bacteria	10828
321	Ga0496111_0014475	3300048914	Bacteria	5389
322	Ga0496111_0021774	3300048914	Bacteria	4479
323	Ga0496111_0101744	3300048914	Bacteria	2111
324	Ga0496112_0019405	3300048915	Bacteria	6417
325	Ga0496114_0002522	3300048917	Bacteria	13985
326	Ga0496114_0199255	3300048917	Bacteria	1753
327	Ga0496117_0000017	3300048920	Bacteria	490421
328	Ga0496117_0001678	3300048920	Bacteria	30894
329	Ga0496117_0012435	3300048920	Bacteria	7498
330	Ga0496117_0018604	3300048920	Bacteria	5744
331	Ga0496117_0115708	3300048920	Bacteria	1659
332	Ga0496118_0000018	3300048921	Bacteria	490421
333	Ga0496118_0000289	3300048921	Bacteria	87537
334	Ga0496118_0000290	3300048921	Bacteria	87438
335	Ga0496119_0009975	3300048922	Bacteria	8050
336	Ga0496120_0028704	3300048923	Bacteria	3406
337	Ga0496121_0026240	3300048924	Bacteria	5498
338	Ga0496121_0235471	3300048924	Bacteria	1280
339	Ga0496121_0240447	3300048924	Bacteria	1262
340	Ga0496122_0001299	3300048925	Bacteria	41264
341	Ga0496122_0001766	3300048925	Bacteria	33170
342	Ga0496122_0038055	3300048925	Bacteria	3861
343	Ga0496123_0001034	3300048926	Bacteria	42222
344	Ga0496123_0028446	3300048926	Bacteria	4138
345	Ga0496124_0000040	3300048927	Bacteria	307061
346	Ga0496124_0031168	3300048927	Bacteria	4723
347	Ga0496124_0044569	3300048927	Bacteria	3805
348	Ga0496124_0169289	3300048927	Bacteria	1694
349	Ga0496125_0271211	3300048928	Bacteria	1057
350	Ga0495678_021637	3300049459	Bacteria	2828
351	Ga0501034_0189029	3300049571	Bacteria	2022
352	Ga0501037_0055637	3300049573	Bacteria	2893
353	Ga0501047_0022252	3300049581	Bacteria	6090
354	Ga0501240_000044	3300049673	Bacteria	7621
355	Ga0501241_000379	3300049758	Bacteria	9718
356	nmdc:mga05p37_484948_c1	3300050507	Bacteria	1423
357	nmdc:mga09592_138722_c1	3300050508	Bacteria	2095
358	nmdc:mga06r32_18827_c1	3300050510	Bacteria	6327
359	nmdc:mga08y16_10104_c1	3300050511	Bacteria	9907
360	nmdc:mga0n895_9090_c1	3300050512	Bacteria	8669
361	nmdc:mga0rr50_2270_c1	3300050513	Bacteria	10781
362	nmdc:mga08x19_1922_c1	3300050514	Bacteria	12710
363	nmdc:mga0a205_2513_c1	3300050515	Bacteria	16167
364	Ga0495619_0038355	3300053085	Bacteria	3125
365	Ga0500578_0192944	3300053086	Bacteria	1250
366	Ga0500566_0048429	3300053094	Bacteria	2437
367	Ga0500566_0103111	3300053094	Bacteria	1561
368	Ga0500614_009647	3300053123	Bacteria	2061
369	Ga0500642_0090026	3300053130	Bacteria	1417
370	Ga0500573_0001202	3300053140	Bacteria	12123
371	Ga0500573_0007498	3300053140	Bacteria	5952
372	Ga0500573_0033290	3300053140	Bacteria	2974
373	Ga0500573_0058439	3300053140	Bacteria	2211
374	Ga0500577_0004078	3300053142	Bacteria	3829
375	Ga0500577_0026354	3300053142	Bacteria	1979
376	Ga0500590_007178	3300053148	Bacteria	5483
377	Ga0500616_0000010	3300053153	Bacteria	761410
378	Ga0500616_0000106	3300053153	Bacteria	153706
379	Ga0500636_0108008	3300053177	Bacteria	1575
380	Ga0500645_010855	3300053730	Bacteria	2995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048928	Ga0496125_0271211	Ga0496125_0271211_153_1040	295
2	3300047315	Ga0495581_0269085	Ga0495581_0269085_14_916	300
3	3300046674	Ga0495588_0005790	Ga0495588_0005790_48_983	311
4	3300005289	Ga0065704_10072315	Ga0065704_1007231513	312
5	3300053140	Ga0500573_0033290	Ga0500573_0033290_1860_2798	312
6	3300048908	Ga0496105_0055395	Ga0496105_0055395_27_971	314
7	3300035089	Ga0373944_0083574	Ga0373944_0083574_49_1002	317
8	3300046463	Ga0495653_0238763	Ga0495653_0238763_210_1193	327
9	3300041405	Ga0439438_000012	Ga0439438_000012_31162_32223	332
10	3300013105	Ga0157369_10337090	Ga0157369_103370901	335
11	3300013308	Ga0157375_10464443	Ga0157375_104644431	335
12	3300048904	Ga0496101_0042810	Ga0496101_0042810_482_1489	335
13	3300048909	Ga0496106_0009066	Ga0496106_0009066_6215_7222	335
14	3300048910	Ga0496107_0084175	Ga0496107_0084175_643_1650	335
15	3300048911	Ga0496108_0105999	Ga0496108_0105999_14_1021	335
16	3300048913	Ga0496110_0078936	Ga0496110_0078936_113_1120	335
17	3300048914	Ga0496111_0021774	Ga0496111_0021774_2903_3910	335
18	iso_pu_bacteria	2945916053	2945916677	342
19	iso_pu_bacteria	2908678064	2908680409	343
20	iso_pu_bacteria	2919069694	2919073155	343
21	3300049571	Ga0501034_0189029	Ga0501034_0189029_496_1551	345
22	3300013100	Ga0157373_10021715	Ga0157373_100217155	346
23	3300042013	Ga0439456_003655	Ga0439456_003655_2071_3111	346
24	3300049573	Ga0501037_0055637	Ga0501037_0055637_1416_2456	346
25	3300005618	Ga0068864_100017114	Ga0068864_1000171142	348
26	3300025941	Ga0207711_10339077	Ga0207711_103390771	348
27	3300035113	Ga0373936_0000006	Ga0373936_0000006_251065_252111	348
28	3300046674	Ga0495588_0045798	Ga0495588_0045798_384_1433	349
29	3300048909	Ga0496106_0338289	Ga0496106_0338289_15_1064	349
30	iso_pu_bacteria	2623620443	2624482194	349
31	iso_pu_bacteria	2713897148	2715753176	349
32	iso_pu_bacteria	2842832357	2842834691	349
33	iso_pu_bacteria	2842843487	2842843544	349
34	iso_pu_bacteria	2902330777	2902332821	349
35	iso_pu_bacteria	2919385768	2919387045	349
36	iso_pu_bacteria	2919487758	2919492248	349
37	iso_pu_bacteria	2946027586	2946030945	349
38	iso_pu_bacteria	3007614139	3007619058	349
39	iso_pu_bacteria	8029995093	8029997871	349
40	iso_pu_bacteria	8056161164	8056165557	349
41	iso_pu_bacteria	8056166840	8056168269	349
42	iso_pu_bacteria	2545555834	2545678719	350
43	iso_pu_bacteria	2857729791	2857730812	350
44	iso_pu_bacteria	2928121344	2928122610	350
45	iso_pu_bacteria	641522639	641646715	350
46	3300005530	Ga0070679_100459413	Ga0070679_1004594131	351
47	3300031852	Ga0307410_10196393	Ga0307410_101963931	351
48	3300047472	Ga0495686_0002705	Ga0495686_0002705_4782_5849	351
49	iso_pu_bacteria	2808606384	2808974201	351
50	iso_pu_bacteria	2808606390	2809008987	351
51	iso_pu_bacteria	2808606391	2809016138	351
52	iso_pu_bacteria	2904434214	2904434386	351
53	iso_pu_bacteria	2977264416	2977267988	351
54	3300003762	Ga0055542_1005251	Ga0055542_10052513	352
55	3300005367	Ga0070667_100038738	Ga0070667_1000387383	352
56	3300005548	Ga0070665_100057895	Ga0070665_1000578953	352
57	3300025254	Ga0209148_1004441	Ga0209148_10044412	352
58	3300025986	Ga0207658_10021814	Ga0207658_100218143	352
59	3300028379	Ga0268266_10024347	Ga0268266_100243474	352
60	3300031852	Ga0307410_10112891	Ga0307410_101128911	352
61	3300031901	Ga0307406_10184082	Ga0307406_101840821	352
62	3300032002	Ga0307416_100095845	Ga0307416_1000958452	352
63	3300044765	Ga0466970_0034035	Ga0466970_0034035_110_1204	352
64	3300048905	Ga0496102_0064712	Ga0496102_0064712_1133_2194	352
65	3300048906	Ga0496103_0039571	Ga0496103_0039571_559_1620	352
66	3300048920	Ga0496117_0001678	Ga0496117_0001678_4125_5219	352
67	3300048920	Ga0496117_0012435	Ga0496117_0012435_5289_6350	352
68	3300048920	Ga0496117_0115708	Ga0496117_0115708_298_1359	352
69	3300048921	Ga0496118_0000289	Ga0496118_0000289_23378_24439	352
70	3300048921	Ga0496118_0000290	Ga0496118_0000290_82183_83277	352
71	3300048922	Ga0496119_0009975	Ga0496119_0009975_4735_5829	352
72	3300048923	Ga0496120_0028704	Ga0496120_0028704_350_1444	352
73	3300048924	Ga0496121_0026240	Ga0496121_0026240_541_1602	352
74	3300048924	Ga0496121_0235471	Ga0496121_0235471_72_1172	352
75	3300048924	Ga0496121_0240447	Ga0496121_0240447_94_1155	352
76	3300048925	Ga0496122_0038055	Ga0496122_0038055_443_1537	352
77	3300048926	Ga0496123_0028446	Ga0496123_0028446_822_1916	352
78	3300048927	Ga0496124_0000040	Ga0496124_0000040_251167_252261	352
79	3300048927	Ga0496124_0031168	Ga0496124_0031168_588_1688	352
80	3300048927	Ga0496124_0044569	Ga0496124_0044569_679_1740	352
81	3300048927	Ga0496124_0169289	Ga0496124_0169289_177_1277	352
82	3300049581	Ga0501047_0022252	Ga0501047_0022252_3569_4630	352
83	iso_pu_bacteria	2728369276	2729909599	352
84	iso_pu_bacteria	2751185788	2753302978	352
85	iso_pu_bacteria	2773857758	2774381272	352
86	iso_pu_bacteria	2808606370	2808892816	352
87	iso_pu_bacteria	2852677369	2852678837	352
88	iso_pu_bacteria	2857720070	2857720491	352
89	iso_pu_bacteria	2904430863	2904431705	352
90	iso_pu_bacteria	2904501621	2904504243	352
91	iso_pu_bacteria	2908674828	2908676441	352
92	iso_pu_bacteria	2909074476	2909077410	352
93	iso_pu_bacteria	2919039151	2919039227	352
94	iso_pu_bacteria	2919042368	2919042587	352
95	iso_pu_bacteria	2919391150	2919395220	352
96	iso_pu_bacteria	2920879853	2920880422	352
97	iso_pu_bacteria	2928104781	2928104902	352
98	iso_pu_bacteria	2928500415	2928503035	352
99	iso_pu_bacteria	2945956166	2945958756	352
100	iso_pu_bacteria	2966924647	2966926850	352
101	iso_pu_bacteria	2974315732	2974318410	352
102	iso_pu_bacteria	2977228692	2977229208	352
103	iso_pu_bacteria	2977236895	2977238754	352
104	iso_pu_bacteria	2984523437	2984526619	352
105	iso_pu_bacteria	2984542743	2984543462	352
106	iso_pu_bacteria	2984551494	2984555133	352
107	3300015261	Ga0182006_1001126	Ga0182006_10011267	353
108	3300027111	Ga0209281_1002595	Ga0209281_10025954	353
109	3300027111	Ga0209281_1019483	Ga0209281_10194831	353
110	3300031238	Ga0265332_10005385	Ga0265332_100053855	353
111	3300031548	Ga0307408_100004233	Ga0307408_1000042333	353
112	3300031548	Ga0307408_100087206	Ga0307408_1000872062	353
113	3300031731	Ga0307405_10025403	Ga0307405_100254033	353
114	3300031852	Ga0307410_10175676	Ga0307410_101756762	353
115	3300031911	Ga0307412_10016969	Ga0307412_100169691	353
116	3300031911	Ga0307412_10050990	Ga0307412_100509902	353
117	3300032002	Ga0307416_100161917	Ga0307416_1001619172	353
118	3300032002	Ga0307416_100318224	Ga0307416_1003182242	353
119	3300032005	Ga0307411_10010305	Ga0307411_100103055	353
120	3300041405	Ga0439438_001086	Ga0439438_001086_7628_8689	353
121	3300041405	Ga0439438_002632	Ga0439438_002632_3056_4117	353
122	3300041407	Ga0439447_033322	Ga0439447_033322_191_1252	353
123	3300042006	Ga0439432_000435	Ga0439432_000435_10579_11640	353
124	3300042010	Ga0439452_000024	Ga0439452_000024_165459_166520	353
125	3300042010	Ga0439452_000072	Ga0439452_000072_67516_68577	353
126	3300042013	Ga0439456_011319	Ga0439456_011319_657_1718	353
127	3300042016	Ga0439463_025593	Ga0439463_025593_71_1132	353
128	3300042115	Ga0450911_000060	Ga0450911_000060_9257_10318	353
129	3300042145	Ga0450906_000025	Ga0450906_000025_2199_3260	353
130	3300046452	Ga0495617_000440	Ga0495617_000440_19779_20840	353
131	3300046453	Ga0495627_000528	Ga0495627_000528_16518_17579	353
132	3300046458	Ga0495591_001413	Ga0495591_001413_9464_10525	353
133	3300046501	Ga0495607_0002787	Ga0495607_0002787_106_1167	353
134	3300046507	Ga0495606_0001751	Ga0495606_0001751_12119_13180	353
135	3300046507	Ga0495606_0002211	Ga0495606_0002211_1115_2176	353
136	3300046507	Ga0495606_0033177	Ga0495606_0033177_1421_2482	353
137	3300046512	Ga0495610_0016172	Ga0495610_0016172_1083_2144	353
138	3300046513	Ga0495616_0027586	Ga0495616_0027586_856_1917	353
139	3300046519	Ga0495632_0000208	Ga0495632_0000208_11448_12509	353
140	3300046519	Ga0495632_0015450	Ga0495632_0015450_1082_2143	353
141	3300046519	Ga0495632_0024566	Ga0495632_0024566_772_1833	353
142	3300046522	Ga0495643_0005398	Ga0495643_0005398_581_1642	353
143	3300046522	Ga0495643_0005677	Ga0495643_0005677_4939_6000	353
144	3300046530	Ga0495654_0000399	Ga0495654_0000399_8609_9670	353
145	3300046530	Ga0495654_0001333	Ga0495654_0001333_968_2029	353
146	3300046530	Ga0495654_0068055	Ga0495654_0068055_400_1461	353
147	3300046542	Ga0495597_0000253	Ga0495597_0000253_3312_4373	353
148	3300046542	Ga0495597_0006591	Ga0495597_0006591_522_1583	353
149	3300046692	Ga0495671_0000194	Ga0495671_0000194_40716_41777	353
150	3300046692	Ga0495671_0089920	Ga0495671_0089920_210_1271	353
151	3300046810	Ga0495660_0000626	Ga0495660_0000626_4986_6047	353
152	3300047320	Ga0495672_0000213	Ga0495672_0000213_37671_38732	353
153	3300047320	Ga0495672_0005973	Ga0495672_0005973_2328_3434	353
154	3300047323	Ga0495683_0000013	Ga0495683_0000013_343_1404	353
155	3300047323	Ga0495683_0001852	Ga0495683_0001852_133_1194	353
156	3300047323	Ga0495683_0044142	Ga0495683_0044142_1021_2082	353
157	3300047469	Ga0495673_0000227	Ga0495673_0000227_19791_20852	353
158	3300047469	Ga0495673_0001804	Ga0495673_0001804_2470_3531	353
159	3300048905	Ga0496102_0004715	Ga0496102_0004715_6645_7736	353
160	3300048912	Ga0496109_0168462	Ga0496109_0168462_175_1266	353
161	3300048913	Ga0496110_0016105	Ga0496110_0016105_3059_4150	353
162	3300048914	Ga0496111_0002466	Ga0496111_0002466_3605_4696	353
163	3300048920	Ga0496117_0018604	Ga0496117_0018604_3353_4453	353
164	3300048925	Ga0496122_0001766	Ga0496122_0001766_28364_29425	353
165	3300049459	Ga0495678_021637	Ga0495678_021637_1071_2132	353
166	3300049673	Ga0501240_000044	Ga0501240_000044_673_1734	353
167	3300049758	Ga0501241_000379	Ga0501241_000379_2680_3741	353
168	iso_pu_bacteria	2690315906	2691515506	353
169	iso_pu_bacteria	2808606357	2808828637	353
170	iso_pu_bacteria	2808606360	2808849910	353
171	iso_pu_bacteria	2808606366	2808877524	353
172	iso_pu_bacteria	2808606700	2810364976	353
173	iso_pu_bacteria	2811994871	2812319643	353
174	iso_pu_bacteria	2905926851	2905928844	353
175	iso_pu_bacteria	2939598168	2939601578	353
176	iso_pu_bacteria	2946003308	2946006022	353
177	iso_pu_bacteria	2946037020	2946037329	353
178	iso_pu_bacteria	2966921586	2966923565	353
179	iso_pu_bacteria	2974302888	2974305397	353
180	3300005327	Ga0070658_10020514	Ga0070658_100205144	354
181	3300005328	Ga0070676_10188290	Ga0070676_101882902	354
182	3300005330	Ga0070690_100017023	Ga0070690_1000170233	354
183	3300005331	Ga0070670_100006895	Ga0070670_1000068954	354
184	3300005334	Ga0068869_100006569	Ga0068869_1000065692	354
185	3300005335	Ga0070666_10018943	Ga0070666_100189433	354
186	3300005335	Ga0070666_10043182	Ga0070666_100431823	354
187	3300005336	Ga0070680_100005605	Ga0070680_1000056054	354
188	3300005337	Ga0070682_100001587	Ga0070682_1000015876	354
189	3300005339	Ga0070660_100264334	Ga0070660_1002643341	354
190	3300005340	Ga0070689_100186851	Ga0070689_1001868512	354
191	3300005341	Ga0070691_10008139	Ga0070691_100081394	354
192	3300005347	Ga0070668_100067256	Ga0070668_1000672562	354
193	3300005354	Ga0070675_100102774	Ga0070675_1001027742	354
194	3300005355	Ga0070671_100008158	Ga0070671_1000081585	354
195	3300005356	Ga0070674_100012705	Ga0070674_1000127055	354
196	3300005367	Ga0070667_100194637	Ga0070667_1001946371	354
197	3300005434	Ga0070709_10015233	Ga0070709_100152333	354
198	3300005435	Ga0070714_100044523	Ga0070714_1000445232	354
199	3300005435	Ga0070714_100171496	Ga0070714_1001714962	354
200	3300005436	Ga0070713_100005304	Ga0070713_1000053041	354
201	3300005438	Ga0070701_10014833	Ga0070701_100148331	354
202	3300005439	Ga0070711_100040835	Ga0070711_1000408353	354
203	3300005441	Ga0070700_100238499	Ga0070700_1002384991	354
204	3300005455	Ga0070663_100002768	Ga0070663_1000027681	354
205	3300005456	Ga0070678_100001715	Ga0070678_1000017154	354
206	3300005458	Ga0070681_10014719	Ga0070681_100147192	354
207	3300005459	Ga0068867_100083859	Ga0068867_1000838593	354
208	3300005466	Ga0070685_10094045	Ga0070685_100940452	354
209	3300005535	Ga0070684_100268176	Ga0070684_1002681761	354
210	3300005543	Ga0070672_100065808	Ga0070672_1000658082	354
211	3300005548	Ga0070665_100008406	Ga0070665_1000084068	354
212	3300005563	Ga0068855_100127592	Ga0068855_1001275922	354
213	3300005564	Ga0070664_100012261	Ga0070664_1000122615	354
214	3300005578	Ga0068854_100043393	Ga0068854_1000433932	354
215	3300005614	Ga0068856_100098097	Ga0068856_1000980972	354
216	3300005615	Ga0070702_100001844	Ga0070702_1000018445	354
217	3300005616	Ga0068852_100001162	Ga0068852_10000116211	354
218	3300005616	Ga0068852_100011762	Ga0068852_1000117623	354
219	3300005617	Ga0068859_100026040	Ga0068859_1000260402	354
220	3300005618	Ga0068864_100021877	Ga0068864_1000218773	354
221	3300005718	Ga0068866_10031604	Ga0068866_100316042	354
222	3300005719	Ga0068861_100059406	Ga0068861_1000594063	354
223	3300005834	Ga0068851_10000015	Ga0068851_1000001597	354
224	3300005834	Ga0068851_10024545	Ga0068851_100245453	354
225	3300005840	Ga0068870_10001039	Ga0068870_100010392	354
226	3300005841	Ga0068863_100017518	Ga0068863_1000175182	354
227	3300005842	Ga0068858_100009829	Ga0068858_1000098293	354
228	3300005844	Ga0068862_100062265	Ga0068862_1000622652	354
229	3300006058	Ga0075432_10019646	Ga0075432_100196462	354
230	3300006237	Ga0097621_100047542	Ga0097621_1000475422	354
231	3300006844	Ga0075428_100077791	Ga0075428_1000777913	354
232	3300006847	Ga0075431_100092726	Ga0075431_1000927263	354
233	3300006852	Ga0075433_10003899	Ga0075433_100038996	354
234	3300006871	Ga0075434_100029575	Ga0075434_1000295752	354
235	3300006880	Ga0075429_100032110	Ga0075429_1000321103	354
236	3300006914	Ga0075436_100002363	Ga0075436_1000023636	354
237	3300006931	Ga0097620_100026039	Ga0097620_1000260392	354
238	3300007076	Ga0075435_100003586	Ga0075435_1000035862	354
239	3300009093	Ga0105240_10079123	Ga0105240_100791233	354
240	3300009094	Ga0111539_10014262	Ga0111539_100142626	354
241	3300009098	Ga0105245_10010913	Ga0105245_100109133	354
242	3300009101	Ga0105247_10006743	Ga0105247_100067433	354
243	3300009101	Ga0105247_10086411	Ga0105247_100864112	354
244	3300009147	Ga0114129_10040041	Ga0114129_100400416	354
245	3300009148	Ga0105243_10042801	Ga0105243_100428013	354
246	3300009174	Ga0105241_10005951	Ga0105241_100059515	354
247	3300009177	Ga0105248_10035149	Ga0105248_100351494	354
248	3300009545	Ga0105237_10001195	Ga0105237_1000119513	354
249	3300009551	Ga0105238_10000985	Ga0105238_1000098510	354
250	3300009551	Ga0105238_10010085	Ga0105238_100100854	354
251	3300009553	Ga0105249_10114808	Ga0105249_101148083	354
252	3300010375	Ga0105239_10026930	Ga0105239_100269304	354
253	3300010375	Ga0105239_10080819	Ga0105239_100808193	354
254	3300011119	Ga0105246_10022108	Ga0105246_100221083	354
255	3300013104	Ga0157370_10076505	Ga0157370_100765053	354
256	3300013297	Ga0157378_10058521	Ga0157378_100585213	354
257	3300013306	Ga0163162_10076528	Ga0163162_100765283	354
258	3300013307	Ga0157372_10009603	Ga0157372_100096035	354
259	3300013308	Ga0157375_10040811	Ga0157375_100408113	354
260	3300014325	Ga0163163_10009649	Ga0163163_100096493	354
261	3300014968	Ga0157379_10079442	Ga0157379_100794423	354
262	3300017792	Ga0163161_10055725	Ga0163161_100557253	354
263	3300020081	Ga0206354_10041880	Ga0206354_100418802	354
264	3300020081	Ga0206354_11374799	Ga0206354_113747992	354
265	3300020082	Ga0206353_10971666	Ga0206353_109716662	354
266	3300025321	Ga0207656_10000001	Ga0207656_10000001787	354
267	3300025901	Ga0207688_10004596	Ga0207688_100045964	354
268	3300025903	Ga0207680_10021600	Ga0207680_100216003	354
269	3300025906	Ga0207699_10005008	Ga0207699_100050083	354
270	3300025907	Ga0207645_10188367	Ga0207645_101883672	354
271	3300025908	Ga0207643_10000594	Ga0207643_1000059412	354
272	3300025909	Ga0207705_10008467	Ga0207705_100084673	354
273	3300025909	Ga0207705_10017388	Ga0207705_100173884	354
274	3300025911	Ga0207654_10001922	Ga0207654_100019226	354
275	3300025913	Ga0207695_10163164	Ga0207695_101631642	354
276	3300025914	Ga0207671_10000001	Ga0207671_10000001786	354
277	3300025915	Ga0207693_10009609	Ga0207693_100096093	354
278	3300025916	Ga0207663_10007387	Ga0207663_100073875	354
279	3300025917	Ga0207660_10004032	Ga0207660_100040323	354
280	3300025919	Ga0207657_10011837	Ga0207657_100118373	354
281	3300025920	Ga0207649_10001959	Ga0207649_100019592	354
282	3300025921	Ga0207652_10018869	Ga0207652_100188694	354
283	3300025924	Ga0207694_10000052	Ga0207694_1000005261	354
284	3300025925	Ga0207650_10001016	Ga0207650_100010168	354
285	3300025926	Ga0207659_10003036	Ga0207659_100030366	354
286	3300025928	Ga0207700_10349340	Ga0207700_103493401	354
287	3300025929	Ga0207664_10057802	Ga0207664_100578022	354
288	3300025931	Ga0207644_10000953	Ga0207644_100009536	354
289	3300025932	Ga0207690_10032399	Ga0207690_100323992	354
290	3300025933	Ga0207706_10070419	Ga0207706_100704192	354
291	3300025935	Ga0207709_10024558	Ga0207709_100245584	354
292	3300025937	Ga0207669_10004387	Ga0207669_100043873	354
293	3300025940	Ga0207691_10022729	Ga0207691_100227292	354
294	3300025940	Ga0207691_10066275	Ga0207691_100662753	354
295	3300025941	Ga0207711_10033529	Ga0207711_100335293	354
296	3300025942	Ga0207689_10001431	Ga0207689_1000143112	354
297	3300025942	Ga0207689_10014654	Ga0207689_100146544	354
298	3300025944	Ga0207661_10000322	Ga0207661_1000032228	354
299	3300025944	Ga0207661_10183267	Ga0207661_101832672	354
300	3300025945	Ga0207679_10003328	Ga0207679_100033284	354
301	3300025961	Ga0207712_10070082	Ga0207712_100700823	354
302	3300025972	Ga0207668_10060188	Ga0207668_100601883	354
303	3300025972	Ga0207668_10116723	Ga0207668_101167232	354
304	3300025981	Ga0207640_10088990	Ga0207640_100889902	354
305	3300026023	Ga0207677_10002359	Ga0207677_100023596	354
306	3300026067	Ga0207678_10001818	Ga0207678_100018189	354
307	3300026075	Ga0207708_10114530	Ga0207708_101145302	354
308	3300026075	Ga0207708_10129183	Ga0207708_101291832	354
309	3300026078	Ga0207702_10001992	Ga0207702_100019926	354
310	3300026078	Ga0207702_10004459	Ga0207702_100044598	354
311	3300026088	Ga0207641_10018686	Ga0207641_100186864	354
312	3300026089	Ga0207648_10242148	Ga0207648_102421482	354
313	3300026095	Ga0207676_10000896	Ga0207676_1000089612	354
314	3300026116	Ga0207674_10014697	Ga0207674_100146973	354
315	3300026118	Ga0207675_100050902	Ga0207675_1000509023	354
316	3300026118	Ga0207675_100139175	Ga0207675_1001391752	354
317	3300026121	Ga0207683_10001721	Ga0207683_1000172112	354
318	3300026142	Ga0207698_10000510	Ga0207698_1000051011	354
319	3300027907	Ga0207428_10004514	Ga0207428_100045146	354
320	3300028381	Ga0268264_10280595	Ga0268264_102805951	354
321	3300028794	Ga0307515_10002934	Ga0307515_100029347	354
322	3300035090	Ga0373949_0000785	Ga0373949_0000785_374_1447	354
323	3300044683	Ga0466965_0051882	Ga0466965_0051882_119_1198	354
324	3300044683	Ga0466965_0124930	Ga0466965_0124930_225_1304	354
325	3300044901	Ga0466960_0105527	Ga0466960_0105527_357_1436	354
326	3300046471	Ga0495650_0000781	Ga0495650_0000781_8220_9290	354
327	3300046491	Ga0495584_0074869	Ga0495584_0074869_231_1295	354
328	3300046522	Ga0495643_0046625	Ga0495643_0046625_533_1606	354
329	3300046684	Ga0495669_0012101	Ga0495669_0012101_1054_2118	354
330	3300048903	Ga0496100_0046720	Ga0496100_0046720_539_1612	354
331	3300048904	Ga0496101_0023982	Ga0496101_0023982_416_1489	354
332	3300048904	Ga0496101_0094553	Ga0496101_0094553_668_1732	354
333	3300048905	Ga0496102_0007064	Ga0496102_0007064_7088_8161	354
334	3300048905	Ga0496102_0078263	Ga0496102_0078263_300_1364	354
335	3300048908	Ga0496105_0030999	Ga0496105_0030999_495_1568	354
336	3300048909	Ga0496106_0004071	Ga0496106_0004071_6972_8045	354
337	3300048909	Ga0496106_0365809	Ga0496106_0365809_54_1118	354
338	3300048910	Ga0496107_0003209	Ga0496107_0003209_8262_9335	354
339	3300048911	Ga0496108_0004435	Ga0496108_0004435_8759_9832	354
340	3300048913	Ga0496110_0006184	Ga0496110_0006184_2653_3726	354
341	3300048914	Ga0496111_0002672	Ga0496111_0002672_7140_8213	354
342	3300048915	Ga0496112_0019405	Ga0496112_0019405_1997_3070	354
343	3300050507	nmdc:mga05p37_484948_c1	nmdc:mga05p37_484948_c1_144_1217	354
344	3300050508	nmdc:mga09592_138722_c1	nmdc:mga09592_138722_c1_944_2017	354
345	3300050510	nmdc:mga06r32_18827_c1	nmdc:mga06r32_18827_c1_3649_4722	354
346	3300050511	nmdc:mga08y16_10104_c1	nmdc:mga08y16_10104_c1_7587_8660	354
347	3300050512	nmdc:mga0n895_9090_c1	nmdc:mga0n895_9090_c1_568_1641	354
348	3300050513	nmdc:mga0rr50_2270_c1	nmdc:mga0rr50_2270_c1_5547_6620	354
349	3300050514	nmdc:mga08x19_1922_c1	nmdc:mga08x19_1922_c1_5901_6974	354
350	3300050515	nmdc:mga0a205_2513_c1	nmdc:mga0a205_2513_c1_7353_8426	354
351	3300053086	Ga0500578_0192944	Ga0500578_0192944_57_1130	354
352	3300053094	Ga0500566_0048429	Ga0500566_0048429_1221_2294	354
353	3300053094	Ga0500566_0103111	Ga0500566_0103111_96_1169	354
354	3300053123	Ga0500614_009647	Ga0500614_009647_504_1577	354
355	3300053130	Ga0500642_0090026	Ga0500642_0090026_40_1113	354
356	3300053140	Ga0500573_0001202	Ga0500573_0001202_1231_2328	354
357	3300053148	Ga0500590_007178	Ga0500590_007178_1533_2603	354
358	3300053153	Ga0500616_0000010	Ga0500616_0000010_672188_673270	354
359	3300053177	Ga0500636_0108008	Ga0500636_0108008_55_1128	354
360	3300053730	Ga0500645_010855	Ga0500645_010855_207_1286	354
361	iso_pu_bacteria	2844852863	2844853256	354
362	iso_pu_bacteria	8057345674	8057346318	354
363	3300005353	Ga0070669_100072697	Ga0070669_1000726973	355
364	3300005364	Ga0070673_100037897	Ga0070673_1000378974	355
365	3300005456	Ga0070678_100152046	Ga0070678_1001520463	355
366	3300005985	Ga0081539_10000057	Ga0081539_1000005753	355
367	3300009011	Ga0105251_10000842	Ga0105251_1000084217	355
368	3300009011	Ga0105251_10013950	Ga0105251_100139504	355
369	3300009092	Ga0105250_10017182	Ga0105250_100171822	355
370	3300013104	Ga0157370_10062805	Ga0157370_100628052	355
371	3300013105	Ga0157369_10009353	Ga0157369_100093535	355
372	3300013307	Ga0157372_10191669	Ga0157372_101916692	355
373	3300025233	Ga0209437_100032	Ga0209437_100032456	355
374	3300025315	Ga0207697_10014980	Ga0207697_100149804	355
375	3300025728	Ga0207655_1007620	Ga0207655_10076202	355
376	3300025728	Ga0207655_1040915	Ga0207655_10409152	355
377	3300025735	Ga0207713_1000011	Ga0207713_1000011486	355
378	3300025893	Ga0207682_10003456	Ga0207682_100034568	355
379	3300025907	Ga0207645_10053292	Ga0207645_100532921	355
380	3300025940	Ga0207691_10000652	Ga0207691_100006522	355
381	3300025941	Ga0207711_10193439	Ga0207711_101934392	355
382	3300025972	Ga0207668_10083995	Ga0207668_100839952	355
383	3300026121	Ga0207683_10056282	Ga0207683_100562822	355
384	3300037312	Ga0395899_0014768	Ga0395899_0014768_1076_2143	355
385	3300046457	Ga0495590_0000359	Ga0495590_0000359_11446_12513	355
386	3300046476	Ga0495662_0031438	Ga0495662_0031438_615_1706	355
387	3300046557	Ga0495622_0000083	Ga0495622_0000083_78332_79399	355
388	3300046615	Ga0495656_0007665	Ga0495656_0007665_96_1187	355
389	3300046674	Ga0495588_0017420	Ga0495588_0017420_1439_2524	355
390	3300046691	Ga0495670_0083873	Ga0495670_0083873_181_1269	355
391	3300046809	Ga0495600_0168057	Ga0495600_0168057_287_1378	355
392	3300047315	Ga0495581_0007410	Ga0495581_0007410_3747_4838	355
393	3300047315	Ga0495581_0039544	Ga0495581_0039544_573_1664	355
394	3300047322	Ga0495680_0046718	Ga0495680_0046718_1301_2392	355
395	3300047445	Ga0495677_0073002	Ga0495677_0073002_71_1162	355
396	3300048903	Ga0496100_0045738	Ga0496100_0045738_444_1580	355
397	3300048905	Ga0496102_0030896	Ga0496102_0030896_3556_4623	355
398	3300048905	Ga0496102_0302991	Ga0496102_0302991_223_1290	355
399	3300048906	Ga0496103_0030496	Ga0496103_0030496_2154_3245	355
400	3300048906	Ga0496103_0081398	Ga0496103_0081398_351_1418	355
401	3300048907	Ga0496104_0064304	Ga0496104_0064304_354_1421	355
402	3300048910	Ga0496107_0181362	Ga0496107_0181362_22_1113	355
403	3300048911	Ga0496108_0115126	Ga0496108_0115126_648_1739	355
404	3300048911	Ga0496108_0239864	Ga0496108_0239864_280_1347	355
405	3300048912	Ga0496109_0009329	Ga0496109_0009329_6941_8008	355
406	3300048913	Ga0496110_0006196	Ga0496110_0006196_1324_2391	355
407	3300048913	Ga0496110_0134544	Ga0496110_0134544_628_1764	355
408	3300048914	Ga0496111_0101744	Ga0496111_0101744_519_1655	355
409	3300048917	Ga0496114_0002522	Ga0496114_0002522_12702_13769	355
410	3300048917	Ga0496114_0199255	Ga0496114_0199255_69_1136	355
411	3300048920	Ga0496117_0000017	Ga0496117_0000017_307099_308166	355
412	3300048921	Ga0496118_0000018	Ga0496118_0000018_307099_308166	355
413	3300048925	Ga0496122_0001299	Ga0496122_0001299_19176_20243	355
414	3300048926	Ga0496123_0001034	Ga0496123_0001034_19176_20243	355
415	3300053140	Ga0500573_0058439	Ga0500573_0058439_758_1855	355
416	3300053142	Ga0500577_0004078	Ga0500577_0004078_241_1353	355
417	3300053142	Ga0500577_0026354	Ga0500577_0026354_690_1787	355
418	iso_pu_bacteria	2870622029	2870623253	355
419	iso_pu_bacteria	2939657138	2939657695	355
420	3300005985	Ga0081539_10012305	Ga0081539_100123057	356
421	3300026116	Ga0207674_10024655	Ga0207674_100246554	356
422	3300032126	Ga0307415_100233341	Ga0307415_1002333411	356
423	3300035119	Ga0373956_0031192	Ga0373956_0031192_722_1792	356
424	3300035410	Ga0373924_0064198	Ga0373924_0064198_141_1211	356
425	3300046454	Ga0495592_0163091	Ga0495592_0163091_202_1272	356
426	3300046462	Ga0495651_0004073	Ga0495651_0004073_8259_9329	356
427	3300046516	Ga0495628_0000176	Ga0495628_0000176_29074_30147	356
428	3300046529	Ga0495652_0021834	Ga0495652_0021834_2223_3293	356
429	3300046536	Ga0495587_0111243	Ga0495587_0111243_177_1247	356
430	3300046675	Ga0495657_0018780	Ga0495657_0018780_1585_2655	356
431	3300047322	Ga0495680_0015720	Ga0495680_0015720_1729_2799	356
432	3300047444	Ga0495675_0035660	Ga0495675_0035660_1152_2222	356
433	3300048088	Ga0495602_0001974	Ga0495602_0001974_18782_19855	356
434	3300048088	Ga0495602_0021879	Ga0495602_0021879_1486_2556	356
435	3300048913	Ga0496110_0008070	Ga0496110_0008070_5464_6534	356
436	3300048914	Ga0496111_0014475	Ga0496111_0014475_2752_3822	356
437	3300053085	Ga0495619_0038355	Ga0495619_0038355_1553_2623	356
438	3300053140	Ga0500573_0007498	Ga0500573_0007498_2611_3762	356
439	3300046533	Ga0495640_0206274	Ga0495640_0206274_11_1084	357
440	iso_pu_bacteria	2964326757	2964328121	358
441	3300005329	Ga0070683_100006108	Ga0070683_1000061087	359
442	3300005985	Ga0081539_10002416	Ga0081539_1000241620	361
443	3300053153	Ga0500616_0000106	Ga0500616_0000106_121537_122628	361
444	iso_pu_bacteria	2919446982	2919448048	363
445	3300002705	JGI25156J39149_1000339	JGI25156J39149_10003397	368
446	3300046459	Ga0495629_0000033	Ga0495629_0000033_116037_117143	368

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22917

PRISE

PRISE-like Rossmann-fold domain

32

380

0.89 PF13460

NAD_binding_10

NAD(P)H-binding

36

160

0.85 PF01370

Epimerase

NAD dependent epimerase/dehydratase family

32

267

0.81 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2v6g-assembly1.cif.gz_A	structure of progesterone 5beta-reductase from digitalis lanata in complex with nadp	0.9525	2	354
5mlh-assembly1.cif.gz_A	plantago major multifunctional oxidoreductase in complex with 8-oxogeranial and nadp+	0.9502	2	354
6el3-assembly3.cif.gz_B	structure of progesterone 5beta-reductase from arabidopsis thaliana in complex with nadp	0.9494	1	354
5mlr-assembly1.cif.gz_A-2	plantago major multifunctional oxidoreductase v150m mutant in complex with citral and nadp+	0.9492	2	354
2v6f-assembly1.cif.gz_A	structure of progesterone 5beta-reductase from digitalis lanata	0.9361	2	354

ID	Description	Score	Start	End	Superfamily
af_Q9STX2_25_388_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9506	1	354	3.40.50.720
af_I1KMT6_5_372_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9347	3	354	3.40.50.720
af_Q9STX2_25_388_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9227	1	354	3.40.50.720
af_A0A0P0VZR0_3_273_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9019	34	270	3.40.50.720
af_O74913_7_403_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9004	5	354	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A158DZG8-F1-model_v4	NAD-dependent epimerase/dehydratase	0.9955	1	355	GO:0016491 GO:0046872
AF-A0A2H1TNL3-F1-model_v4	deleted	0.9907	161	354
AF-A0A369Q2D5-F1-model_v4	3-oxo-Delta(4,5)-steroid 5-beta-reductase	0.9903	211	354
AF-A0A3M3NRQ8-F1-model_v4	Aldo-keto reductase protein	0.9898	192	354
AF-A0A4Q5QR50-F1-model_v4	NAD-dependent epimerase	0.9895	132	354

Feature Viewer

pLDDT	pTM	Quality
91.23	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F445829

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF22917

PRISE

PRISE-like Rossmann-fold domain

32

380

0.89

PF13460

NAD_binding_10

NAD(P)H-binding

36

160

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

32

267

0.81

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map