F445744

General Info

Members Datasets Scaffolds Average Seq Length
446 229 892 370

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10045242|Ga0207646_100452422
Length 416
Sequence VSAPPSAAPSASAVQQSSPGLAAAPAKPTRPLSGITSDALVRHLYVHLPFCAHRCGYCDFVTVVGRRGQHTAYVDGLLTELELEGELLAPELETIFLGGGTPTFTEPHELGRLLTALPVAAEVTVEANPETVTPALAALLRSSGVDRVSLGAQTFQPELLGVLDRVAGPDDVRRSFYHLRDAGFDNISLDLIYGIPRQRPSDLDADIEEALALRPEHLSCYELEAKPGTRFTYAYGEELRRQAEAMEGYFECVVETLARAGYRWYETANFCRAAEADAGRRDLRSRHNLAYWRGRDYVGLGIGAVSTVRGQRWRTTPRLGLYLAALGEGRRPPRELEPLPDSVQREERVMLGLRLDEPLPVAAVAASLDVDALARLERLGLAEWVPLGEPQHARGGLTLTPRGRLLGDAVTADLLA

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
147 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 15.25
Rhizosphere 84.08
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10045242 3300025922 Bacteria 3951
2 Ga0070683_100160670 3300005329 Bacteria 2132
3 Ga0070690_100024674 3300005330 Bacteria 3698
4 Ga0070670_100029986 3300005331 Bacteria 4684
5 Ga0070670_100032563 3300005331 Bacteria 4490
6 Ga0070680_100106185 3300005336 Bacteria 2335
7 Ga0068868_100095945 3300005338 Bacteria 2394
8 Ga0070660_100013246 3300005339 Bacteria 5910
9 Ga0070660_100034288 3300005339 Bacteria 3833
10 Ga0070689_100003774 3300005340 Bacteria 10146
11 Ga0070689_100004144 3300005340 Bacteria 9770
12 Ga0070687_100060851 3300005343 Bacteria 1994
13 Ga0070661_100034839 3300005344 Bacteria 3653
14 Ga0070692_10002103 3300005345 Bacteria 7607
15 Ga0070668_100017557 3300005347 Bacteria 5366
16 Ga0070675_100221057 3300005354 Bacteria 1649
17 Ga0070671_100234953 3300005355 Bacteria 1556
18 Ga0070674_100008326 3300005356 Bacteria 6170
19 Ga0070674_100076311 3300005356 Bacteria 2382
20 Ga0070673_100059116 3300005364 Bacteria 3034
21 Ga0070673_100250104 3300005364 Bacteria 1545
22 Ga0070688_100006538 3300005365 Bacteria 6233
23 Ga0070703_10004869 3300005406 Bacteria 3752
24 Ga0070709_10009435 3300005434 Bacteria 5385
25 Ga0070713_100110758 3300005436 Bacteria 2393
26 Ga0070710_10033036 3300005437 Bacteria 2807
27 Ga0070701_10000527 3300005438 Bacteria 13195
28 Ga0070701_10137493 3300005438 Bacteria 1394
29 Ga0070711_100013020 3300005439 Bacteria 5215
30 Ga0070711_100252484 3300005439 Bacteria 1384
31 Ga0070705_100005960 3300005440 Bacteria 5959
32 Ga0070700_100003804 3300005441 Bacteria 7818
33 Ga0070700_100006112 3300005441 Bacteria 6415
34 Ga0070708_100015571 3300005445 Bacteria 6285
35 Ga0070663_100010157 3300005455 Bacteria 5859
36 Ga0070678_100001233 3300005456 Bacteria 13523
37 Ga0070681_10013325 3300005458 Bacteria 8171
38 Ga0068867_100009093 3300005459 Bacteria 7010
39 Ga0070685_10000758 3300005466 Bacteria 17549
40 Ga0070685_10002617 3300005466 Bacteria 9220
41 Ga0070706_100024817 3300005467 Bacteria 5519
42 Ga0070707_100000309 3300005468 Bacteria 47965
43 Ga0070707_100009898 3300005468 Bacteria 8875
44 Ga0070698_100218188 3300005471 Bacteria 1841
45 Ga0070699_100074172 3300005518 Bacteria 2960
46 Ga0070699_100090043 3300005518 Bacteria 2681
47 Ga0070679_100027415 3300005530 Bacteria 5606
48 Ga0070679_100040776 3300005530 Bacteria 4619
49 Ga0070679_100106836 3300005530 Bacteria 2784
50 Ga0070679_100250866 3300005530 Unclassified 1726
51 Ga0070684_100072987 3300005535 Bacteria 3023
52 Ga0070672_100013244 3300005543 Bacteria 5817
53 Ga0070672_100056776 3300005543 Bacteria 3071
54 Ga0070696_100030156 3300005546 Bacteria 3712
55 Ga0070696_100043989 3300005546 Bacteria 3091
56 Ga0070693_100074596 3300005547 Bacteria 2007
57 Ga0070665_100003372 3300005548 Bacteria 17091
58 Ga0070665_100015648 3300005548 Bacteria 7620
59 Ga0070704_100002845 3300005549 Bacteria 9809
60 Ga0070664_100056995 3300005564 Bacteria 3320
61 Ga0070664_100100062 3300005564 Bacteria 2520
62 Ga0070664_100395673 3300005564 Bacteria 1263
63 Ga0068857_100001704 3300005577 Bacteria 17673
64 Ga0068854_100270504 3300005578 Bacteria 1364
65 Ga0068856_100004194 3300005614 Bacteria 14397
66 Ga0068856_100007297 3300005614 Bacteria 10787
67 Ga0068856_100174543 3300005614 Bacteria 2162
68 Ga0070702_100002756 3300005615 Bacteria 7695
69 Ga0070702_100008371 3300005615 Bacteria 5007
70 Ga0068859_100046718 3300005617 Bacteria 4348
71 Ga0068866_10005551 3300005718 Bacteria 5212
72 Ga0068866_10170955 3300005718 Bacteria 1276
73 Ga0068861_100099782 3300005719 Bacteria 2307
74 Ga0068861_100184821 3300005719 Bacteria 1738
75 Ga0068870_10017516 3300005840 Bacteria 3442
76 Ga0068870_10018520 3300005840 Bacteria 3364
77 Ga0068858_100262975 3300005842 Unclassified 1640
78 Ga0068860_100026848 3300005843 Bacteria 5548
79 Ga0068862_100081653 3300005844 Bacteria 2804
80 Ga0081455_10045797 3300005937 Bacteria 3802
81 Ga0081538_10000283 3300005981 Bacteria 58086
82 Ga0081538_10000301 3300005981 Bacteria 56945
83 Ga0081538_10000375 3300005981 Bacteria 51029
84 Ga0081538_10000773 3300005981 Bacteria 35006
85 Ga0081538_10002849 3300005981 Bacteria 16537
86 Ga0081538_10011338 3300005981 Bacteria 7228
87 Ga0081539_10001549 3300005985 Bacteria 38322
88 Ga0070717_10129918 3300006028 Bacteria 2165
89 Ga0075365_10027207 3300006038 Bacteria 3636
90 Ga0097621_100223310 3300006237 Bacteria 1642
91 Ga0068871_100011506 3300006358 Bacteria 6490
92 Ga0075431_100171635 3300006847 Bacteria 2228
93 Ga0075433_10022869 3300006852 Bacteria 5253
94 Ga0075433_10024120 3300006852 Bacteria 5129
95 Ga0075434_100006726 3300006871 Bacteria 10564
96 Ga0075434_100081124 3300006871 Bacteria 3241
97 Ga0075434_100106025 3300006871 Bacteria 2820
98 Ga0075434_100252606 3300006871 Bacteria 1782
99 Ga0075429_100003982 3300006880 Bacteria 12638
100 Ga0068865_100000466 3300006881 Bacteria 22602
101 Ga0068865_100022834 3300006881 Bacteria 4087
102 Ga0075436_100004777 3300006914 Bacteria 9305
103 Ga0075436_100021102 3300006914 Bacteria 4469
104 Ga0075436_100025940 3300006914 Bacteria 4035
105 Ga0097620_100046717 3300006931 Bacteria 4348
106 Ga0075435_100010930 3300007076 Bacteria 6653
107 Ga0111539_10001409 3300009094 Bacteria 32013
108 Ga0111539_10096276 3300009094 Bacteria 3477
109 Ga0105245_10004080 3300009098 Bacteria 12965
110 Ga0105245_10085290 3300009098 Bacteria 2895
111 Ga0105245_10609665 3300009098 Bacteria 1119
112 Ga0105247_10065408 3300009101 Bacteria 2262
113 Ga0105247_10133176 3300009101 Bacteria 1622
114 Ga0114129_10004975 3300009147 Bacteria 18726
115 Ga0114129_10006109 3300009147 Bacteria 17079
116 Ga0114129_10011823 3300009147 Bacteria 12416
117 Ga0114129_10047826 3300009147 Bacteria 6010
118 Ga0114129_10049630 3300009147 Bacteria 5896
119 Ga0114129_10281481 3300009147 Bacteria 2222
120 Ga0114129_10712490 3300009147 Bacteria 1289
121 Ga0105243_10002360 3300009148 Bacteria 15801
122 Ga0105243_10036431 3300009148 Bacteria 3819
123 Ga0105243_10134511 3300009148 Bacteria 2102
124 Ga0105248_10057365 3300009177 Bacteria 4371
125 Ga0105248_10179819 3300009177 Bacteria 2383
126 Ga0105237_10049033 3300009545 Bacteria 4246
127 Ga0105249_10004723 3300009553 Bacteria 11762
128 Ga0105239_10010318 3300010375 Bacteria 10462
129 Ga0105239_10106829 3300010375 Bacteria 3101
130 Ga0105239_10286703 3300010375 Bacteria 1854
131 Ga0105246_10168765 3300011119 Bacteria 1674
132 Ga0157370_10020774 3300013104 Bacteria 6552
133 Ga0157374_10003026 3300013296 Bacteria 14087
134 Ga0157374_10102538 3300013296 Bacteria 2744
135 Ga0157378_10371301 3300013297 Bacteria 1402
136 Ga0163162_10003839 3300013306 Bacteria 14411
137 Ga0163162_10286348 3300013306 Bacteria 1779
138 Ga0163162_10299773 3300013306 Bacteria 1739
139 Ga0157375_10007752 3300013308 Bacteria 9395
140 Ga0157375_10318484 3300013308 Bacteria 1720
141 Ga0163163_10017196 3300014325 Bacteria 6739
142 Ga0163163_10119261 3300014325 Bacteria 2671
143 Ga0163163_10161892 3300014325 Bacteria 2283
144 Ga0157377_10003196 3300014745 Bacteria 7387
145 Ga0157376_10031843 3300014969 Bacteria 4228
146 Ga0206353_10104255 3300020082 Bacteria 1832
147 Ga0207653_10003112 3300025885 Bacteria 5257
148 Ga0207642_10000491 3300025899 Bacteria 12140
149 Ga0207710_10030034 3300025900 Bacteria 2369
150 Ga0207688_10008595 3300025901 Bacteria 5558
151 Ga0207643_10007959 3300025908 Bacteria 5688
152 Ga0207684_10032079 3300025910 Bacteria 4468
153 Ga0207684_10161012 3300025910 Bacteria 1933
154 Ga0207707_10011649 3300025912 Bacteria 7653
155 Ga0207707_10014051 3300025912 Bacteria 6979
156 Ga0207693_10000179 3300025915 Bacteria 57434
157 Ga0207693_10000679 3300025915 Bacteria 30553
158 Ga0207693_10001288 3300025915 Bacteria 22292
159 Ga0207663_10042768 3300025916 Bacteria 2770
160 Ga0207663_10158357 3300025916 Bacteria 1596
161 Ga0207663_10159975 3300025916 Bacteria 1589
162 Ga0207660_10027914 3300025917 Bacteria 3857
163 Ga0207657_10040649 3300025919 Bacteria 4118
164 Ga0207657_10042530 3300025919 Bacteria 4008
165 Ga0207657_10081639 3300025919 Bacteria 2715
166 Ga0207652_10004003 3300025921 Bacteria 12033
167 Ga0207652_10019721 3300025921 Bacteria 5548
168 Ga0207652_10094710 3300025921 Unclassified 2630
169 Ga0207646_10001136 3300025922 Bacteria 33979
170 Ga0207646_10159826 3300025922 Bacteria 2033
171 Ga0207650_10003774 3300025925 Bacteria 10362
172 Ga0207650_10087854 3300025925 Bacteria 2369
173 Ga0207687_10002856 3300025927 Bacteria 11728
174 Ga0207664_10028296 3300025929 Bacteria 4258
175 Ga0207644_10037885 3300025931 Bacteria 3394
176 Ga0207644_10079020 3300025931 Bacteria 2426
177 Ga0207706_10141527 3300025933 Bacteria 2116
178 Ga0207686_10002068 3300025934 Bacteria 11060
179 Ga0207686_10075806 3300025934 Bacteria 2178
180 Ga0207709_10023658 3300025935 Bacteria 3498
181 Ga0207670_10018362 3300025936 Bacteria 4250
182 Ga0207704_10000919 3300025938 Bacteria 13022
183 Ga0207704_10157521 3300025938 Bacteria 1611
184 Ga0207665_10003530 3300025939 Bacteria 10440
185 Ga0207691_10004683 3300025940 Bacteria 13248
186 Ga0207691_10017957 3300025940 Bacteria 6701
187 Ga0207689_10035139 3300025942 Bacteria 4163
188 Ga0207661_10060375 3300025944 Bacteria 3059
189 Ga0207661_10248597 3300025944 Bacteria 1580
190 Ga0207679_10246133 3300025945 Bacteria 1517
191 Ga0207667_10124562 3300025949 Bacteria 2655
192 Ga0207712_10004212 3300025961 Bacteria 9076
193 Ga0207640_10106776 3300025981 Bacteria 1976
194 Ga0207677_10187576 3300026023 Bacteria 1633
195 Ga0207678_10007040 3300026067 Bacteria 9987
196 Ga0207708_10000500 3300026075 Bacteria 30176
197 Ga0207708_10011534 3300026075 Bacteria 6584
198 Ga0207702_10007044 3300026078 Bacteria 9621
199 Ga0207702_10128232 3300026078 Bacteria 2280
200 Ga0207702_10163003 3300026078 Bacteria 2037
201 Ga0207641_10156222 3300026088 Bacteria 2070
202 Ga0207648_10004585 3300026089 Bacteria 14167
203 Ga0207648_10100782 3300026089 Bacteria 2530
204 Ga0207674_10002728 3300026116 Bacteria 22028
205 Ga0207674_10007487 3300026116 Bacteria 12727
206 Ga0207675_100032290 3300026118 Bacteria 4876
207 Ga0207683_10001613 3300026121 Bacteria 20249
208 Ga0207683_10034019 3300026121 Bacteria 4429
209 Ga0207683_10060415 3300026121 Bacteria 3332
210 Ga0207698_10060761 3300026142 Bacteria 2940
211 Ga0207428_10050939 3300027907 Bacteria 3310
212 Ga0268264_10084148 3300028381 Bacteria 2727
213 Ga0265318_10001206 3300028577 Bacteria 15720
214 Ga0265338_10047455 3300028800 Bacteria 3921
215 Ga0265338_10085731 3300028800 Bacteria 2624
216 Ga0265338_10098977 3300028800 Bacteria 2383
217 Ga0265332_10012631 3300031238 Bacteria 3744
218 Ga0265328_10000898 3300031239 Bacteria 13766
219 Ga0265325_10037738 3300031241 Bacteria 2552
220 Ga0265325_10037759 3300031241 Bacteria 2551
221 Ga0265314_10087728 3300031711 Bacteria 2033
222 Ga0307416_100103495 3300032002 Bacteria 2486
223 Ga0373932_0001990 3300035112 Bacteria 5388
224 Ga0373961_0016443 3300035241 Bacteria 1906
225 Ga0373937_0152218 3300036401 Bacteria 2167
226 Ga0395899_0017730 3300037312 Bacteria 5422
227 Ga0395899_0056538 3300037312 Bacteria 2899
228 Ga0395899_0122259 3300037312 Bacteria 1863
229 Ga0395900_0004553 3300037418 Bacteria 14658
230 Ga0395900_0005102 3300037418 Bacteria 13789
231 Ga0395900_0008552 3300037418 Bacteria 10524
232 Ga0395900_0055237 3300037418 Bacteria 4089
233 Ga0395900_0063869 3300037418 Bacteria 3784
234 Ga0395900_0093295 3300037418 Bacteria 3092
235 Ga0395900_0098227 3300037418 Bacteria 3008
236 Ga0395900_0132858 3300037418 Bacteria 2550
237 Ga0395900_0168174 3300037418 Bacteria 2233
238 Ga0395898_0005976 3300037466 Bacteria 13071
239 Ga0395898_0010004 3300037466 Bacteria 9930
240 Ga0395898_0011371 3300037466 Bacteria 9245
241 Ga0395898_0013287 3300037466 Bacteria 8479
242 Ga0395898_0033301 3300037466 Bacteria 5143
243 Ga0395898_0036659 3300037466 Bacteria 4869
244 Ga0395898_0058581 3300037466 Bacteria 3749
245 Ga0395898_0067452 3300037466 Bacteria 3463
246 Ga0395898_0149451 3300037466 Bacteria 2236
247 Ga0395905_0008668 3300037471 Bacteria 10018
248 Ga0395905_0017152 3300037471 Bacteria 6878
249 Ga0395905_0031230 3300037471 Bacteria 5015
250 Ga0395905_0034630 3300037471 Bacteria 4743
251 Ga0395905_0098720 3300037471 Bacteria 2742
252 Ga0395905_0149756 3300037471 Bacteria 2195
253 Ga0395905_0157741 3300037471 Bacteria 2134
254 Ga0395905_0168691 3300037471 Bacteria 2056
255 Ga0395901_0001857 3300038443 Bacteria 21846
256 Ga0395901_0003321 3300038443 Bacteria 16211
257 Ga0395901_0008882 3300038443 Bacteria 10174
258 Ga0395901_0018762 3300038443 Bacteria 7066
259 Ga0395901_0022888 3300038443 Bacteria 6406
260 Ga0395901_0068024 3300038443 Bacteria 3710
261 Ga0395901_0068460 3300038443 Bacteria 3697
262 Ga0395901_0231212 3300038443 Bacteria 1930
263 Ga0451793_0070286 3300041452 Bacteria 3076
264 Ga0451835_0271174 3300041492 Bacteria 3748
265 Ga0450918_008713 3300042531 Bacteria 1782
266 Ga0466969_0000895 3300044656 Bacteria 16088
267 Ga0466972_0065634 3300044658 Bacteria 1736
268 Ga0466966_0047412 3300044684 Bacteria 2740
269 Ga0466961_0058724 3300044693 Bacteria 2447
270 Ga0466963_0065003 3300044694 Bacteria 2445
271 Ga0466964_0010837 3300044706 Bacteria 3443
272 Ga0466968_0001650 3300044735 Bacteria 8056
273 Ga0466968_0012966 3300044735 Bacteria 3271
274 Ga0466968_0036227 3300044735 Bacteria 2067
275 Ga0466970_0169782 3300044765 Unclassified 1208
276 Ga0466960_0002175 3300044901 Bacteria 7317
277 Ga0466959_0020394 3300045049 Bacteria 4882
278 Ga0466958_0034866 3300045836 Bacteria 3003
279 Ga0466967_0021774 3300045976 Bacteria 5215
280 Ga0466967_0157071 3300045976 Bacteria 2131
281 Ga0495629_0003253 3300046459 Bacteria 12304
282 Ga0495582_0023271 3300046473 Bacteria 3390
283 Ga0495605_0033143 3300046474 Bacteria 2625
284 Ga0495639_0018993 3300046475 Bacteria 2998
285 Ga0495662_0069634 3300046476 Bacteria 1704
286 Ga0495584_0063246 3300046491 Bacteria 1860
287 Ga0495594_0132644 3300046499 Bacteria 1411
288 Ga0495630_0007883 3300046517 Bacteria 7636
289 Ga0495640_0011644 3300046533 Bacteria 6756
290 Ga0495586_0006318 3300046535 Bacteria 6330
291 Ga0495586_0049709 3300046535 Bacteria 2267
292 Ga0495656_0107901 3300046615 Bacteria 1298
293 Ga0495658_0028506 3300046683 Bacteria 3014
294 Ga0495613_0005472 3300046689 Bacteria 9538
295 Ga0495613_0077727 3300046689 Bacteria 2414
296 Ga0495613_0122667 3300046689 Bacteria 1865
297 Ga0495624_0015852 3300046690 Bacteria 5074
298 Ga0495589_0049612 3300046794 Bacteria 2077
299 Ga0495676_0211837 3300047321 Bacteria 1340
300 Ga0496100_0004075 3300048903 Bacteria 7705
301 Ga0496100_0063993 3300048903 Bacteria 2432
302 Ga0496100_0073042 3300048903 Bacteria 2294
303 Ga0496101_0001850 3300048904 Bacteria 12760
304 Ga0496101_0011102 3300048904 Bacteria 5969
305 Ga0496101_0076653 3300048904 Bacteria 2463
306 Ga0496101_0178922 3300048904 Bacteria 1632
307 Ga0496102_0028867 3300048905 Bacteria 4959
308 Ga0496103_0002352 3300048906 Bacteria 11928
309 Ga0496103_0053966 3300048906 Bacteria 2491
310 Ga0496104_0000319 3300048907 Bacteria 42768
311 Ga0496104_0012908 3300048907 Bacteria 7523
312 Ga0496104_0017047 3300048907 Bacteria 6609
313 Ga0496104_0052315 3300048907 Bacteria 3857
314 Ga0496104_0058940 3300048907 Bacteria 3635
315 Ga0496104_0132480 3300048907 Bacteria 2394
316 Ga0496105_0000194 3300048908 Bacteria 40666
317 Ga0496105_0003392 3300048908 Bacteria 11778
318 Ga0496105_0028073 3300048908 Bacteria 4602
319 Ga0496105_0039440 3300048908 Bacteria 3893
320 Ga0496105_0184187 3300048908 Bacteria 1709
321 Ga0496106_0004691 3300048909 Bacteria 10130
322 Ga0496106_0038255 3300048909 Bacteria 3589
323 Ga0496106_0047482 3300048909 Bacteria 3231
324 Ga0496106_0053992 3300048909 Bacteria 3035
325 Ga0496107_0000722 3300048910 Bacteria 18871
326 Ga0496107_0021065 3300048910 Bacteria 4606
327 Ga0496108_0000971 3300048911 Bacteria 22338
328 Ga0496108_0020808 3300048911 Bacteria 5394
329 Ga0496108_0026173 3300048911 Bacteria 4812
330 Ga0496108_0074541 3300048911 Bacteria 2865
331 Ga0496108_0080161 3300048911 Bacteria 2765
332 Ga0496109_0001518 3300048912 Bacteria 19311
333 Ga0496109_0003287 3300048912 Bacteria 13499
334 Ga0496109_0021739 3300048912 Bacteria 5678
335 Ga0496109_0034749 3300048912 Bacteria 4543
336 Ga0496109_0036653 3300048912 Bacteria 4427
337 Ga0496109_0060021 3300048912 Bacteria 3475
338 Ga0496109_0063303 3300048912 Bacteria 3383
339 Ga0496109_0224205 3300048912 Bacteria 1768
340 Ga0496110_0000757 3300048913 Bacteria 22349
341 Ga0496110_0002108 3300048913 Bacteria 14845
342 Ga0496110_0008523 3300048913 Bacteria 8256
343 Ga0496110_0018807 3300048913 Bacteria 5801
344 Ga0496110_0062812 3300048913 Bacteria 3281
345 Ga0496111_0000359 3300048914 Bacteria 22584
346 Ga0496111_0007625 3300048914 Bacteria 7112
347 Ga0496111_0008513 3300048914 Bacteria 6794
348 Ga0496111_0120658 3300048914 Bacteria 1936
349 Ga0496111_0137712 3300048914 Bacteria 1809
350 Ga0496111_0265499 3300048914 Bacteria 1273
351 Ga0496112_0004864 3300048915 Bacteria 11480
352 Ga0496112_0004929 3300048915 Bacteria 11427
353 Ga0496112_0005958 3300048915 Bacteria 10635
354 Ga0496112_0316043 3300048915 Bacteria 1506
355 Ga0496112_0354489 3300048915 Bacteria 1409
356 Ga0496113_0020788 3300048916 Bacteria 4622
357 Ga0496113_0049822 3300048916 Bacteria 3120
358 Ga0496113_0057246 3300048916 Bacteria 2929
359 Ga0496114_0011261 3300048917 Bacteria 7141
360 Ga0496114_0012153 3300048917 Bacteria 6889
361 Ga0496114_0028647 3300048917 Bacteria 4571
362 Ga0496114_0030355 3300048917 Bacteria 4447
363 Ga0496114_0035090 3300048917 Bacteria 4140
364 Ga0496115_0016686 3300048918 Bacteria 5597
365 Ga0496115_0030275 3300048918 Bacteria 4257
366 Ga0496115_0086283 3300048918 Bacteria 2561
367 Ga0501031_0005079 3300049568 Bacteria 8564
368 Ga0501033_0074551 3300049570 Bacteria 2491
369 Ga0501036_0003967 3300049572 Bacteria 11888
370 Ga0501036_0132307 3300049572 Bacteria 2105
371 Ga0501036_0169996 3300049572 Bacteria 1837
372 Ga0501039_0002797 3300049575 Bacteria 13032
373 Ga0501039_0006475 3300049575 Bacteria 8902
374 Ga0501040_0004379 3300049576 Bacteria 9179
375 Ga0501040_0010291 3300049576 Bacteria 6117
376 Ga0501040_0040033 3300049576 Bacteria 3189
377 Ga0501040_0052795 3300049576 Bacteria 2783
378 Ga0501041_0002443 3300049577 Bacteria 10552
379 Ga0501041_0010208 3300049577 Bacteria 5536
380 Ga0501042_0000396 3300049578 Bacteria 22075
381 Ga0501042_0049996 3300049578 Bacteria 2982
382 Ga0501046_0023950 3300049580 Bacteria 5013
383 Ga0501046_0053841 3300049580 Bacteria 3168
384 Ga0501046_0077197 3300049580 Bacteria 2579
385 Ga0501047_0030861 3300049581 Bacteria 5167
386 Ga0501048_0002492 3300049582 Bacteria 14056
387 Ga0501048_0004942 3300049582 Bacteria 10169
388 Ga0501067_0012844 3300049583 Bacteria 4637
389 Ga0501067_0024960 3300049583 Bacteria 3314
390 Ga0501067_0037788 3300049583 Bacteria 2681
391 Ga0501070_0000499 3300049586 Bacteria 35735
392 Ga0501070_0182461 3300049586 Bacteria 1727
393 Ga0501071_0069993 3300049587 Bacteria 2555
394 Ga0501072_0001349 3300049588 Bacteria 18401
395 Ga0501072_0001617 3300049588 Bacteria 16845
396 Ga0501072_0048463 3300049588 Bacteria 3346
397 Ga0501073_0111984 3300049589 Bacteria 1893
398 Ga0501074_0003979 3300049590 Bacteria 10531
399 Ga0501074_0232577 3300049590 Bacteria 1312
400 Ga0501075_0056932 3300049591 Bacteria 2943
401 Ga0501075_0169680 3300049591 Bacteria 1665
402 Ga0501076_0000767 3300049592 Bacteria 20726
403 Ga0501076_0008805 3300049592 Bacteria 7417
404 Ga0501077_0002933 3300049593 Bacteria 10239
405 Ga0501077_0004618 3300049593 Bacteria 8364
406 Ga0501079_0001587 3300049741 Bacteria 16140
407 Ga0501080_0067017 3300049742 Bacteria 3339
408 Ga0501080_0163576 3300049742 Bacteria 2054
409 Ga0501081_0005884 3300049743 Bacteria 7937
410 Ga0501081_0044697 3300049743 Bacteria 3041
411 Ga0501035_0116219 3300049822 Bacteria 2341
412 Ga0501045_0002805 3300049824 Bacteria 11906
413 Ga0501045_0010658 3300049824 Bacteria 6442
414 nmdc:mga0yw44_65712_c1 3300050492 Bacteria 2236
415 nmdc:mga05p37_211888_c1 3300050507 Bacteria 2342
416 nmdc:mga05p37_247840_c1 3300050507 Bacteria 2138
417 nmdc:mga05p37_2512_c1 3300050507 Bacteria 21327
418 nmdc:mga05p37_33482_c1 3300050507 Bacteria 6293
419 nmdc:mga05p37_50033_c1 3300050507 Bacteria 5140
420 nmdc:mga05p37_50322_c1 3300050507 Bacteria 5124
421 nmdc:mga09592_1697_c1 3300050508 Bacteria 17777
422 nmdc:mga09592_85996_c1 3300050508 Bacteria 2682
423 nmdc:mga0qj67_72781_c1 3300050509 Bacteria 2745
424 nmdc:mga06r32_221600_c1 3300050510 Bacteria 1880
425 nmdc:mga0n895_250811_c1 3300050512 Bacteria 1796
426 nmdc:mga0n895_56144_c1 3300050512 Bacteria 3879
427 nmdc:mga0rr50_3519_c1 3300050513 Bacteria 9031
428 nmdc:mga0rr50_4760_c1 3300050513 Bacteria 8008
429 nmdc:mga08x19_16830_c1 3300050514 Bacteria 4465
430 nmdc:mga08x19_23478_c1 3300050514 Bacteria 3826
431 nmdc:mga0a205_182551_c1 3300050515 Bacteria 1992
432 nmdc:mga0a205_78962_c1 3300050515 Bacteria 3180
433 Ga0495601_0152059 3300053077 Bacteria 1511
434 Ga0495595_0057338 3300053084 Bacteria 1817
435 Ga0501084_0016160 3300054114 Bacteria 6196
436 Ga0501084_0022236 3300054114 Bacteria 5292
437 Ga0501084_0050727 3300054114 Bacteria 3472
438 Ga0501084_0138850 3300054114 Bacteria 2046
439 Ga0501084_0290656 3300054114 Bacteria 1380
440 Ga0501082_0010663 3300060353 Bacteria 7910
441 Ga0501082_0079380 3300060353 Bacteria 2831
442 Ga0501082_0082192 3300060353 Bacteria 2779
443 Ga0501082_0105323 3300060353 Bacteria 2440
444 Ga0530510_0002000 3300061734 Bacteria 13983
445 Ga0530510_0005876 3300061734 Bacteria 8506
446 Ga0530510_0010431 3300061734 Bacteria 6514
447 Ga0207646_10045242
448 Ga0070683_100160670
449 Ga0070690_100024674
450 Ga0070670_100029986
451 Ga0070670_100032563
452 Ga0070680_100106185
453 Ga0068868_100095945
454 Ga0070660_100013246
455 Ga0070660_100034288
456 Ga0070689_100003774
457 Ga0070689_100004144
458 Ga0070687_100060851
459 Ga0070661_100034839
460 Ga0070692_10002103
461 Ga0070668_100017557
462 Ga0070675_100221057
463 Ga0070671_100234953
464 Ga0070674_100008326
465 Ga0070674_100076311
466 Ga0070673_100059116
467 Ga0070673_100250104
468 Ga0070688_100006538
469 Ga0070703_10004869
470 Ga0070709_10009435
471 Ga0070713_100110758
472 Ga0070710_10033036
473 Ga0070701_10000527
474 Ga0070701_10137493
475 Ga0070711_100013020
476 Ga0070711_100252484
477 Ga0070705_100005960
478 Ga0070700_100003804
479 Ga0070700_100006112
480 Ga0070708_100015571
481 Ga0070663_100010157
482 Ga0070678_100001233
483 Ga0070681_10013325
484 Ga0068867_100009093
485 Ga0070685_10000758
486 Ga0070685_10002617
487 Ga0070706_100024817
488 Ga0070707_100000309
489 Ga0070707_100009898
490 Ga0070698_100218188
491 Ga0070699_100074172
492 Ga0070699_100090043
493 Ga0070679_100027415
494 Ga0070679_100040776
495 Ga0070679_100106836
496 Ga0070679_100250866
497 Ga0070684_100072987
498 Ga0070672_100013244
499 Ga0070672_100056776
500 Ga0070696_100030156
501 Ga0070696_100043989
502 Ga0070693_100074596
503 Ga0070665_100003372
504 Ga0070665_100015648
505 Ga0070704_100002845
506 Ga0070664_100056995
507 Ga0070664_100100062
508 Ga0070664_100395673
509 Ga0068857_100001704
510 Ga0068854_100270504
511 Ga0068856_100004194
512 Ga0068856_100007297
513 Ga0068856_100174543
514 Ga0070702_100002756
515 Ga0070702_100008371
516 Ga0068859_100046718
517 Ga0068866_10005551
518 Ga0068866_10170955
519 Ga0068861_100099782
520 Ga0068861_100184821
521 Ga0068870_10017516
522 Ga0068870_10018520
523 Ga0068858_100262975
524 Ga0068860_100026848
525 Ga0068862_100081653
526 Ga0081455_10045797
527 Ga0081538_10000283
528 Ga0081538_10000301
529 Ga0081538_10000375
530 Ga0081538_10000773
531 Ga0081538_10002849
532 Ga0081538_10011338
533 Ga0081539_10001549
534 Ga0070717_10129918
535 Ga0075365_10027207
536 Ga0097621_100223310
537 Ga0068871_100011506
538 Ga0075431_100171635
539 Ga0075433_10022869
540 Ga0075433_10024120
541 Ga0075434_100006726
542 Ga0075434_100081124
543 Ga0075434_100106025
544 Ga0075434_100252606
545 Ga0075429_100003982
546 Ga0068865_100000466
547 Ga0068865_100022834
548 Ga0075436_100004777
549 Ga0075436_100021102
550 Ga0075436_100025940
551 Ga0097620_100046717
552 Ga0075435_100010930
553 Ga0111539_10001409
554 Ga0111539_10096276
555 Ga0105245_10004080
556 Ga0105245_10085290
557 Ga0105245_10609665
558 Ga0105247_10065408
559 Ga0105247_10133176
560 Ga0114129_10004975
561 Ga0114129_10006109
562 Ga0114129_10011823
563 Ga0114129_10047826
564 Ga0114129_10049630
565 Ga0114129_10281481
566 Ga0114129_10712490
567 Ga0105243_10002360
568 Ga0105243_10036431
569 Ga0105243_10134511
570 Ga0105248_10057365
571 Ga0105248_10179819
572 Ga0105237_10049033
573 Ga0105249_10004723
574 Ga0105239_10010318
575 Ga0105239_10106829
576 Ga0105239_10286703
577 Ga0105246_10168765
578 Ga0157370_10020774
579 Ga0157374_10003026
580 Ga0157374_10102538
581 Ga0157378_10371301
582 Ga0163162_10003839
583 Ga0163162_10286348
584 Ga0163162_10299773
585 Ga0157375_10007752
586 Ga0157375_10318484
587 Ga0163163_10017196
588 Ga0163163_10119261
589 Ga0163163_10161892
590 Ga0157377_10003196
591 Ga0157376_10031843
592 Ga0206353_10104255
593 Ga0207653_10003112
594 Ga0207642_10000491
595 Ga0207710_10030034
596 Ga0207688_10008595
597 Ga0207643_10007959
598 Ga0207684_10032079
599 Ga0207684_10161012
600 Ga0207707_10011649
601 Ga0207707_10014051
602 Ga0207693_10000179
603 Ga0207693_10000679
604 Ga0207693_10001288
605 Ga0207663_10042768
606 Ga0207663_10158357
607 Ga0207663_10159975
608 Ga0207660_10027914
609 Ga0207657_10040649
610 Ga0207657_10042530
611 Ga0207657_10081639
612 Ga0207652_10004003
613 Ga0207652_10019721
614 Ga0207652_10094710
615 Ga0207646_10001136
616 Ga0207646_10159826
617 Ga0207650_10003774
618 Ga0207650_10087854
619 Ga0207687_10002856
620 Ga0207664_10028296
621 Ga0207644_10037885
622 Ga0207644_10079020
623 Ga0207706_10141527
624 Ga0207686_10002068
625 Ga0207686_10075806
626 Ga0207709_10023658
627 Ga0207670_10018362
628 Ga0207704_10000919
629 Ga0207704_10157521
630 Ga0207665_10003530
631 Ga0207691_10004683
632 Ga0207691_10017957
633 Ga0207689_10035139
634 Ga0207661_10060375
635 Ga0207661_10248597
636 Ga0207679_10246133
637 Ga0207667_10124562
638 Ga0207712_10004212
639 Ga0207640_10106776
640 Ga0207677_10187576
641 Ga0207678_10007040
642 Ga0207708_10000500
643 Ga0207708_10011534
644 Ga0207702_10007044
645 Ga0207702_10128232
646 Ga0207702_10163003
647 Ga0207641_10156222
648 Ga0207648_10004585
649 Ga0207648_10100782
650 Ga0207674_10002728
651 Ga0207674_10007487
652 Ga0207675_100032290
653 Ga0207683_10001613
654 Ga0207683_10034019
655 Ga0207683_10060415
656 Ga0207698_10060761
657 Ga0207428_10050939
658 Ga0268264_10084148
659 Ga0265318_10001206
660 Ga0265338_10047455
661 Ga0265338_10085731
662 Ga0265338_10098977
663 Ga0265332_10012631
664 Ga0265328_10000898
665 Ga0265325_10037738
666 Ga0265325_10037759
667 Ga0265314_10087728
668 Ga0307416_100103495
669 Ga0373932_0001990
670 Ga0373961_0016443
671 Ga0373937_0152218
672 Ga0395899_0017730
673 Ga0395899_0056538
674 Ga0395899_0122259
675 Ga0395900_0004553
676 Ga0395900_0005102
677 Ga0395900_0008552
678 Ga0395900_0055237
679 Ga0395900_0063869
680 Ga0395900_0093295
681 Ga0395900_0098227
682 Ga0395900_0132858
683 Ga0395900_0168174
684 Ga0395898_0005976
685 Ga0395898_0010004
686 Ga0395898_0011371
687 Ga0395898_0013287
688 Ga0395898_0033301
689 Ga0395898_0036659
690 Ga0395898_0058581
691 Ga0395898_0067452
692 Ga0395898_0149451
693 Ga0395905_0008668
694 Ga0395905_0017152
695 Ga0395905_0031230
696 Ga0395905_0034630
697 Ga0395905_0098720
698 Ga0395905_0149756
699 Ga0395905_0157741
700 Ga0395905_0168691
701 Ga0395901_0001857
702 Ga0395901_0003321
703 Ga0395901_0008882
704 Ga0395901_0018762
705 Ga0395901_0022888
706 Ga0395901_0068024
707 Ga0395901_0068460
708 Ga0395901_0231212
709 Ga0451793_0070286
710 Ga0451835_0271174
711 Ga0450918_008713
712 Ga0466969_0000895
713 Ga0466972_0065634
714 Ga0466966_0047412
715 Ga0466961_0058724
716 Ga0466963_0065003
717 Ga0466964_0010837
718 Ga0466968_0001650
719 Ga0466968_0012966
720 Ga0466968_0036227
721 Ga0466970_0169782
722 Ga0466960_0002175
723 Ga0466959_0020394
724 Ga0466958_0034866
725 Ga0466967_0021774
726 Ga0466967_0157071
727 Ga0495629_0003253
728 Ga0495582_0023271
729 Ga0495605_0033143
730 Ga0495639_0018993
731 Ga0495662_0069634
732 Ga0495584_0063246
733 Ga0495594_0132644
734 Ga0495630_0007883
735 Ga0495640_0011644
736 Ga0495586_0006318
737 Ga0495586_0049709
738 Ga0495656_0107901
739 Ga0495658_0028506
740 Ga0495613_0005472
741 Ga0495613_0077727
742 Ga0495613_0122667
743 Ga0495624_0015852
744 Ga0495589_0049612
745 Ga0495676_0211837
746 Ga0496100_0004075
747 Ga0496100_0063993
748 Ga0496100_0073042
749 Ga0496101_0001850
750 Ga0496101_0011102
751 Ga0496101_0076653
752 Ga0496101_0178922
753 Ga0496102_0028867
754 Ga0496103_0002352
755 Ga0496103_0053966
756 Ga0496104_0000319
757 Ga0496104_0012908
758 Ga0496104_0017047
759 Ga0496104_0052315
760 Ga0496104_0058940
761 Ga0496104_0132480
762 Ga0496105_0000194
763 Ga0496105_0003392
764 Ga0496105_0028073
765 Ga0496105_0039440
766 Ga0496105_0184187
767 Ga0496106_0004691
768 Ga0496106_0038255
769 Ga0496106_0047482
770 Ga0496106_0053992
771 Ga0496107_0000722
772 Ga0496107_0021065
773 Ga0496108_0000971
774 Ga0496108_0020808
775 Ga0496108_0026173
776 Ga0496108_0074541
777 Ga0496108_0080161
778 Ga0496109_0001518
779 Ga0496109_0003287
780 Ga0496109_0021739
781 Ga0496109_0034749
782 Ga0496109_0036653
783 Ga0496109_0060021
784 Ga0496109_0063303
785 Ga0496109_0224205
786 Ga0496110_0000757
787 Ga0496110_0002108
788 Ga0496110_0008523
789 Ga0496110_0018807
790 Ga0496110_0062812
791 Ga0496111_0000359
792 Ga0496111_0007625
793 Ga0496111_0008513
794 Ga0496111_0120658
795 Ga0496111_0137712
796 Ga0496111_0265499
797 Ga0496112_0004864
798 Ga0496112_0004929
799 Ga0496112_0005958
800 Ga0496112_0316043
801 Ga0496112_0354489
802 Ga0496113_0020788
803 Ga0496113_0049822
804 Ga0496113_0057246
805 Ga0496114_0011261
806 Ga0496114_0012153
807 Ga0496114_0028647
808 Ga0496114_0030355
809 Ga0496114_0035090
810 Ga0496115_0016686
811 Ga0496115_0030275
812 Ga0496115_0086283
813 Ga0501031_0005079
814 Ga0501033_0074551
815 Ga0501036_0003967
816 Ga0501036_0132307
817 Ga0501036_0169996
818 Ga0501039_0002797
819 Ga0501039_0006475
820 Ga0501040_0004379
821 Ga0501040_0010291
822 Ga0501040_0040033
823 Ga0501040_0052795
824 Ga0501041_0002443
825 Ga0501041_0010208
826 Ga0501042_0000396
827 Ga0501042_0049996
828 Ga0501046_0023950
829 Ga0501046_0053841
830 Ga0501046_0077197
831 Ga0501047_0030861
832 Ga0501048_0002492
833 Ga0501048_0004942
834 Ga0501067_0012844
835 Ga0501067_0024960
836 Ga0501067_0037788
837 Ga0501070_0000499
838 Ga0501070_0182461
839 Ga0501071_0069993
840 Ga0501072_0001349
841 Ga0501072_0001617
842 Ga0501072_0048463
843 Ga0501073_0111984
844 Ga0501074_0003979
845 Ga0501074_0232577
846 Ga0501075_0056932
847 Ga0501075_0169680
848 Ga0501076_0000767
849 Ga0501076_0008805
850 Ga0501077_0002933
851 Ga0501077_0004618
852 Ga0501079_0001587
853 Ga0501080_0067017
854 Ga0501080_0163576
855 Ga0501081_0005884
856 Ga0501081_0044697
857 Ga0501035_0116219
858 Ga0501045_0002805
859 Ga0501045_0010658
860 nmdc:mga0yw44_65712_c1
861 nmdc:mga05p37_211888_c1
862 nmdc:mga05p37_247840_c1
863 nmdc:mga05p37_2512_c1
864 nmdc:mga05p37_33482_c1
865 nmdc:mga05p37_50033_c1
866 nmdc:mga05p37_50322_c1
867 nmdc:mga09592_1697_c1
868 nmdc:mga09592_85996_c1
869 nmdc:mga0qj67_72781_c1
870 nmdc:mga06r32_221600_c1
871 nmdc:mga0n895_250811_c1
872 nmdc:mga0n895_56144_c1
873 nmdc:mga0rr50_3519_c1
874 nmdc:mga0rr50_4760_c1
875 nmdc:mga08x19_16830_c1
876 nmdc:mga08x19_23478_c1
877 nmdc:mga0a205_182551_c1
878 nmdc:mga0a205_78962_c1
879 Ga0495601_0152059
880 Ga0495595_0057338
881 Ga0501084_0016160
882 Ga0501084_0022236
883 Ga0501084_0050727
884 Ga0501084_0138850
885 Ga0501084_0290656
886 Ga0501082_0010663
887 Ga0501082_0079380
888 Ga0501082_0082192
889 Ga0501082_0105323
890 Ga0530510_0002000
891 Ga0530510_0005876
892 Ga0530510_0010431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06969

HemN_C

HemN C-terminal domain

339

406

0.94

PF04055

Radical_SAM

Radical SAM superfamily

45

210

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qz7-assembly1.cif.gz_B transcriptional regulator lmrr with bound daunomycin and with trp-67 and trp-96 replaced by 5,6,7-trifluorotrp 0.8408 330 358
7qep-assembly1.cif.gz_C0 cryo-em structure of the ribosome from encephalitozoon cuniculi 0.8306 332 359
8a3w-assembly1.cif.gz_SN cryo-em structure of leishmania major 80s ribosome : wild type 0.8263 332 362
1tbx-assembly1.cif.gz_A crystal structure of ssv1 f-93 0.8185 330 367
3jbp-assembly1.cif.gz_O cryo-electron microscopy reconstruction of the plasmodium falciparum 80s ribosome bound to e-trna 0.8089 330 362
ID Description Score Start End Superfamily
af_Q2FXY9_7_216_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9192 8 202 3.80.30.20
af_P52062_9_222_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9155 8 197 3.80.30.20
af_P9WP73_8_223_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9011 8 200 3.80.30.20
af_Q9HA92_43_208_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8754 8 165 3.20.20.70
af_Q5SUV1_33_283_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8568 2 236 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A538HI81-F1-model_v4 Radical SAM protein 0.9845 1 154 GO:0003824
GO:0005737
GO:0006779
GO:0051539
AF-A0A538HI81-F1-model_v4 Radical SAM protein 0.9538 1 154 GO:0003824
GO:0005737
GO:0006779
GO:0051539
AF-A0A2V8GT17-F1-model_v4 Heme chaperone HemW 0.9315 4 269 GO:0004109
GO:0005737
GO:0006779
GO:0046872
GO:0051539
AF-A0A3D3FGC2-F1-model_v4 Coproporphyrinogen dehydrogenase HemZ 0.9297 6 164 GO:0003824
GO:0005737
GO:0006779
GO:0051539
AF-A0A355A4D5-F1-model_v4 Coproporphyrinogen dehydrogenase HemZ 0.9287 6 192 GO:0003824
GO:0005737
GO:0006779
GO:0051539

Map