F445787

General Info

Members Datasets Scaffolds Average Seq Length
446 194 360 390

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000204|Ga0495650_0000204_104445_105689
Length 414
Sequence LSNAGLKPIPAPLYFAVINRIEAFMFDFDRVIDRHGSWCTQWDFVADRFGRDDLLPFTISDMDFATAPCILSALQHRVQHGVLGYSRWQHEDFLTAIDHWYQQRFALHVDRQQIVYGPSVIYMVAQLIRHWSSAGDAVLIHTPAYDAFYKAIEGNDRQVLSLPLVCNRAEWQCDMAALESLLSRDECKIMLLCSPHNPTGKVWRRDELQQMADLCQRHGVQVISDEIHMDMVMGDQPHVPWIAVARGRWALFTSASKSFNVPALTGAYGFISDEADREAWFHALKSADGLSSPAVMAVAAHIAAYREGAEWLDALRDYLRANLQQVARRLNQAFPQLNWQPPQATYLAWIDLNPLGLGDKALQKALIEQQKVAIMPGYTYGPQGNGYLRLNVGCPRSKLDDGLDRLIAAIESLL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
8 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
9 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
10 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
11 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
12 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
13 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
14 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
15 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
16 2636415599 Klebsiella variicola DX120E Isolate Unclassified
17 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
18 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
19 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
20 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
21 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
22 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
23 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
24 2751185917 Enterobacter sp. HK169 Isolate Unclassified
25 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
26 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
27 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
28 2775507074 Klebsiella sp. D5A Isolate Unclassified
29 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
30 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
31 2821118458 Enterobacter asburiae 609 Isolate Unclassified
32 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
33 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
34 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
35 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
36 2847085930 Erwinia persicina B64 Isolate Bulb
37 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
38 2865014394 Pantoea sp. R-71966 Isolate Unclassified
39 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
40 2876601092 Pantoea endophytica 596 Isolate Unclassified
41 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
42 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
43 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
44 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
45 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
46 2904504865 Serratia marcescens 1822 Isolate Unclassified
47 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
48 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
49 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
50 2919150387 Rahnella aceris 1817 Isolate Unclassified
51 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
52 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
53 2927143783 Rahnella sp. 2050 Isolate Unclassified
54 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
55 2932406140 Serratia sp. 2723 Isolate Rhizosphere
56 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
57 2937539931 Pantoea sp. LS15 Isolate Unclassified
58 2937967321 Serratia sp. YC16 Isolate Unclassified
59 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
60 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
61 2939577877 Serratia sp. 509 Isolate Rhizosphere
62 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
63 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
64 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
65 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
66 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
67 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
68 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
69 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
70 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
71 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
72 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
73 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
74 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
75 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
76 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
77 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
78 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
79 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
80 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
81 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
82 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
101 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
102 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
103 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
112 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
127 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
128 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
132 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
133 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
134 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
180 640753048 Serratia proteamaculans 568 Isolate Endosphere
181 8004592986 Serratia sp. S119 Isolate Unclassified
182 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
183 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
184 8018221730 Enterobacter sp. CM29 Isolate Unclassified
185 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
186 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
187 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
188 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
189 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
190 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
191 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
192 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
193 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
194 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.72
Metatranscriptomes 0
Isolates 19.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0.22
Endosphere 5.61
Nodule 4.48
Rhizoplane 5.16
Rhizosphere 48.43
Stem 0
Stem Tuber 0
Unclassified 35.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2730796 2162886007 Bacteria 3032
2 JGI25162J39368_1000009 3300002737 Bacteria 389795
3 JGI25163J39215_1000112 3300002771 Bacteria 33836
4 JGI25164J39214_1000002 3300002772 Bacteria 406570
5 Ga0055538_1000015 3300003751 Bacteria 311166
6 Ga0055539_1000009 3300003752 Bacteria 406566
7 Ga0055533_1000012 3300003756 Bacteria 406566
8 Ga0055525_1000014 3300003759 Bacteria 406566
9 Ga0055541_1000006 3300003841 Bacteria 406566
10 Ga0058692_1001389 3300003856 Bacteria 8957
11 Ga0058692_1005219 3300003856 Bacteria 3733
12 Ga0058692_1005220 3300003856 Bacteria 3733
13 Ga0058692_1007258 3300003856 Bacteria 2957
14 Ga0058692_1007497 3300003856 Bacteria 2888
15 Ga0065704_10000115 3300005289 Bacteria 75390
16 Ga0065704_10000297 3300005289 Bacteria 43486
17 Ga0065704_10000854 3300005289 Bacteria 11560
18 Ga0070665_100003098 3300005548 Bacteria 17905
19 Ga0068857_100000773 3300005577 Bacteria 23816
20 Ga0075364_10005738 3300006051 Bacteria 7238
21 Ga0075364_10049223 3300006051 Bacteria 2748
22 Ga0075364_10098235 3300006051 Bacteria 1948
23 Ga0079104_1000083 3300006946 Bacteria 137254
24 Ga0079104_1000218 3300006946 Bacteria 80243
25 Ga0079104_1000263 3300006946 Bacteria 69767
26 Ga0079104_1000292 3300006946 Bacteria 63382
27 Ga0079104_1000716 3300006946 Bacteria 29970
28 Ga0079104_1000733 3300006946 Bacteria 29076
29 Ga0079104_1001695 3300006946 Bacteria 14097
30 Ga0079104_1002113 3300006946 Bacteria 11343
31 Ga0079104_1002449 3300006946 Bacteria 10011
32 Ga0105251_10000002 3300009011 Bacteria 350843
33 Ga0105251_10000189 3300009011 Bacteria 62590
34 Ga0105251_10001242 3300009011 Bacteria 22091
35 Ga0105251_10003141 3300009011 Bacteria 12254
36 Ga0105251_10004870 3300009011 Bacteria 8959
37 Ga0105251_10006273 3300009011 Bacteria 7615
38 Ga0105251_10011006 3300009011 Bacteria 5197
39 Ga0105251_10012464 3300009011 Bacteria 4810
40 Ga0105251_10016137 3300009011 Bacteria 4049
41 Ga0105244_10000015 3300009036 Bacteria 256814
42 Ga0105244_10002160 3300009036 Bacteria 15082
43 Ga0105244_10002576 3300009036 Bacteria 13611
44 Ga0105244_10003001 3300009036 Bacteria 12376
45 Ga0105244_10003258 3300009036 Bacteria 11714
46 Ga0105244_10006949 3300009036 Bacteria 7250
47 Ga0105244_10029148 3300009036 Bacteria 2954
48 Ga0105244_10075016 3300009036 Bacteria 1681
49 Ga0105244_10077551 3300009036 Bacteria 1648
50 Ga0105250_10000002 3300009092 Bacteria 566949
51 Ga0105250_10000072 3300009092 Bacteria 94689
52 Ga0105250_10000113 3300009092 Bacteria 72385
53 Ga0105250_10003290 3300009092 Bacteria 7691
54 Ga0105250_10004663 3300009092 Bacteria 6270
55 Ga0105250_10006318 3300009092 Bacteria 5188
56 Ga0105250_10018996 3300009092 Bacteria 2779
57 Ga0105247_10000320 3300009101 Bacteria 43113
58 Ga0105243_10060358 3300009148 Bacteria 3029
59 Ga0105241_10000002 3300009174 Bacteria 869480
60 Ga0105246_10021366 3300011119 Bacteria 4165
61 Ga0105246_10041146 3300011119 Bacteria 3122
62 Ga0157373_10000405 3300013100 Bacteria 34603
63 Ga0157373_10001029 3300013100 Bacteria 21504
64 Ga0157373_10015376 3300013100 Bacteria 5594
65 Ga0157371_10000008 3300013102 Bacteria 393028
66 Ga0157371_10002962 3300013102 Bacteria 15794
67 Ga0157371_10010131 3300013102 Bacteria 7364
68 Ga0157371_10027004 3300013102 Bacteria 4167
69 Ga0157370_10002375 3300013104 Bacteria 22690
70 Ga0157370_10003134 3300013104 Bacteria 19581
71 Ga0157369_10020840 3300013105 Bacteria 7328
72 Ga0157372_10076707 3300013307 Bacteria 3774
73 Ga0182006_1000047 3300015261 Bacteria 187006
74 Ga0182006_1024408 3300015261 Bacteria 2494
75 Ga0183366_1001 3300015679 Bacteria 2743932
76 Ga0183370_1001 3300015680 Bacteria 2743932
77 Ga0183369_1001 3300015685 Bacteria 2743932
78 Ga0183368_1001 3300015687 Bacteria 2743932
79 Ga0163161_10000001 3300017792 Bacteria 2041488
80 Ga0209760_100120 3300025207 Bacteria 53842
81 Ga0209784_100001 3300025224 Bacteria 3600592
82 Ga0209566_100001 3300025225 Bacteria 3600765
83 Ga0209674_100002 3300025226 Bacteria 3600592
84 Ga0209563_100002 3300025230 Bacteria 2045675
85 Ga0207427_100020 3300025231 Bacteria 507515
86 Ga0209437_100001 3300025233 Bacteria 2045675
87 Ga0209437_100073 3300025233 Bacteria 302948
88 Ga0209677_100002 3300025253 Bacteria 2045675
89 Ga0209129_1000004 3300025258 Bacteria 884499
90 Ga0209233_1000610 3300025261 Bacteria 18314
91 Ga0207696_1000001 3300025711 Bacteria 2579611
92 Ga0207696_1000005 3300025711 Bacteria 642078
93 Ga0207696_1000042 3300025711 Bacteria 307256
94 Ga0207696_1000218 3300025711 Bacteria 83242
95 Ga0207696_1000292 3300025711 Bacteria 58466
96 Ga0207696_1000398 3300025711 Bacteria 40651
97 Ga0207696_1001059 3300025711 Bacteria 16268
98 Ga0207696_1002113 3300025711 Bacteria 9985
99 Ga0207696_1003125 3300025711 Bacteria 7717
100 Ga0207696_1013996 3300025711 Bacteria 2768
101 Ga0207655_1000001 3300025728 Bacteria 1866413
102 Ga0207655_1000009 3300025728 Bacteria 664676
103 Ga0207655_1000037 3300025728 Bacteria 354473
104 Ga0207655_1000061 3300025728 Bacteria 258893
105 Ga0207655_1000063 3300025728 Bacteria 257028
106 Ga0207655_1000373 3300025728 Bacteria 63082
107 Ga0207655_1001029 3300025728 Bacteria 28136
108 Ga0207655_1003246 3300025728 Bacteria 12211
109 Ga0207655_1005519 3300025728 Bacteria 8581
110 Ga0207713_1000001 3300025735 Bacteria 2295391
111 Ga0207713_1000002 3300025735 Bacteria 1061749
112 Ga0207713_1000003 3300025735 Bacteria 860698
113 Ga0207713_1000008 3300025735 Bacteria 553952
114 Ga0207713_1000016 3300025735 Bacteria 421689
115 Ga0207713_1000029 3300025735 Bacteria 285054
116 Ga0207713_1001124 3300025735 Bacteria 22760
117 Ga0207713_1001872 3300025735 Bacteria 15989
118 Ga0207713_1009037 3300025735 Bacteria 5661
119 Ga0207713_1014697 3300025735 Bacteria 4049
120 Ga0207713_1026145 3300025735 Bacteria 2681
121 Ga0207713_1040056 3300025735 Bacteria 1970
122 Ga0207710_10000113 3300025900 Bacteria 102300
123 Ga0207654_10000005 3300025911 Bacteria 869492
124 Ga0207657_10216616 3300025919 Bacteria 1535
125 Ga0207709_10037239 3300025935 Bacteria 2889
126 Ga0207709_10097551 3300025935 Bacteria 1936
127 Ga0207674_10003836 3300026116 Bacteria 18318
128 Ga0209281_1000001 3300027111 Bacteria 1933496
129 Ga0209281_1000003 3300027111 Bacteria 1260089
130 Ga0209281_1000006 3300027111 Bacteria 1170244
131 Ga0209281_1000130 3300027111 Bacteria 191756
132 Ga0209281_1000181 3300027111 Bacteria 146200
133 Ga0209281_1000287 3300027111 Bacteria 93918
134 Ga0209281_1000414 3300027111 Bacteria 64365
135 Ga0209281_1000494 3300027111 Bacteria 53600
136 Ga0209281_1000638 3300027111 Bacteria 38391
137 Ga0209281_1001424 3300027111 Bacteria 14249
138 Ga0209281_1001749 3300027111 Bacteria 11117
139 Ga0209371_1000001 3300027312 Bacteria 2771503
140 Ga0209371_1000005 3300027312 Bacteria 1061740
141 Ga0209371_1000041 3300027312 Bacteria 340377
142 Ga0209371_1000212 3300027312 Bacteria 80989
143 Ga0209371_1001290 3300027312 Bacteria 17602
144 Ga0209371_1002237 3300027312 Bacteria 11151
145 Ga0209371_1004804 3300027312 Bacteria 5680
146 Ga0209371_1011563 3300027312 Bacteria 2613
147 Ga0268266_10001737 3300028379 Bacteria 24933
148 Ga0268256_1000001 3300030500 Bacteria 2771065
149 Ga0268256_1000003 3300030500 Bacteria 1289401
150 Ga0268256_1000006 3300030500 Bacteria 1063991
151 Ga0268256_1001101 3300030500 Bacteria 17602
152 Ga0268256_1002885 3300030500 Bacteria 8251
153 Ga0268256_1011926 3300030500 Bacteria 2715
154 Ga0268256_1011927 3300030500 Bacteria 2715
155 Ga0268256_1012557 3300030500 Bacteria 2613
156 Ga0268256_1028824 3300030500 Bacteria 1365
157 Ga0439438_001385 3300041405 Bacteria 10689
158 Ga0439438_010039 3300041405 Bacteria 3025
159 Ga0439447_003034 3300041407 Bacteria 6009
160 Ga0439466_0000009 3300041411 Bacteria 232657
161 Ga0451853_3093388 3300041512 Bacteria 8241
162 Ga0439432_013185 3300042006 Bacteria 2812
163 Ga0439432_019692 3300042006 Bacteria 2246
164 Ga0439432_023040 3300042006 Bacteria 2053
165 Ga0439432_040182 3300042006 Bacteria 1484
166 Ga0439452_000002 3300042010 Bacteria 1377577
167 Ga0439452_000028 3300042010 Bacteria 204513
168 Ga0439452_000246 3300042010 Bacteria 37436
169 Ga0439452_000493 3300042010 Bacteria 21705
170 Ga0450907_000597 3300042146 Bacteria 9622
171 Ga0466981_0000002 3300044669 Bacteria 313036
172 Ga0495627_000116 3300046453 Bacteria 99916
173 Ga0495591_000013 3300046458 Bacteria 268106
174 Ga0495591_000100 3300046458 Bacteria 99473
175 Ga0495591_000763 3300046458 Bacteria 23259
176 Ga0495591_001170 3300046458 Bacteria 17125
177 Ga0495638_0001608 3300046460 Bacteria 20176
178 Ga0495650_0000005 3300046471 Bacteria 766553
179 Ga0495650_0000043 3300046471 Bacteria 357197
180 Ga0495650_0000204 3300046471 Bacteria 129303
181 Ga0495650_0016261 3300046471 Bacteria 3775
182 Ga0495584_0036764 3300046491 Bacteria 2473
183 Ga0495585_0007998 3300046492 Bacteria 6428
184 Ga0495596_0014544 3300046500 Bacteria 3316
185 Ga0495606_0002305 3300046507 Bacteria 22488
186 Ga0495620_0004508 3300046515 Bacteria 7836
187 Ga0495631_0045391 3300046518 Bacteria 1935
188 Ga0495648_0014312 3300046524 Bacteria 5815
189 Ga0495654_0000041 3300046530 Bacteria 174733
190 Ga0495654_0000167 3300046530 Bacteria 64853
191 Ga0495654_0004539 3300046530 Bacteria 8217
192 Ga0495654_0004607 3300046530 Bacteria 8140
193 Ga0495654_0025098 3300046530 Bacteria 3073
194 Ga0495609_0049290 3300046538 Bacteria 1880
195 Ga0495609_0063797 3300046538 Bacteria 1626
196 Ga0495597_0002127 3300046542 Bacteria 13118
197 Ga0495611_0057081 3300046648 Bacteria 1769
198 Ga0495625_0004823 3300046660 Bacteria 12601
199 Ga0495671_0008104 3300046692 Bacteria 5930
200 Ga0495649_0001040 3300046694 Bacteria 21746
201 Ga0495649_0003204 3300046694 Bacteria 11183
202 Ga0495589_0000001 3300046794 Bacteria 888100
203 Ga0495589_0060498 3300046794 Bacteria 1860
204 Ga0495660_0000012 3300046810 Bacteria 350701
205 Ga0495660_0000048 3300046810 Bacteria 145350
206 Ga0495660_0034009 3300046810 Bacteria 2854
207 Ga0495672_0000002 3300047320 Bacteria 740116
208 Ga0495672_0000020 3300047320 Bacteria 432845
209 Ga0495672_0000043 3300047320 Bacteria 266893
210 Ga0495683_0013394 3300047323 Bacteria 4288
211 Ga0495679_000018 3300047446 Bacteria 239433
212 Ga0495679_001854 3300047446 Bacteria 11414
213 Ga0495679_007690 3300047446 Bacteria 4467
214 Ga0495679_019407 3300047446 Bacteria 2389
215 Ga0495673_0000070 3300047469 Bacteria 217453
216 Ga0495673_0000167 3300047469 Bacteria 111793
217 Ga0496100_0074374 3300048903 Bacteria 2276
218 Ga0496100_0143490 3300048903 Bacteria 1695
219 Ga0496101_0000055 3300048904 Bacteria 136176
220 Ga0496102_0005316 3300048905 Bacteria 10935
221 Ga0496103_0150705 3300048906 Bacteria 1490
222 Ga0496104_0000091 3300048907 Bacteria 87834
223 Ga0496104_0000233 3300048907 Bacteria 49075
224 Ga0496104_0007416 3300048907 Bacteria 9693
225 Ga0496104_0308087 3300048907 Bacteria 1496
226 Ga0496105_0007743 3300048908 Bacteria 8337
227 Ga0496105_0007901 3300048908 Bacteria 8263
228 Ga0496105_0038424 3300048908 Bacteria 3943
229 Ga0496116_0000001 3300048919 Bacteria 1501681
230 Ga0496116_0000066 3300048919 Bacteria 264035
231 Ga0496116_0000305 3300048919 Bacteria 82397
232 Ga0496116_0000822 3300048919 Bacteria 39198
233 Ga0496116_0017930 3300048919 Bacteria 5474
234 Ga0496116_0031503 3300048919 Bacteria 3794
235 Ga0496116_0031679 3300048919 Bacteria 3780
236 Ga0496117_0000020 3300048920 Bacteria 458405
237 Ga0496117_0000022 3300048920 Bacteria 439512
238 Ga0496117_0000453 3300048920 Bacteria 68285
239 Ga0496117_0001256 3300048920 Bacteria 37763
240 Ga0496117_0002666 3300048920 Bacteria 22108
241 Ga0496117_0003591 3300048920 Bacteria 17896
242 Ga0496117_0005868 3300048920 Bacteria 12695
243 Ga0496117_0009820 3300048920 Bacteria 8818
244 Ga0496117_0027200 3300048920 Bacteria 4462
245 Ga0496117_0032466 3300048920 Bacteria 3965
246 Ga0496117_0077455 3300048920 Bacteria 2200
247 Ga0496117_0139365 3300048920 Bacteria 1455
248 Ga0496117_0149664 3300048920 Bacteria 1383
249 Ga0496117_0151578 3300048920 Bacteria 1371
250 Ga0496118_0000007 3300048921 Bacteria 650986
251 Ga0496118_0000015 3300048921 Bacteria 551359
252 Ga0496118_0000085 3300048921 Bacteria 179731
253 Ga0496118_0004321 3300048921 Bacteria 16946
254 Ga0496118_0004655 3300048921 Bacteria 16095
255 Ga0496118_0004751 3300048921 Bacteria 15897
256 Ga0496118_0005928 3300048921 Bacteria 13665
257 Ga0496118_0038875 3300048921 Bacteria 3806
258 Ga0496118_0088942 3300048921 Bacteria 2134
259 Ga0496118_0103092 3300048921 Bacteria 1920
260 Ga0496118_0109227 3300048921 Bacteria 1841
261 Ga0496118_0124106 3300048921 Bacteria 1676
262 Ga0496119_0000001 3300048922 Bacteria 789520
263 Ga0496119_0000570 3300048922 Bacteria 49795
264 Ga0496119_0002980 3300048922 Bacteria 17974
265 Ga0496119_0004522 3300048922 Bacteria 13800
266 Ga0496119_0004672 3300048922 Bacteria 13500
267 Ga0496119_0008290 3300048922 Bacteria 9169
268 Ga0496119_0008327 3300048922 Bacteria 9138
269 Ga0496119_0008708 3300048922 Bacteria 8855
270 Ga0496119_0067806 3300048922 Bacteria 2102
271 Ga0496119_0088649 3300048922 Bacteria 1763
272 Ga0496119_0097431 3300048922 Bacteria 1658
273 Ga0496119_0115644 3300048922 Bacteria 1481
274 Ga0496120_0000016 3300048923 Bacteria 307608
275 Ga0496120_0000952 3300048923 Bacteria 39508
276 Ga0496120_0001357 3300048923 Bacteria 30064
277 Ga0496120_0001569 3300048923 Bacteria 26742
278 Ga0496120_0003772 3300048923 Bacteria 13386
279 Ga0496120_0004407 3300048923 Bacteria 11822
280 Ga0496120_0008528 3300048923 Bacteria 7425
281 Ga0496120_0009525 3300048923 Bacteria 6878
282 Ga0496120_0019382 3300048923 Bacteria 4353
283 Ga0496120_0024080 3300048923 Bacteria 3801
284 Ga0496120_0024401 3300048923 Bacteria 3771
285 Ga0496120_0025123 3300048923 Bacteria 3701
286 Ga0496120_0060577 3300048923 Bacteria 2116
287 Ga0496120_0064680 3300048923 Bacteria 2029
288 Ga0496120_0103955 3300048923 Bacteria 1495
289 Ga0496120_0129757 3300048923 Bacteria 1292
290 Ga0496121_0002456 3300048924 Bacteria 28303
291 Ga0496121_0002791 3300048924 Bacteria 25878
292 Ga0496121_0006576 3300048924 Bacteria 14344
293 Ga0496121_0007110 3300048924 Bacteria 13586
294 Ga0496121_0009657 3300048924 Bacteria 11051
295 Ga0496121_0011073 3300048924 Bacteria 10064
296 Ga0496121_0014137 3300048924 Bacteria 8504
297 Ga0496121_0017575 3300048924 Bacteria 7292
298 Ga0496121_0116594 3300048924 Bacteria 2025
299 Ga0496122_0000005 3300048925 Bacteria 630659
300 Ga0496122_0000110 3300048925 Bacteria 190142
301 Ga0496122_0001733 3300048925 Bacteria 33832
302 Ga0496122_0003163 3300048925 Bacteria 21971
303 Ga0496122_0008753 3300048925 Bacteria 10830
304 Ga0496122_0008934 3300048925 Bacteria 10659
305 Ga0496122_0013882 3300048925 Bacteria 7839
306 Ga0496122_0036870 3300048925 Bacteria 3945
307 Ga0496122_0053379 3300048925 Bacteria 3047
308 Ga0496122_0101817 3300048925 Bacteria 1917
309 Ga0496123_0000008 3300048926 Bacteria 630628
310 Ga0496123_0000081 3300048926 Bacteria 190142
311 Ga0496123_0001180 3300048926 Bacteria 38508
312 Ga0496123_0002658 3300048926 Bacteria 21604
313 Ga0496123_0003165 3300048926 Bacteria 18795
314 Ga0496123_0004613 3300048926 Bacteria 14336
315 Ga0496123_0006929 3300048926 Bacteria 10830
316 Ga0496123_0011714 3300048926 Bacteria 7564
317 Ga0496123_0019758 3300048926 Bacteria 5296
318 Ga0496123_0082611 3300048926 Bacteria 1946
319 Ga0496123_0115590 3300048926 Bacteria 1522
320 Ga0496124_0000066 3300048927 Bacteria 222815
321 Ga0496124_0000196 3300048927 Bacteria 119375
322 Ga0496124_0000199 3300048927 Bacteria 118647
323 Ga0496124_0000425 3300048927 Bacteria 75572
324 Ga0496124_0001064 3300048927 Bacteria 43365
325 Ga0496124_0002919 3300048927 Bacteria 21557
326 Ga0496124_0011009 3300048927 Bacteria 9084
327 Ga0496124_0011522 3300048927 Bacteria 8825
328 Ga0496124_0012744 3300048927 Bacteria 8265
329 Ga0496124_0012856 3300048927 Bacteria 8222
330 Ga0496124_0022183 3300048927 Bacteria 5829
331 Ga0496124_0028916 3300048927 Bacteria 4948
332 Ga0496124_0060139 3300048927 Bacteria 3188
333 Ga0496124_0120856 3300048927 Bacteria 2093
334 Ga0496124_0151839 3300048927 Bacteria 1816
335 Ga0496124_0249347 3300048927 Bacteria 1314
336 Ga0496125_0000009 3300048928 Bacteria 677678
337 Ga0496125_0000033 3300048928 Bacteria 351850
338 Ga0496125_0002253 3300048928 Bacteria 25624
339 Ga0496125_0006899 3300048928 Bacteria 12156
340 Ga0496125_0007926 3300048928 Bacteria 11213
341 Ga0496125_0008967 3300048928 Bacteria 10374
342 Ga0496125_0012428 3300048928 Bacteria 8453
343 Ga0496125_0017697 3300048928 Bacteria 6783
344 Ga0496125_0052763 3300048928 Bacteria 3341
345 Ga0496125_0057994 3300048928 Bacteria 3130
346 Ga0496125_0063959 3300048928 Bacteria 2929
347 Ga0496125_0152600 3300048928 Bacteria 1584
348 Ga0496126_0001084 3300048929 Bacteria 45796
349 Ga0496126_0001269 3300048929 Bacteria 40626
350 Ga0496126_0024781 3300048929 Bacteria 5785
351 Ga0496126_0041444 3300048929 Bacteria 4260
352 Ga0496126_0042012 3300048929 Bacteria 4226
353 Ga0496126_0043126 3300048929 Bacteria 4163
354 Ga0496126_0072657 3300048929 Bacteria 3059
355 Ga0496126_0122434 3300048929 Bacteria 2254
356 Ga0496126_0288093 3300048929 Bacteria 1359
357 Ga0495678_000354 3300049459 Bacteria 47217
358 Ga0495682_0000001 3300049460 Bacteria 1559116
359 nmdc:mga00v17_14820_c2 3300050491 Bacteria 2952
360 Ga0500621_000003 3300053126 Bacteria 596975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0088942 Ga0496118_0088942_1117_2115 332
2 3300048928 Ga0496125_0152600 Ga0496125_0152600_28_1086 352
3 3300046538 Ga0495609_0049290 Ga0495609_0049290_57_1118 353
4 3300048922 Ga0496119_0097431 Ga0496119_0097431_24_1085 353
5 3300048919 Ga0496116_0000305 Ga0496116_0000305_30121_31320 360
6 3300048922 Ga0496119_0008327 Ga0496119_0008327_7550_8749 360
7 3300048923 Ga0496120_0000016 Ga0496120_0000016_276311_277510 360
8 3300009092 Ga0105250_10000113 Ga0105250_1000011311 371
9 3300025711 Ga0207696_1000218 Ga0207696_100021820 371
10 3300046538 Ga0495609_0063797 Ga0495609_0063797_443_1615 371
11 3300048927 Ga0496124_0022183 Ga0496124_0022183_1218_2390 371
12 3300048928 Ga0496125_0000009 Ga0496125_0000009_459750_460922 371
13 3300048929 Ga0496126_0122434 Ga0496126_0122434_179_1351 371
14 3300009011 Ga0105251_10000002 Ga0105251_10000002269 379
15 3300009011 Ga0105251_10003141 Ga0105251_100031415 379
16 3300009092 Ga0105250_10004663 Ga0105250_100046633 379
17 3300009101 Ga0105247_10000320 Ga0105247_1000032039 379
18 3300009174 Ga0105241_10000002 Ga0105241_10000002452 379
19 3300013100 Ga0157373_10001029 Ga0157373_1000102910 379
20 3300017792 Ga0163161_10000001 Ga0163161_100000011049 379
21 3300025711 Ga0207696_1000001 Ga0207696_10000011119 379
22 3300025735 Ga0207713_1000008 Ga0207713_100000877 379
23 3300025735 Ga0207713_1000016 Ga0207713_100001684 379
24 3300025900 Ga0207710_10000113 Ga0207710_1000011339 379
25 3300025911 Ga0207654_10000005 Ga0207654_10000005451 379
26 3300027111 Ga0209281_1000003 Ga0209281_1000003253 379
27 3300042006 Ga0439432_023040 Ga0439432_023040_710_1891 379
28 3300046453 Ga0495627_000116 Ga0495627_000116_98101_99282 379
29 3300046794 Ga0495589_0000001 Ga0495589_0000001_846751_847932 379
30 3300048919 Ga0496116_0000001 Ga0496116_0000001_519343_520524 379
31 3300048920 Ga0496117_0027200 Ga0496117_0027200_2898_4079 379
32 3300048922 Ga0496119_0088649 Ga0496119_0088649_228_1409 379
33 3300009011 Ga0105251_10001242 Ga0105251_100012427 380
34 3300009036 Ga0105244_10002160 Ga0105244_1000216011 380
35 3300025728 Ga0207655_1000037 Ga0207655_1000037280 380
36 3300025735 Ga0207713_1001872 Ga0207713_10018729 380
37 iso_pu_bacteria 2608642108 2608669382 385
38 iso_pu_bacteria 2711768156 2712470031 385
39 iso_pu_bacteria 2791355275 2793405700 385
40 iso_pu_bacteria 2844528606 2844530833 385
41 iso_pu_bacteria 2852103415 2852104835 385
42 iso_pu_bacteria 2865014394 2865015205 385
43 iso_pu_bacteria 2945951305 2945953045 385
44 iso_pu_bacteria 2506520007 2506578286 386
45 iso_pu_bacteria 2506520008 2506583424 386
46 iso_pu_bacteria 2508501071 2508852295 386
47 iso_pu_bacteria 2547132416 2548651226 386
48 iso_pu_bacteria 2602042047 2603642624 386
49 iso_pu_bacteria 2602042066 2603698335 386
50 iso_pu_bacteria 2602042067 2603703215 386
51 iso_pu_bacteria 2602042109 2603866592 386
52 iso_pu_bacteria 2636415599 2637225535 386
53 iso_pu_bacteria 2667528172 2671103148 386
54 iso_pu_bacteria 2671180115 2671587567 386
55 iso_pu_bacteria 2681812866 2681997701 386
56 iso_pu_bacteria 2681812869 2682006772 386
57 iso_pu_bacteria 2687453601 2689444837 386
58 iso_pu_bacteria 2751185917 2753855778 386
59 iso_pu_bacteria 2765235842 2765588775 386
60 iso_pu_bacteria 2772190666 2772438868 386
61 iso_pu_bacteria 2775506706 2775538780 386
62 iso_pu_bacteria 2775507074 2777022891 386
63 iso_pu_bacteria 2806310673 2807179535 386
64 iso_pu_bacteria 2821118458 2821119585 386
65 iso_pu_bacteria 2823373977 2823374566 386
66 iso_pu_bacteria 2844425489 2844427332 386
67 iso_pu_bacteria 2846540461 2846541246 386
68 iso_pu_bacteria 2847085930 2847087742 386
69 iso_pu_bacteria 2869551831 2869554244 386
70 iso_pu_bacteria 2884086401 2884088953 386
71 iso_pu_bacteria 2888366609 2888368890 386
72 iso_pu_bacteria 2888373701 2888378086 386
73 iso_pu_bacteria 2891670763 2891671734 386
74 iso_pu_bacteria 2904504865 2904508606 386
75 iso_pu_bacteria 2904513164 2904513604 386
76 iso_pu_bacteria 2919108558 2919108771 386
77 iso_pu_bacteria 2923634449 2923634652 386
78 iso_pu_bacteria 2927833300 2927834298 386
79 iso_pu_bacteria 2932406140 2932408122 386
80 iso_pu_bacteria 2937539931 2937540362 386
81 iso_pu_bacteria 2937967321 2937967484 386
82 iso_pu_bacteria 2939568625 2939568992 386
83 iso_pu_bacteria 2939573065 2939573720 386
84 iso_pu_bacteria 2939577877 2939578579 386
85 iso_pu_bacteria 2939642701 2939643960 386
86 iso_pu_bacteria 2969079654 2969082531 386
87 iso_pu_bacteria 2974310843 2974312302 386
88 iso_pu_bacteria 2984559226 2984559589 386
89 iso_pu_bacteria 2984595703 2984597676 386
90 iso_pu_bacteria 3000376612 3000378794 386
91 iso_pu_bacteria 640753048 640937801 386
92 iso_pu_bacteria 8004592986 8004595777 386
93 iso_pu_bacteria 8015394850 8015399356 386
94 iso_pu_bacteria 8018221730 8018224745 386
95 iso_pu_bacteria 8018405270 8018408331 386
96 iso_pu_bacteria 8054844752 8054845720 386
97 iso_pu_bacteria 8054849141 8054853086 386
98 iso_pu_bacteria 8055087960 8055090955 386
99 iso_pu_bacteria 8055092621 8055094585 386
100 iso_pu_bacteria 8055097453 8055099961 386
101 iso_pu_bacteria 8055693939 8055696153 386
102 iso_pu_bacteria 8057304971 8057309381 386
103 iso_pu_bacteria 2585427591 2585829641 387
104 iso_pu_bacteria 2585427592 2585832853 387
105 iso_pu_bacteria 2667528173 2671110001 387
106 iso_pu_bacteria 2904474040 2904477167 387
107 iso_pu_bacteria 2908669403 2908672383 387
108 iso_pu_bacteria 2919150387 2919153334 387
109 iso_pu_bacteria 2919543075 2919546239 387
110 iso_pu_bacteria 2927143783 2927143960 387
111 iso_pu_bacteria 2939602548 2939603403 387
112 3300048925 Ga0496122_0101817 Ga0496122_0101817_188_1366 388
113 iso_pu_bacteria 2511231025 2511382790 388
114 iso_pu_bacteria 2511231035 2511437671 388
115 iso_pu_bacteria 2876601092 2876604332 388
116 iso_pu_bacteria 2935625433 2935626844 388
117 iso_pu_bacteria 2939617950 2939619413 388
118 iso_pu_bacteria 2974435778 2974438291 388
119 iso_pu_bacteria 8016733728 8016736016 388
120 iso_pu_bacteria 8019499862 8019500585 388
121 iso_pu_bacteria 8019504834 8019506297 388
122 3300002737 JGI25162J39368_1000009 JGI25162J39368_1000009271 389
123 3300002771 JGI25163J39215_1000112 JGI25163J39215_10001121 389
124 3300002772 JGI25164J39214_1000002 JGI25164J39214_100000274 389
125 3300003751 Ga0055538_1000015 Ga0055538_1000015195 389
126 3300003752 Ga0055539_1000009 Ga0055539_1000009286 389
127 3300003756 Ga0055533_1000012 Ga0055533_100001274 389
128 3300003759 Ga0055525_1000014 Ga0055525_1000014286 389
129 3300003841 Ga0055541_1000006 Ga0055541_100000674 389
130 3300003856 Ga0058692_1005219 Ga0058692_10052194 389
131 3300003856 Ga0058692_1005220 Ga0058692_10052201 389
132 3300005289 Ga0065704_10000115 Ga0065704_1000011511 389
133 3300006051 Ga0075364_10098235 Ga0075364_100982351 389
134 3300009011 Ga0105251_10004870 Ga0105251_100048705 389
135 3300009011 Ga0105251_10011006 Ga0105251_100110064 389
136 3300009036 Ga0105244_10006949 Ga0105244_100069493 389
137 3300009036 Ga0105244_10029148 Ga0105244_100291482 389
138 3300009092 Ga0105250_10018996 Ga0105250_100189962 389
139 3300011119 Ga0105246_10021366 Ga0105246_100213663 389
140 3300011119 Ga0105246_10041146 Ga0105246_100411462 389
141 3300013100 Ga0157373_10000405 Ga0157373_100004053 389
142 3300013100 Ga0157373_10015376 Ga0157373_100153764 389
143 3300013102 Ga0157371_10002962 Ga0157371_100029623 389
144 3300013102 Ga0157371_10010131 Ga0157371_100101314 389
145 3300013105 Ga0157369_10020840 Ga0157369_100208404 389
146 3300013307 Ga0157372_10076707 Ga0157372_100767073 389
147 3300015261 Ga0182006_1000047 Ga0182006_100004741 389
148 3300015261 Ga0182006_1024408 Ga0182006_10244082 389
149 3300025207 Ga0209760_100120 Ga0209760_10012020 389
150 3300025224 Ga0209784_100001 Ga0209784_1000011961 389
151 3300025225 Ga0209566_100001 Ga0209566_1000011961 389
152 3300025226 Ga0209674_100002 Ga0209674_1000021961 389
153 3300025230 Ga0209563_100002 Ga0209563_100002496 389
154 3300025231 Ga0207427_100020 Ga0207427_100020280 389
155 3300025233 Ga0209437_100001 Ga0209437_100001496 389
156 3300025233 Ga0209437_100073 Ga0209437_100073285 389
157 3300025253 Ga0209677_100002 Ga0209677_100002496 389
158 3300025258 Ga0209129_1000004 Ga0209129_1000004120 389
159 3300025261 Ga0209233_1000610 Ga0209233_100061021 389
160 3300025711 Ga0207696_1000042 Ga0207696_10000422 389
161 3300025711 Ga0207696_1000398 Ga0207696_100039831 389
162 3300025711 Ga0207696_1013996 Ga0207696_10139962 389
163 3300025728 Ga0207655_1003246 Ga0207655_100324610 389
164 3300025728 Ga0207655_1005519 Ga0207655_10055194 389
165 3300025735 Ga0207713_1000001 Ga0207713_10000011022 389
166 3300025735 Ga0207713_1009037 Ga0207713_10090372 389
167 3300027312 Ga0209371_1000041 Ga0209371_1000041252 389
168 3300027312 Ga0209371_1002237 Ga0209371_10022374 389
169 3300027312 Ga0209371_1004804 Ga0209371_10048045 389
170 3300030500 Ga0268256_1000003 Ga0268256_10000031076 389
171 3300030500 Ga0268256_1011926 Ga0268256_10119262 389
172 3300030500 Ga0268256_1011927 Ga0268256_10119272 389
173 3300030500 Ga0268256_1028824 Ga0268256_10288241 389
174 3300041405 Ga0439438_010039 Ga0439438_010039_936_2105 389
175 3300041407 Ga0439447_003034 Ga0439447_003034_4418_5620 389
176 3300041411 Ga0439466_0000009 Ga0439466_0000009_220017_221219 389
177 3300042006 Ga0439432_013185 Ga0439432_013185_215_1417 389
178 3300042010 Ga0439452_000002 Ga0439452_000002_1231911_1233080 389
179 3300042010 Ga0439452_000028 Ga0439452_000028_153484_154668 389
180 3300042146 Ga0450907_000597 Ga0450907_000597_551_1753 389
181 3300046458 Ga0495591_000013 Ga0495591_000013_100028_101206 389
182 3300046492 Ga0495585_0007998 Ga0495585_0007998_2249_3451 389
183 3300046500 Ga0495596_0014544 Ga0495596_0014544_1242_2414 389
184 3300046530 Ga0495654_0000041 Ga0495654_0000041_104151_105329 389
185 3300046648 Ga0495611_0057081 Ga0495611_0057081_141_1310 389
186 3300046810 Ga0495660_0034009 Ga0495660_0034009_130_1332 389
187 3300047320 Ga0495672_0000043 Ga0495672_0000043_12115_13317 389
188 3300047446 Ga0495679_001854 Ga0495679_001854_7412_8614 389
189 3300048903 Ga0496100_0074374 Ga0496100_0074374_163_1341 389
190 3300048904 Ga0496101_0000055 Ga0496101_0000055_59548_60726 389
191 3300048905 Ga0496102_0005316 Ga0496102_0005316_3959_5131 389
192 3300048906 Ga0496103_0150705 Ga0496103_0150705_201_1403 389
193 3300048908 Ga0496105_0007743 Ga0496105_0007743_6369_7541 389
194 3300048920 Ga0496117_0000022 Ga0496117_0000022_416608_417780 389
195 3300048920 Ga0496117_0000453 Ga0496117_0000453_13649_14851 389
196 3300048920 Ga0496117_0002666 Ga0496117_0002666_5322_6506 389
197 3300048920 Ga0496117_0032466 Ga0496117_0032466_257_1441 389
198 3300048921 Ga0496118_0000007 Ga0496118_0000007_158618_159790 389
199 3300048921 Ga0496118_0000085 Ga0496118_0000085_90392_91594 389
200 3300048921 Ga0496118_0004321 Ga0496118_0004321_7163_8347 389
201 3300048922 Ga0496119_0000001 Ga0496119_0000001_738573_739757 389
202 3300048922 Ga0496119_0002980 Ga0496119_0002980_5429_6601 389
203 3300048923 Ga0496120_0000952 Ga0496120_0000952_6840_8018 389
204 3300048923 Ga0496120_0001569 Ga0496120_0001569_1389_2591 389
205 3300048923 Ga0496120_0019382 Ga0496120_0019382_1456_2640 389
206 3300048924 Ga0496121_0002456 Ga0496121_0002456_23984_25186 389
207 3300048925 Ga0496122_0001733 Ga0496122_0001733_16027_17199 389
208 3300048925 Ga0496122_0013882 Ga0496122_0013882_5331_6509 389
209 3300048925 Ga0496122_0036870 Ga0496122_0036870_2531_3715 389
210 3300048926 Ga0496123_0001180 Ga0496123_0001180_21398_22570 389
211 3300048926 Ga0496123_0002658 Ga0496123_0002658_15101_16285 389
212 3300048926 Ga0496123_0004613 Ga0496123_0004613_12039_13217 389
213 3300048926 Ga0496123_0082611 Ga0496123_0082611_616_1818 389
214 3300048927 Ga0496124_0000199 Ga0496124_0000199_114686_115870 389
215 3300048927 Ga0496124_0002919 Ga0496124_0002919_15975_17177 389
216 3300048927 Ga0496124_0011009 Ga0496124_0011009_3493_4671 389
217 3300048927 Ga0496124_0011522 Ga0496124_0011522_4121_5293 389
218 3300048927 Ga0496124_0012744 Ga0496124_0012744_5395_6573 389
219 3300048928 Ga0496125_0007926 Ga0496125_0007926_5662_6846 389
220 3300048928 Ga0496125_0012428 Ga0496125_0012428_1001_2173 389
221 3300048929 Ga0496126_0042012 Ga0496126_0042012_253_1431 389
222 3300048929 Ga0496126_0072657 Ga0496126_0072657_1390_2574 389
223 3300048929 Ga0496126_0288093 Ga0496126_0288093_136_1314 389
224 3300050491 nmdc:mga00v17_14820_c2 nmdc:mga00v17_14820_c2_1140_2312 389
225 2162886007 SwRhRL2b_contig_2730796 SwRhRL2b_0857.00004140 390
226 3300003856 Ga0058692_1001389 Ga0058692_10013895 390
227 3300003856 Ga0058692_1007258 Ga0058692_10072581 390
228 3300003856 Ga0058692_1007497 Ga0058692_10074971 390
229 3300005289 Ga0065704_10000297 Ga0065704_1000029720 390
230 3300005289 Ga0065704_10000854 Ga0065704_1000085410 390
231 3300005548 Ga0070665_100003098 Ga0070665_10000309813 390
232 3300005577 Ga0068857_100000773 Ga0068857_10000077326 390
233 3300006051 Ga0075364_10005738 Ga0075364_100057383 390
234 3300006051 Ga0075364_10049223 Ga0075364_100492232 390
235 3300006946 Ga0079104_1000083 Ga0079104_100008364 390
236 3300006946 Ga0079104_1000218 Ga0079104_100021834 390
237 3300006946 Ga0079104_1000263 Ga0079104_100026325 390
238 3300006946 Ga0079104_1000292 Ga0079104_100029241 390
239 3300006946 Ga0079104_1000716 Ga0079104_100071614 390
240 3300006946 Ga0079104_1000733 Ga0079104_100073313 390
241 3300006946 Ga0079104_1001695 Ga0079104_10016952 390
242 3300006946 Ga0079104_1002113 Ga0079104_100211312 390
243 3300006946 Ga0079104_1002449 Ga0079104_10024493 390
244 3300009011 Ga0105251_10000189 Ga0105251_1000018962 390
245 3300009011 Ga0105251_10006273 Ga0105251_100062732 390
246 3300009011 Ga0105251_10012464 Ga0105251_100124642 390
247 3300009011 Ga0105251_10016137 Ga0105251_100161373 390
248 3300009036 Ga0105244_10000015 Ga0105244_10000015154 390
249 3300009036 Ga0105244_10002576 Ga0105244_100025765 390
250 3300009036 Ga0105244_10003001 Ga0105244_100030016 390
251 3300009036 Ga0105244_10003258 Ga0105244_100032586 390
252 3300009036 Ga0105244_10075016 Ga0105244_100750162 390
253 3300009036 Ga0105244_10077551 Ga0105244_100775512 390
254 3300009092 Ga0105250_10000002 Ga0105250_1000000224 390
255 3300009092 Ga0105250_10000072 Ga0105250_1000007216 390
256 3300009092 Ga0105250_10003290 Ga0105250_100032903 390
257 3300009092 Ga0105250_10006318 Ga0105250_100063184 390
258 3300009148 Ga0105243_10060358 Ga0105243_100603582 390
259 3300013102 Ga0157371_10000008 Ga0157371_10000008189 390
260 3300013102 Ga0157371_10027004 Ga0157371_100270042 390
261 3300013104 Ga0157370_10002375 Ga0157370_1000237517 390
262 3300013104 Ga0157370_10003134 Ga0157370_1000313415 390
263 3300015679 Ga0183366_1001 Ga0183366_10011159 390
264 3300015680 Ga0183370_1001 Ga0183370_10011159 390
265 3300015685 Ga0183369_1001 Ga0183369_10011159 390
266 3300015687 Ga0183368_1001 Ga0183368_10011159 390
267 3300025711 Ga0207696_1000005 Ga0207696_1000005563 390
268 3300025711 Ga0207696_1000292 Ga0207696_100029226 390
269 3300025711 Ga0207696_1001059 Ga0207696_10010599 390
270 3300025711 Ga0207696_1002113 Ga0207696_100211310 390
271 3300025711 Ga0207696_1003125 Ga0207696_10031252 390
272 3300025728 Ga0207655_1000001 Ga0207655_10000011219 390
273 3300025728 Ga0207655_1000009 Ga0207655_1000009406 390
274 3300025728 Ga0207655_1000061 Ga0207655_1000061155 390
275 3300025728 Ga0207655_1000063 Ga0207655_100006323 390
276 3300025728 Ga0207655_1000373 Ga0207655_10003733 390
277 3300025728 Ga0207655_1001029 Ga0207655_100102914 390
278 3300025735 Ga0207713_1000002 Ga0207713_1000002805 390
279 3300025735 Ga0207713_1000003 Ga0207713_1000003179 390
280 3300025735 Ga0207713_1000029 Ga0207713_100002942 390
281 3300025735 Ga0207713_1001124 Ga0207713_10011245 390
282 3300025735 Ga0207713_1014697 Ga0207713_10146971 390
283 3300025735 Ga0207713_1026145 Ga0207713_10261452 390
284 3300025735 Ga0207713_1040056 Ga0207713_10400562 390
285 3300025919 Ga0207657_10216616 Ga0207657_102166162 390
286 3300025935 Ga0207709_10037239 Ga0207709_100372391 390
287 3300025935 Ga0207709_10097551 Ga0207709_100975512 390
288 3300026116 Ga0207674_10003836 Ga0207674_100038362 390
289 3300027111 Ga0209281_1000001 Ga0209281_1000001786 390
290 3300027111 Ga0209281_1000006 Ga0209281_10000061063 390
291 3300027111 Ga0209281_1000130 Ga0209281_100013063 390
292 3300027111 Ga0209281_1000181 Ga0209281_1000181104 390
293 3300027111 Ga0209281_1000287 Ga0209281_100028722 390
294 3300027111 Ga0209281_1000414 Ga0209281_100041419 390
295 3300027111 Ga0209281_1000494 Ga0209281_100049435 390
296 3300027111 Ga0209281_1000638 Ga0209281_100063817 390
297 3300027111 Ga0209281_1001424 Ga0209281_100142411 390
298 3300027111 Ga0209281_1001749 Ga0209281_10017493 390
299 3300027312 Ga0209371_1000001 Ga0209371_10000011083 390
300 3300027312 Ga0209371_1000005 Ga0209371_100000556 390
301 3300027312 Ga0209371_1000212 Ga0209371_100021259 390
302 3300027312 Ga0209371_1001290 Ga0209371_10012902 390
303 3300027312 Ga0209371_1011563 Ga0209371_10115632 390
304 3300028379 Ga0268266_10001737 Ga0268266_1000173713 390
305 3300030500 Ga0268256_1000001 Ga0268256_10000011558 390
306 3300030500 Ga0268256_1000006 Ga0268256_10000061000 390
307 3300030500 Ga0268256_1001101 Ga0268256_100110117 390
308 3300030500 Ga0268256_1002885 Ga0268256_10028853 390
309 3300030500 Ga0268256_1012557 Ga0268256_10125572 390
310 3300041405 Ga0439438_001385 Ga0439438_001385_1352_2524 390
311 3300041512 Ga0451853_3093388 Ga0451853_3093388_2838_4010 390
312 3300042006 Ga0439432_019692 Ga0439432_019692_77_1249 390
313 3300042006 Ga0439432_040182 Ga0439432_040182_193_1377 390
314 3300042010 Ga0439452_000246 Ga0439452_000246_14224_15396 390
315 3300042010 Ga0439452_000493 Ga0439452_000493_6568_7740 390
316 3300044669 Ga0466981_0000002 Ga0466981_0000002_186381_187553 390
317 3300046458 Ga0495591_000100 Ga0495591_000100_75970_77142 390
318 3300046458 Ga0495591_000763 Ga0495591_000763_7183_8355 390
319 3300046458 Ga0495591_001170 Ga0495591_001170_7310_8494 390
320 3300046460 Ga0495638_0001608 Ga0495638_0001608_13046_14230 390
321 3300046471 Ga0495650_0000005 Ga0495650_0000005_648587_649759 390
322 3300046471 Ga0495650_0000043 Ga0495650_0000043_174557_175789 390
323 3300046471 Ga0495650_0000204 Ga0495650_0000204_104445_105689 390
324 3300046471 Ga0495650_0016261 Ga0495650_0016261_535_1707 390
325 3300046491 Ga0495584_0036764 Ga0495584_0036764_311_1483 390
326 3300046507 Ga0495606_0002305 Ga0495606_0002305_3610_4782 390
327 3300046515 Ga0495620_0004508 Ga0495620_0004508_6163_7347 390
328 3300046518 Ga0495631_0045391 Ga0495631_0045391_390_1562 390
329 3300046524 Ga0495648_0014312 Ga0495648_0014312_3264_4436 390
330 3300046530 Ga0495654_0000167 Ga0495654_0000167_55075_56247 390
331 3300046530 Ga0495654_0004539 Ga0495654_0004539_3167_4348 390
332 3300046530 Ga0495654_0004607 Ga0495654_0004607_5406_6578 390
333 3300046530 Ga0495654_0025098 Ga0495654_0025098_724_1896 390
334 3300046542 Ga0495597_0002127 Ga0495597_0002127_6826_7998 390
335 3300046660 Ga0495625_0004823 Ga0495625_0004823_470_1642 390
336 3300046692 Ga0495671_0008104 Ga0495671_0008104_2907_4079 390
337 3300046694 Ga0495649_0001040 Ga0495649_0001040_9590_10774 390
338 3300046694 Ga0495649_0003204 Ga0495649_0003204_5743_6927 390
339 3300046794 Ga0495589_0060498 Ga0495589_0060498_122_1294 390
340 3300046810 Ga0495660_0000012 Ga0495660_0000012_244426_245658 390
341 3300046810 Ga0495660_0000048 Ga0495660_0000048_10392_11564 390
342 3300047320 Ga0495672_0000002 Ga0495672_0000002_599139_600311 390
343 3300047320 Ga0495672_0000020 Ga0495672_0000020_380177_381349 390
344 3300047323 Ga0495683_0013394 Ga0495683_0013394_209_1381 390
345 3300047446 Ga0495679_000018 Ga0495679_000018_164209_165381 390
346 3300047446 Ga0495679_007690 Ga0495679_007690_91_1263 390
347 3300047446 Ga0495679_019407 Ga0495679_019407_346_1530 390
348 3300047469 Ga0495673_0000070 Ga0495673_0000070_123698_124870 390
349 3300047469 Ga0495673_0000167 Ga0495673_0000167_102995_104167 390
350 3300048903 Ga0496100_0143490 Ga0496100_0143490_64_1236 390
351 3300048907 Ga0496104_0000091 Ga0496104_0000091_84119_85291 390
352 3300048907 Ga0496104_0000233 Ga0496104_0000233_8780_10012 390
353 3300048907 Ga0496104_0007416 Ga0496104_0007416_377_1549 390
354 3300048907 Ga0496104_0308087 Ga0496104_0308087_257_1429 390
355 3300048908 Ga0496105_0007901 Ga0496105_0007901_6195_7367 390
356 3300048908 Ga0496105_0038424 Ga0496105_0038424_523_1695 390
357 3300048919 Ga0496116_0000066 Ga0496116_0000066_100791_102023 390
358 3300048919 Ga0496116_0000822 Ga0496116_0000822_21963_23135 390
359 3300048919 Ga0496116_0017930 Ga0496116_0017930_2445_3617 390
360 3300048919 Ga0496116_0031503 Ga0496116_0031503_2032_3204 390
361 3300048919 Ga0496116_0031679 Ga0496116_0031679_687_1859 390
362 3300048920 Ga0496117_0000020 Ga0496117_0000020_421911_423083 390
363 3300048920 Ga0496117_0001256 Ga0496117_0001256_3833_5005 390
364 3300048920 Ga0496117_0003591 Ga0496117_0003591_2622_3854 390
365 3300048920 Ga0496117_0005868 Ga0496117_0005868_449_1621 390
366 3300048920 Ga0496117_0009820 Ga0496117_0009820_694_1881 390
367 3300048920 Ga0496117_0077455 Ga0496117_0077455_899_2071 390
368 3300048920 Ga0496117_0139365 Ga0496117_0139365_159_1331 390
369 3300048920 Ga0496117_0149664 Ga0496117_0149664_81_1253 390
370 3300048920 Ga0496117_0151578 Ga0496117_0151578_41_1213 390
371 3300048921 Ga0496118_0000015 Ga0496118_0000015_437195_438367 390
372 3300048921 Ga0496118_0004655 Ga0496118_0004655_13931_15118 390
373 3300048921 Ga0496118_0004751 Ga0496118_0004751_599_1771 390
374 3300048921 Ga0496118_0005928 Ga0496118_0005928_3174_4406 390
375 3300048921 Ga0496118_0038875 Ga0496118_0038875_2504_3676 390
376 3300048921 Ga0496118_0103092 Ga0496118_0103092_116_1288 390
377 3300048921 Ga0496118_0109227 Ga0496118_0109227_124_1296 390
378 3300048921 Ga0496118_0124106 Ga0496118_0124106_434_1606 390
379 3300048922 Ga0496119_0000570 Ga0496119_0000570_23944_25116 390
380 3300048922 Ga0496119_0004522 Ga0496119_0004522_1845_3026 390
381 3300048922 Ga0496119_0004672 Ga0496119_0004672_2030_3202 390
382 3300048922 Ga0496119_0008290 Ga0496119_0008290_509_1690 390
383 3300048922 Ga0496119_0008708 Ga0496119_0008708_5758_6990 390
384 3300048922 Ga0496119_0067806 Ga0496119_0067806_781_1974 390
385 3300048922 Ga0496119_0115644 Ga0496119_0115644_221_1393 390
386 3300048923 Ga0496120_0001357 Ga0496120_0001357_22941_24113 390
387 3300048923 Ga0496120_0003772 Ga0496120_0003772_5798_6970 390
388 3300048923 Ga0496120_0004407 Ga0496120_0004407_9025_10197 390
389 3300048923 Ga0496120_0008528 Ga0496120_0008528_1047_2279 390
390 3300048923 Ga0496120_0009525 Ga0496120_0009525_2544_3716 390
391 3300048923 Ga0496120_0024080 Ga0496120_0024080_1227_2399 390
392 3300048923 Ga0496120_0024401 Ga0496120_0024401_554_1735 390
393 3300048923 Ga0496120_0025123 Ga0496120_0025123_2016_3197 390
394 3300048923 Ga0496120_0060577 Ga0496120_0060577_782_1975 390
395 3300048923 Ga0496120_0064680 Ga0496120_0064680_402_1574 390
396 3300048923 Ga0496120_0103955 Ga0496120_0103955_265_1437 390
397 3300048923 Ga0496120_0129757 Ga0496120_0129757_80_1252 390
398 3300048924 Ga0496121_0002791 Ga0496121_0002791_14259_15431 390
399 3300048924 Ga0496121_0006576 Ga0496121_0006576_10872_12044 390
400 3300048924 Ga0496121_0007110 Ga0496121_0007110_10768_11940 390
401 3300048924 Ga0496121_0009657 Ga0496121_0009657_3710_4882 390
402 3300048924 Ga0496121_0011073 Ga0496121_0011073_2287_3459 390
403 3300048924 Ga0496121_0014137 Ga0496121_0014137_7214_8386 390
404 3300048924 Ga0496121_0017575 Ga0496121_0017575_3833_5005 390
405 3300048924 Ga0496121_0116594 Ga0496121_0116594_109_1281 390
406 3300048925 Ga0496122_0000005 Ga0496122_0000005_114916_116088 390
407 3300048925 Ga0496122_0000110 Ga0496122_0000110_98201_99433 390
408 3300048925 Ga0496122_0003163 Ga0496122_0003163_11590_12762 390
409 3300048925 Ga0496122_0008753 Ga0496122_0008753_2941_4113 390
410 3300048925 Ga0496122_0008934 Ga0496122_0008934_1712_2884 390
411 3300048925 Ga0496122_0053379 Ga0496122_0053379_1648_2820 390
412 3300048926 Ga0496123_0000008 Ga0496123_0000008_514541_515713 390
413 3300048926 Ga0496123_0000081 Ga0496123_0000081_90710_91942 390
414 3300048926 Ga0496123_0003165 Ga0496123_0003165_6545_7717 390
415 3300048926 Ga0496123_0006929 Ga0496123_0006929_2941_4113 390
416 3300048926 Ga0496123_0011714 Ga0496123_0011714_4681_5853 390
417 3300048926 Ga0496123_0019758 Ga0496123_0019758_1644_2816 390
418 3300048926 Ga0496123_0115590 Ga0496123_0115590_123_1295 390
419 3300048927 Ga0496124_0000066 Ga0496124_0000066_163087_164319 390
420 3300048927 Ga0496124_0000196 Ga0496124_0000196_676_1857 390
421 3300048927 Ga0496124_0000425 Ga0496124_0000425_62296_63480 390
422 3300048927 Ga0496124_0001064 Ga0496124_0001064_30835_32007 390
423 3300048927 Ga0496124_0012856 Ga0496124_0012856_5565_6737 390
424 3300048927 Ga0496124_0028916 Ga0496124_0028916_2933_4105 390
425 3300048927 Ga0496124_0060139 Ga0496124_0060139_1646_2818 390
426 3300048927 Ga0496124_0120856 Ga0496124_0120856_776_1969 390
427 3300048927 Ga0496124_0151839 Ga0496124_0151839_51_1223 390
428 3300048927 Ga0496124_0249347 Ga0496124_0249347_24_1196 390
429 3300048928 Ga0496125_0000033 Ga0496125_0000033_168394_169626 390
430 3300048928 Ga0496125_0002253 Ga0496125_0002253_13946_15118 390
431 3300048928 Ga0496125_0006899 Ga0496125_0006899_8569_9741 390
432 3300048928 Ga0496125_0008967 Ga0496125_0008967_2203_3375 390
433 3300048928 Ga0496125_0017697 Ga0496125_0017697_3407_4579 390
434 3300048928 Ga0496125_0052763 Ga0496125_0052763_1198_2370 390
435 3300048928 Ga0496125_0057994 Ga0496125_0057994_357_1529 390
436 3300048928 Ga0496125_0063959 Ga0496125_0063959_773_1945 390
437 3300048929 Ga0496126_0001084 Ga0496126_0001084_31583_32755 390
438 3300048929 Ga0496126_0001269 Ga0496126_0001269_33482_34714 390
439 3300048929 Ga0496126_0024781 Ga0496126_0024781_2116_3288 390
440 3300048929 Ga0496126_0041444 Ga0496126_0041444_546_1718 390
441 3300048929 Ga0496126_0043126 Ga0496126_0043126_683_1855 390
442 3300049459 Ga0495678_000354 Ga0495678_000354_27567_28739 390
443 3300049460 Ga0495682_0000001 Ga0495682_0000001_1234156_1235328 390
444 3300053126 Ga0500621_000003 Ga0500621_000003_202372_203544 390
445 iso_pu_bacteria 2554235234 2555257574 390
446 iso_pu_bacteria 2971820967 2971823341 390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

52

406

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d2f-assembly1.cif.gz_A x-ray structure of maly from escherichia coli: a pyridoxal-5'-phosphate-dependent enzyme acting as a modulator in mal gene expression 0.9888 30 390
8bob-assembly1.cif.gz_B structural basis for negative regulation of the maltose system 0.9861 1 390
1d2f-assembly1.cif.gz_A x-ray structure of maly from escherichia coli: a pyridoxal-5'-phosphate-dependent enzyme acting as a modulator in mal gene expression 0.9861 30 390
6qp3-assembly2.cif.gz_C crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) 0.9629 2 385
6qp3-assembly2.cif.gz_C crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) 0.9556 2 385
ID Description Score Start End Superfamily
af_P23256_285_389_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 1.005 286 388 3.90.1150.10
1d2fA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9967 285 390 3.90.1150.10
1d2fB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9872 42 283 3.40.640.10
1d2fB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9792 42 283 3.40.640.10
af_P23256_285_389_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9759 286 388 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A242HBR9-F1-model_v4 deleted 0.972 1 389
AF-A0A6B1XCA5-F1-model_v4 cysteine-S-conjugate beta-lyase (EC 4.4.1.13) 0.9689 150 387 GO:0008483
GO:0009058
GO:0016829
GO:0030170
AF-A0A165S0L9-F1-model_v4 cysteine-S-conjugate beta-lyase (EC 4.4.1.13) 0.9678 1 266 GO:0009058
GO:0016829
GO:0030170
AF-A0A242HBR9-F1-model_v4 deleted 0.9671 1 389
AF-A0A1F9L863-F1-model_v4 cysteine-S-conjugate beta-lyase (EC 4.4.1.13) 0.9636 3 388 GO:0009058
GO:0016829
GO:0030170

Feature Viewer

pLDDT pTM Quality
94.06 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map