metagRoot

F445703

General Info

Members	Datasets	Scaffolds	Average Seq Length
446	236	446	180

Family's Representative Sequence

Representative Sequence	3300009093\|Ga0105240_10049282\|Ga0105240_100492823
Length	198
Sequence	LEPDSGWKQKLIQPKLASMNLVHLLPVGNIDRALLESISRALPESLPVRCEILACRLDPAAAYHAERQQFHSSEILQRMQPLATPCWRLLAIADVDLYIPILTYVFGEAQIAGVCAVVSAFRFRQEFYGLDGDEDLLRERLLKECVHELGHTLDLRHCQDYRCAMASSHAVEWIDLRGSTLCESCRSQLEAGRAFQLA

Samples

	Sample ID	Description	Type	Environment
1	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
2	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
3	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
4	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
5	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
6	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
7	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
8	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
9	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
10	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
11	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
12	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
13	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
14	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
15	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
16	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
17	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
18	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
19	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
20	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
21	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
22	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
23	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
24	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
25	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
26	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
27	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
28	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
29	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
30	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
31	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
32	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
33	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
34	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
35	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
36	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
37	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
38	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
39	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
40	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
41	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
42	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
43	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
44	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
45	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
46	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
47	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
48	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
49	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
50	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
53	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
54	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
55	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
56	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
57	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
58	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
59	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
60	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
61	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
62	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
63	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
64	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
65	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
66	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
67	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
68	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
69	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
70	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
71	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
72	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
74	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
75	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
77	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
78	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
79	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
80	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
81	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
82	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
83	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
84	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
85	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
86	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
87	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
88	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
89	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
90	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
91	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
92	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
93	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
94	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
95	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
96	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
97	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
98	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
99	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
100	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
101	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
102	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
103	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
104	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
167	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
168	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
169	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
170	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
171	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
172	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
173	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
174	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
175	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
176	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
177	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
178	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
179	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
180	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
181	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
182	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
183	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
184	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
185	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
186	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
187	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
188	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
189	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
190	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
191	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
192	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
193	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
194	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
195	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
196	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
197	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
198	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
199	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
200	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
201	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
202	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
203	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
204	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
205	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
206	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
207	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
208	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
209	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
210	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
211	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
212	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
213	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
214	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
215	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
216	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
217	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
218	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
219	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
220	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
221	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
222	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
223	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
224	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
225	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
226	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
227	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
228	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
229	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
230	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
231	3300049520	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought	Metagenome	Rhizosphere
232	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
233	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
234	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
235	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
236	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.78
Metatranscriptomes	0.22
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	6.95
Rhizosphere	92.83
Stem	0
Stem Tuber	0
Unclassified	0.22

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24752J21851_1006134	3300001976	Unclassified	1571
2	JGI24737J22298_10096936	3300001990	Unclassified	874
3	JGI24743J22301_10032784	3300001991	Unclassified	1027
4	JGI24748J21848_1006896	3300002074	Unclassified	1327
5	JGI24034J26672_10002281	3300002239	Unclassified	2623
6	JGI24751J29686_10001601	3300002459	Bacteria	4675
7	Ga0065712_10383564	3300005290	Unclassified	749
8	Ga0065715_10328902	3300005293	Unclassified	981
9	Ga0065715_10383203	3300005293	Bacteria	892
10	Ga0070658_10087249	3300005327	Bacteria	2568
11	Ga0070683_100017661	3300005329	Bacteria	6303
12	Ga0070683_101214890	3300005329	Unclassified	724
13	Ga0070670_100363113	3300005331	Bacteria	1274
14	Ga0070670_100493305	3300005331	Unclassified	1088
15	Ga0068869_100049535	3300005334	Unclassified	3041
16	Ga0068869_100312501	3300005334	Bacteria	1272
17	Ga0070666_10216035	3300005335	Unclassified	1351
18	Ga0070682_100072540	3300005337	Unclassified	2207
19	Ga0068868_100003132	3300005338	Bacteria	11511
20	Ga0068868_100028678	3300005338	Unclassified	4258
21	Ga0068868_100130258	3300005338	Bacteria	2058
22	Ga0068868_100160007	3300005338	Bacteria	1859
23	Ga0070660_100031857	3300005339	Bacteria	3963
24	Ga0070660_100155154	3300005339	Bacteria	1843
25	Ga0070660_100157937	3300005339	Unclassified	1826
26	Ga0070689_100013238	3300005340	Bacteria	5964
27	Ga0070687_100006689	3300005343	Bacteria	4745
28	Ga0070661_100010692	3300005344	Bacteria	6386
29	Ga0070692_10287414	3300005345	Unclassified	999
30	Ga0070668_100875779	3300005347	Unclassified	801
31	Ga0070669_100008760	3300005353	Bacteria	7219
32	Ga0070675_100010707	3300005354	Bacteria	7173
33	Ga0070675_100279395	3300005354	Bacteria	1467
34	Ga0070671_100433328	3300005355	Bacteria	1127
35	Ga0070671_100607227	3300005355	Bacteria	946
36	Ga0070671_100746470	3300005355	Unclassified	850
37	Ga0070674_100814351	3300005356	Unclassified	807
38	Ga0070673_100018214	3300005364	Bacteria	5013
39	Ga0070688_100012217	3300005365	Bacteria	4806
40	Ga0070659_100038103	3300005366	Bacteria	3748
41	Ga0070659_100269104	3300005366	Unclassified	1415
42	Ga0070709_10050587	3300005434	Bacteria	2604
43	Ga0070709_10096616	3300005434	Bacteria	1959
44	Ga0070709_10253273	3300005434	Bacteria	1269
45	Ga0070714_100000101	3300005435	Bacteria	71577
46	Ga0070714_100001746	3300005435	Bacteria	15844
47	Ga0070714_100113440	3300005435	Bacteria	2403
48	Ga0070714_101492184	3300005435	Unclassified	660
49	Ga0070713_100000675	3300005436	Bacteria	21861
50	Ga0070713_100003078	3300005436	Bacteria	10964
51	Ga0070713_100095360	3300005436	Bacteria	2566
52	Ga0070713_100225307	3300005436	Bacteria	1702
53	Ga0070710_10010586	3300005437	Bacteria	4533
54	Ga0070710_10020932	3300005437	Bacteria	3401
55	Ga0070710_10154923	3300005437	Unclassified	1416
56	Ga0070711_100000076	3300005439	Bacteria	55974
57	Ga0070711_100013225	3300005439	Bacteria	5179
58	Ga0070711_100024970	3300005439	Bacteria	3906
59	Ga0070711_100067912	3300005439	Bacteria	2503
60	Ga0070700_100219078	3300005441	Unclassified	1347
61	Ga0070694_100772777	3300005444	Unclassified	786
62	Ga0070708_100097568	3300005445	Bacteria	2687
63	Ga0070708_100488108	3300005445	Bacteria	1162
64	Ga0070663_100193688	3300005455	Bacteria	1583
65	Ga0070678_100231647	3300005456	Bacteria	1540
66	Ga0070662_100009605	3300005457	Bacteria	6329
67	Ga0070662_100036149	3300005457	Bacteria	3492
68	Ga0070681_10060099	3300005458	Bacteria	3779
69	Ga0070681_10148926	3300005458	Bacteria	2268
70	Ga0070681_10688129	3300005458	Bacteria	938
71	Ga0068867_100008660	3300005459	Bacteria	7184
72	Ga0070685_10004250	3300005466	Bacteria	7225
73	Ga0070707_100035240	3300005468	Bacteria	4774
74	Ga0070707_100284494	3300005468	Bacteria	1607
75	Ga0070698_101125257	3300005471	Bacteria	734
76	Ga0070679_100021973	3300005530	Bacteria	6233
77	Ga0070679_100107120	3300005530	Bacteria	2781
78	Ga0070684_100000472	3300005535	Bacteria	27450
79	Ga0070684_100284314	3300005535	Bacteria	1516
80	Ga0068853_100017617	3300005539	Bacteria	5895
81	Ga0070672_100001294	3300005543	Bacteria	15407
82	Ga0070672_101525415	3300005543	Unclassified	599
83	Ga0070686_100002087	3300005544	Bacteria	11028
84	Ga0070693_100026965	3300005547	Bacteria	3107
85	Ga0070693_100109246	3300005547	Bacteria	1698
86	Ga0068855_100003807	3300005563	Bacteria	18448
87	Ga0068855_100077109	3300005563	Bacteria	3867
88	Ga0070664_100010359	3300005564	Bacteria	7564
89	Ga0070664_100080129	3300005564	Unclassified	2812
90	Ga0068857_100010855	3300005577	Bacteria	7929
91	Ga0068857_100049542	3300005577	Unclassified	3726
92	Ga0068857_100153153	3300005577	Bacteria	2089
93	Ga0068854_100008487	3300005578	Bacteria	6609
94	Ga0068856_100004472	3300005614	Bacteria	13911
95	Ga0068856_100045661	3300005614	Bacteria	4314
96	Ga0068856_100074256	3300005614	Unclassified	3366
97	Ga0070702_100058301	3300005615	Bacteria	2236
98	Ga0068852_100003760	3300005616	Bacteria	10642
99	Ga0068852_100568805	3300005616	Bacteria	1135
100	Ga0068859_100249758	3300005617	Unclassified	1864
101	Ga0068864_100017143	3300005618	Bacteria	6040
102	Ga0068864_100038185	3300005618	Bacteria	4099
103	Ga0068864_100712711	3300005618	Unclassified	981
104	Ga0068866_10000493	3300005718	Bacteria	18141
105	Ga0068861_100188243	3300005719	Bacteria	1723
106	Ga0068851_10012281	3300005834	Bacteria	4033
107	Ga0068851_10016063	3300005834	Bacteria	3577
108	Ga0068870_10003777	3300005840	Bacteria	6442
109	Ga0068863_100047499	3300005841	Bacteria	4071
110	Ga0068863_100265176	3300005841	Unclassified	1661
111	Ga0068863_100446367	3300005841	Bacteria	1269
112	Ga0068858_100025230	3300005842	Bacteria	5532
113	Ga0068860_100231674	3300005843	Unclassified	1795
114	Ga0068862_100012739	3300005844	Bacteria	6960
115	Ga0068862_100691424	3300005844	Unclassified	987
116	Ga0070717_10013204	3300006028	Bacteria	6319
117	Ga0070717_10029343	3300006028	Bacteria	4412
118	Ga0070717_11461280	3300006028	Unclassified	620
119	Ga0070715_10003961	3300006163	Bacteria	4795
120	Ga0070715_10017865	3300006163	Bacteria	2692
121	Ga0070716_100126244	3300006173	Bacteria	1610
122	Ga0070712_100000105	3300006175	Bacteria	43144
123	Ga0070712_100000506	3300006175	Bacteria	22281
124	Ga0070712_101351303	3300006175	Bacteria	621
125	Ga0097621_100073008	3300006237	Bacteria	2839
126	Ga0097621_100468287	3300006237	Bacteria	1137
127	Ga0097621_100905651	3300006237	Unclassified	822
128	Ga0068871_100217518	3300006358	Bacteria	1654
129	Ga0068871_100255497	3300006358	Unclassified	1527
130	Ga0068865_100024696	3300006881	Bacteria	3946
131	Ga0097620_100249750	3300006931	Unclassified	1864
132	Ga0105251_10140365	3300009011	Unclassified	1093
133	Ga0105250_10039110	3300009092	Bacteria	1902
134	Ga0105250_10087702	3300009092	Bacteria	1264
135	Ga0105240_10024763	3300009093	Bacteria	7904
136	Ga0105240_10049282	3300009093	Bacteria	5318
137	Ga0105245_10023261	3300009098	Bacteria	5440
138	Ga0105241_10006198	3300009174	Bacteria	8820
139	Ga0105241_10071223	3300009174	Bacteria	2698
140	Ga0105241_10074474	3300009174	Bacteria	2644
141	Ga0105241_10160840	3300009174	Bacteria	1846
142	Ga0105241_10275236	3300009174	Bacteria	1436
143	Ga0105241_10631344	3300009174	Bacteria	971
144	Ga0105242_10058840	3300009176	Unclassified	3152
145	Ga0105248_10033302	3300009177	Bacteria	5755
146	Ga0105248_10080585	3300009177	Bacteria	3659
147	Ga0105248_10816343	3300009177	Bacteria	1053
148	Ga0105248_11091871	3300009177	Unclassified	902
149	Ga0105237_10045001	3300009545	Bacteria	4443
150	Ga0105238_10289876	3300009551	Bacteria	1619
151	Ga0105238_10696608	3300009551	Unclassified	1028
152	Ga0105249_10026889	3300009553	Bacteria	5188
153	Ga0105249_10125764	3300009553	Bacteria	2441
154	Ga0105239_10079328	3300010375	Unclassified	3612
155	Ga0105239_10378493	3300010375	Bacteria	1600
156	Ga0105239_11528751	3300010375	Unclassified	771
157	Ga0105246_10000935	3300011119	Bacteria	16720
158	Ga0157373_10025035	3300013100	Bacteria	4320
159	Ga0157373_10029545	3300013100	Bacteria	3948
160	Ga0157373_10125013	3300013100	Bacteria	1808
161	Ga0157371_10013625	3300013102	Bacteria	6170
162	Ga0157369_10031061	3300013105	Bacteria	5887
163	Ga0157369_10055261	3300013105	Bacteria	4286
164	Ga0157374_10022579	3300013296	Bacteria	5614
165	Ga0157374_10111825	3300013296	Bacteria	2628
166	Ga0157374_10202122	3300013296	Unclassified	1946
167	Ga0157374_10252586	3300013296	Bacteria	1735
168	Ga0157374_10584604	3300013296	Bacteria	1126
169	Ga0157378_10607820	3300013297	Unclassified	1105
170	Ga0163162_10078233	3300013306	Unclassified	3372
171	Ga0157372_10039871	3300013307	Bacteria	5186
172	Ga0157372_10114715	3300013307	Bacteria	3088
173	Ga0157375_10185469	3300013308	Unclassified	2233
174	Ga0163163_10001888	3300014325	Bacteria	17719
175	Ga0163163_10029419	3300014325	Bacteria	5284
176	Ga0163163_10073991	3300014325	Bacteria	3398
177	Ga0163163_10222922	3300014325	Bacteria	1934
178	Ga0163163_10286594	3300014325	Bacteria	1699
179	Ga0157380_10045649	3300014326	Bacteria	3439
180	Ga0182008_10022217	3300014497	Bacteria	3250
181	Ga0157377_10012137	3300014745	Bacteria	4324
182	Ga0157379_10082119	3300014968	Unclassified	2888
183	Ga0157376_10143127	3300014969	Bacteria	2147
184	Ga0182005_1023414	3300015265	Bacteria	1688
185	Ga0163161_10001198	3300017792	Bacteria	19518
186	Ga0207697_10006536	3300025315	Bacteria	5261
187	Ga0207656_10012602	3300025321	Bacteria	3218
188	Ga0207656_10104487	3300025321	Bacteria	1302
189	Ga0207682_10016969	3300025893	Unclassified	2843
190	Ga0207692_10013400	3300025898	Bacteria	3556
191	Ga0207692_10020798	3300025898	Bacteria	2992
192	Ga0207692_10068348	3300025898	Unclassified	1863
193	Ga0207642_10142576	3300025899	Unclassified	1265
194	Ga0207688_10022246	3300025901	Unclassified	3467
195	Ga0207680_10058398	3300025903	Unclassified	2338
196	Ga0207647_10002605	3300025904	Bacteria	13637
197	Ga0207685_10009485	3300025905	Bacteria	2829
198	Ga0207699_10003382	3300025906	Bacteria	7604
199	Ga0207699_10008682	3300025906	Bacteria	5026
200	Ga0207699_10019119	3300025906	Bacteria	3646
201	Ga0207699_10225208	3300025906	Bacteria	1282
202	Ga0207699_10321796	3300025906	Bacteria	1085
203	Ga0207645_10002044	3300025907	Bacteria	16175
204	Ga0207643_10000248	3300025908	Bacteria	37691
205	Ga0207705_10130702	3300025909	Bacteria	1869
206	Ga0207654_10008437	3300025911	Bacteria	5209
207	Ga0207654_10051806	3300025911	Bacteria	2364
208	Ga0207654_10207600	3300025911	Bacteria	1293
209	Ga0207654_10261478	3300025911	Unclassified	1164
210	Ga0207707_10117743	3300025912	Unclassified	2322
211	Ga0207707_10227573	3300025912	Bacteria	1623
212	Ga0207707_10412863	3300025912	Bacteria	1158
213	Ga0207695_10077432	3300025913	Unclassified	3378
214	Ga0207693_10000016	3300025915	Bacteria	145892
215	Ga0207693_10000065	3300025915	Bacteria	91476
216	Ga0207693_10050443	3300025915	Bacteria	3268
217	Ga0207663_10001491	3300025916	Bacteria	10914
218	Ga0207663_10041900	3300025916	Bacteria	2794
219	Ga0207663_10057661	3300025916	Bacteria	2448
220	Ga0207660_10762127	3300025917	Unclassified	790
221	Ga0207662_10012154	3300025918	Bacteria	4792
222	Ga0207657_10000404	3300025919	Bacteria	45859
223	Ga0207657_10002209	3300025919	Bacteria	21110
224	Ga0207657_10299206	3300025919	Unclassified	1275
225	Ga0207649_10001159	3300025920	Bacteria	15875
226	Ga0207652_10168731	3300025921	Bacteria	1963
227	Ga0207652_10564649	3300025921	Bacteria	1022
228	Ga0207646_10064559	3300025922	Bacteria	3268
229	Ga0207646_10938893	3300025922	Unclassified	766
230	Ga0207681_10127018	3300025923	Bacteria	1879
231	Ga0207694_10187412	3300025924	Bacteria	1680
232	Ga0207650_10000036	3300025925	Bacteria	214579
233	Ga0207650_10329791	3300025925	Unclassified	1251
234	Ga0207650_10331848	3300025925	Bacteria	1247
235	Ga0207659_10019911	3300025926	Bacteria	4426
236	Ga0207687_10121529	3300025927	Unclassified	1954
237	Ga0207700_10000132	3300025928	Bacteria	44689
238	Ga0207700_10000988	3300025928	Bacteria	16396
239	Ga0207700_10094351	3300025928	Bacteria	2371
240	Ga0207700_10566609	3300025928	Bacteria	1009
241	Ga0207700_11505484	3300025928	Unclassified	597
242	Ga0207664_10000111	3300025929	Bacteria	72075
243	Ga0207664_10012656	3300025929	Bacteria	6036
244	Ga0207664_10314419	3300025929	Unclassified	1381
245	Ga0207664_10655698	3300025929	Unclassified	943
246	Ga0207664_10994533	3300025929	Unclassified	752
247	Ga0207644_10048543	3300025931	Unclassified	3035
248	Ga0207644_10674493	3300025931	Bacteria	861
249	Ga0207690_10017756	3300025932	Bacteria	4351
250	Ga0207706_10000301	3300025933	Bacteria	53614
251	Ga0207706_10078195	3300025933	Bacteria	2910
252	Ga0207670_10016460	3300025936	Bacteria	4444
253	Ga0207665_10017293	3300025939	Bacteria	4738
254	Ga0207665_10026475	3300025939	Bacteria	3828
255	Ga0207665_10090926	3300025939	Bacteria	2116
256	Ga0207691_10002309	3300025940	Bacteria	18684
257	Ga0207711_10004607	3300025941	Bacteria	11725
258	Ga0207689_10000669	3300025942	Bacteria	32690
259	Ga0207661_10011380	3300025944	Bacteria	6444
260	Ga0207661_10441041	3300025944	Bacteria	1185
261	Ga0207679_10000162	3300025945	Bacteria	55471
262	Ga0207667_10237004	3300025949	Bacteria	1868
263	Ga0207667_10358771	3300025949	Bacteria	1486
264	Ga0207667_10388919	3300025949	Bacteria	1420
265	Ga0207651_10013663	3300025960	Bacteria	4655
266	Ga0207712_10031706	3300025961	Bacteria	3562
267	Ga0207712_10608712	3300025961	Unclassified	946
268	Ga0207668_10030040	3300025972	Bacteria	3568
269	Ga0207640_10017402	3300025981	Bacteria	4205
270	Ga0207640_10358861	3300025981	Unclassified	1173
271	Ga0207658_10098328	3300025986	Unclassified	2286
272	Ga0207658_10732286	3300025986	Bacteria	895
273	Ga0207677_10083624	3300026023	Bacteria	2298
274	Ga0207677_10379780	3300026023	Bacteria	1192
275	Ga0207703_10068589	3300026035	Bacteria	2922
276	Ga0207639_10042754	3300026041	Bacteria	3398
277	Ga0207678_10021507	3300026067	Bacteria	5656
278	Ga0207678_10415993	3300026067	Bacteria	1165
279	Ga0207708_10176804	3300026075	Bacteria	1693
280	Ga0207702_10002936	3300026078	Bacteria	15945
281	Ga0207702_10023424	3300026078	Bacteria	5121
282	Ga0207702_10049945	3300026078	Bacteria	3530
283	Ga0207641_10000153	3300026088	Bacteria	97933
284	Ga0207641_10022260	3300026088	Bacteria	5216
285	Ga0207641_10072423	3300026088	Bacteria	2967
286	Ga0207641_10106566	3300026088	Bacteria	2478
287	Ga0207648_10000069	3300026089	Bacteria	95981
288	Ga0207676_10000311	3300026095	Bacteria	41694
289	Ga0207676_10058035	3300026095	Bacteria	3051
290	Ga0207674_10000016	3300026116	Bacteria	182470
291	Ga0207674_10007195	3300026116	Bacteria	12991
292	Ga0207674_10112609	3300026116	Bacteria	2695
293	Ga0207675_100039482	3300026118	Bacteria	4405
294	Ga0207683_10000176	3300026121	Bacteria	54804
295	Ga0207683_10135772	3300026121	Bacteria	2214
296	Ga0207698_10152062	3300026142	Bacteria	2010
297	Ga0268266_10001571	3300028379	Bacteria	26702
298	Ga0268264_10090242	3300028381	Bacteria	2641
299	Ga0268264_10164402	3300028381	Unclassified	2002
300	Ga0265336_10142818	3300028666	Bacteria	712
301	Ga0265338_10005376	3300028800	Bacteria	16738
302	Ga0265338_10007981	3300028800	Bacteria	12957
303	Ga0265338_10044756	3300028800	Bacteria	4080
304	Ga0265338_10156884	3300028800	Unclassified	1762
305	Ga0265338_10375831	3300028800	Bacteria	1017
306	Ga0265338_10381109	3300028800	Unclassified	1008
307	Ga0265760_10000582	3300031090	Bacteria	10360
308	Ga0265328_10093485	3300031239	Unclassified	1111
309	Ga0265325_10013227	3300031241	Bacteria	4703
310	Ga0265325_10216704	3300031241	Unclassified	877
311	Ga0265339_10042361	3300031249	Bacteria	2521
312	Ga0265339_10075639	3300031249	Bacteria	1787
313	Ga0265327_10162595	3300031251	Bacteria	1030
314	Ga0265316_10022177	3300031344	Bacteria	5362
315	Ga0265316_10038756	3300031344	Bacteria	3835
316	Ga0265313_10031807	3300031595	Bacteria	2702
317	Ga0265314_10005392	3300031711	Bacteria	11559
318	Ga0265314_10069139	3300031711	Bacteria	2371
319	Ga0265314_10129519	3300031711	Bacteria	1576
320	Ga0265314_10156757	3300031711	Bacteria	1390
321	Ga0307410_10138314	3300031852	Unclassified	1798
322	Ga0307410_10168867	3300031852	Bacteria	1646
323	Ga0307409_100015418	3300031995	Bacteria	5017
324	Ga0307409_100114160	3300031995	Bacteria	2272
325	Ga0307409_100804085	3300031995	Unclassified	948
326	Ga0307416_101560658	3300032002	Unclassified	766
327	Ga0373926_0035937	3300035083	Bacteria	1759
328	Ga0373926_0038890	3300035083	Bacteria	1695
329	Ga0373934_0016766	3300035086	Bacteria	2788
330	Ga0373923_0003346	3300035111	Bacteria	5124
331	Ga0373923_0141963	3300035111	Unclassified	1086
332	Ga0373923_0147946	3300035111	Bacteria	1065
333	Ga0373936_0022356	3300035113	Bacteria	2462
334	Ga0373936_0034995	3300035113	Bacteria	1998
335	Ga0373945_0002730	3300035116	Bacteria	5542
336	Ga0373954_0192556	3300035118	Bacteria	1001
337	Ga0373943_0001484	3300035170	Bacteria	10628
338	Ga0373943_0094508	3300035170	Bacteria	1554
339	Ga0373943_0184536	3300035170	Bacteria	1148
340	Ga0373943_0269158	3300035170	Unclassified	961
341	Ga0373955_0069027	3300035172	Bacteria	1971
342	Ga0373955_0073940	3300035172	Bacteria	1911
343	Ga0373955_0131681	3300035172	Bacteria	1460
344	Ga0373955_0484267	3300035172	Unclassified	755
345	Ga0373924_0116894	3300035410	Unclassified	1156
346	Ga0373924_0328462	3300035410	Unclassified	681
347	Ga0373935_0013771	3300035692	Bacteria	4884
348	Ga0373935_0024666	3300035692	Bacteria	3703
349	Ga0373935_0426094	3300035692	Unclassified	956
350	Ga0373935_0584808	3300035692	Unclassified	816
351	Ga0373935_0757394	3300035692	Unclassified	716
352	Ga0373927_0000016	3300035695	Bacteria	154151
353	Ga0373933_0007417	3300035724	Bacteria	5982
354	Ga0373933_0022212	3300035724	Bacteria	3611
355	Ga0373933_0044419	3300035724	Bacteria	2632
356	Ga0373933_0134238	3300035724	Bacteria	1558
357	Ga0373947_0000154	3300035725	Bacteria	36195
358	Ga0373947_0189308	3300035725	Bacteria	1342
359	Ga0373947_0195140	3300035725	Bacteria	1322
360	Ga0373947_0241610	3300035725	Bacteria	1192
361	Ga0373937_0003309	3300036401	Bacteria	13536
362	Ga0373937_0178760	3300036401	Bacteria	1992
363	Ga0373937_0809061	3300036401	Bacteria	885
364	Ga0373925_0023299	3300037068	Bacteria	4518
365	Ga0373925_0425777	3300037068	Bacteria	1085
366	Ga0373925_0585520	3300037068	Unclassified	918
367	Ga0436360_0045224	3300039438	Unclassified	733
368	Ga0436362_0664754	3300039453	Unclassified	596
369	Ga0451839_0003877	3300041496	Bacteria	594
370	Ga0451577_0445601	3300042876	Bacteria	1176
371	Ga0451577_1289203	3300042876	Unclassified	650
372	Ga0453683_0732660	3300044673	Unclassified	649
373	Ga0466963_0427932	3300044694	Bacteria	933
374	Ga0453684_0188194	3300044712	Bacteria	2417
375	Ga0453684_1141461	3300044712	Unclassified	821
376	Ga0466968_0211793	3300044735	Bacteria	911
377	Ga0451576_0034165	3300045051	Bacteria	5401
378	Ga0451576_0571072	3300045051	Unclassified	1188
379	Ga0451576_1063944	3300045051	Unclassified	847
380	Ga0466967_0030433	3300045976	Bacteria	4530
381	Ga0466967_0510544	3300045976	Bacteria	1180
382	Ga0466967_0846582	3300045976	Unclassified	909
383	Ga0495629_0013591	3300046459	Bacteria	5874
384	Ga0495651_0241480	3300046462	Unclassified	1239
385	Ga0495580_0000243	3300046472	Bacteria	43209
386	Ga0495580_0004718	3300046472	Bacteria	11424
387	Ga0495580_0072028	3300046472	Bacteria	2414
388	Ga0495580_0288477	3300046472	Unclassified	1119
389	Ga0495580_0371675	3300046472	Bacteria	967
390	Ga0495580_0429789	3300046472	Unclassified	888
391	Ga0495580_0573834	3300046472	Unclassified	747
392	Ga0495582_0040561	3300046473	Bacteria	2564
393	Ga0495584_0111842	3300046491	Unclassified	1382
394	Ga0495594_0361969	3300046499	Unclassified	826
395	Ga0495630_0016908	3300046517	Bacteria	5338
396	Ga0495630_0518746	3300046517	Unclassified	914
397	Ga0495666_0101179	3300046526	Unclassified	1358
398	Ga0495665_0078001	3300046531	Bacteria	1743
399	Ga0495665_0157133	3300046531	Bacteria	1186
400	Ga0495658_0078865	3300046683	Bacteria	1928
401	Ga0495669_0009246	3300046684	Bacteria	4153
402	Ga0495669_0198032	3300046684	Bacteria	960
403	Ga0495613_0383975	3300046689	Unclassified	960
404	Ga0495674_0029805	3300047319	Bacteria	4965
405	Ga0495674_0032544	3300047319	Bacteria	4729
406	Ga0495674_0241027	3300047319	Bacteria	1490
407	Ga0495674_0911333	3300047319	Bacteria	678
408	Ga0495602_1130466	3300048088	Unclassified	512
409	Ga0496101_0143466	3300048904	Bacteria	1822
410	Ga0496101_0632714	3300048904	Bacteria	846
411	Ga0496102_0302464	3300048905	Bacteria	1508
412	Ga0496102_0514763	3300048905	Unclassified	1119
413	Ga0496103_0019225	3300048906	Bacteria	4102
414	Ga0496103_0217162	3300048906	Bacteria	1230
415	Ga0496104_0053923	3300048907	Bacteria	3800
416	Ga0496104_0329983	3300048907	Bacteria	1439
417	Ga0496105_0032445	3300048908	Bacteria	4286
418	Ga0496105_0125545	3300048908	Bacteria	2115
419	Ga0496107_0161482	3300048910	Bacteria	1661
420	Ga0496107_0194777	3300048910	Bacteria	1506
421	Ga0496108_0000119	3300048911	Bacteria	77850
422	Ga0496109_0000020	3300048912	Bacteria	189962
423	Ga0496109_0012174	3300048912	Bacteria	7421
424	Ga0496109_0049380	3300048912	Bacteria	3830
425	Ga0496109_1852289	3300048912	Unclassified	536
426	Ga0496110_0015709	3300048913	Bacteria	6307
427	Ga0496110_0078237	3300048913	Unclassified	2944
428	Ga0496111_0005944	3300048914	Bacteria	7872
429	Ga0496111_0017341	3300048914	Bacteria	4978
430	Ga0496111_0662614	3300048914	Bacteria	761
431	Ga0496112_0000490	3300048915	Bacteria	26576
432	Ga0496112_0029257	3300048915	Bacteria	5326
433	Ga0496112_0188378	3300048915	Bacteria	2026
434	Ga0496112_0223933	3300048915	Bacteria	1836
435	Ga0496112_0562233	3300048915	Unclassified	1074
436	Ga0496112_0612753	3300048915	Bacteria	1020
437	Ga0496112_0625739	3300048915	Unclassified	1007
438	Ga0496113_0030923	3300048916	Bacteria	3881
439	Ga0496115_0021346	3300048918	Bacteria	5002
440	Ga0501297_020730	3300049520	Unclassified	821
441	Ga0501067_0320594	3300049583	Unclassified	863
442	Ga0501073_0000938	3300049589	Bacteria	20944
443	Ga0501080_0262336	3300049742	Bacteria	1574
444	Ga0495601_0318333	3300053077	Bacteria	1013
445	Ga0495619_0243474	3300053085	Bacteria	1246
446	Ga0495619_0287147	3300053085	Bacteria	1140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025921	Ga0207652_10564649	Ga0207652_105646491	151
2	3300048088	Ga0495602_1130466	Ga0495602_1130466_18_473	151
3	3300035170	Ga0373943_0269158	Ga0373943_0269158_19_489	152
4	3300048912	Ga0496109_1852289	Ga0496109_1852289_26_511	161
5	3300005435	Ga0070714_101492184	Ga0070714_1014921841	175
6	3300035692	Ga0373935_0426094	Ga0373935_0426094_225_752	175
7	3300035725	Ga0373947_0189308	Ga0373947_0189308_700_1227	175
8	3300037068	Ga0373925_0425777	Ga0373925_0425777_232_759	175
9	3300046472	Ga0495580_0004718	Ga0495580_0004718_10823_11350	175
10	3300046491	Ga0495584_0111842	Ga0495584_0111842_49_576	175
11	3300046526	Ga0495666_0101179	Ga0495666_0101179_248_775	175
12	3300005439	Ga0070711_100067912	Ga0070711_1000679123	176
13	3300025916	Ga0207663_10057661	Ga0207663_100576612	176
14	3300031251	Ga0265327_10162595	Ga0265327_101625952	176
15	3300031595	Ga0265313_10031807	Ga0265313_100318073	176
16	3300039453	Ga0436362_0664754	Ga0436362_0664754_10_540	176
17	3300005290	Ga0065712_10383564	Ga0065712_103835641	177
18	3300005293	Ga0065715_10383203	Ga0065715_103832032	177
19	3300005331	Ga0070670_100363113	Ga0070670_1003631132	177
20	3300005338	Ga0068868_100028678	Ga0068868_1000286782	177
21	3300005338	Ga0068868_100130258	Ga0068868_1001302582	177
22	3300005339	Ga0070660_100031857	Ga0070660_1000318572	177
23	3300005355	Ga0070671_100433328	Ga0070671_1004333282	177
24	3300005366	Ga0070659_100038103	Ga0070659_1000381032	177
25	3300005434	Ga0070709_10050587	Ga0070709_100505873	177
26	3300005437	Ga0070710_10020932	Ga0070710_100209323	177
27	3300005444	Ga0070694_100772777	Ga0070694_1007727771	177
28	3300005445	Ga0070708_100097568	Ga0070708_1000975682	177
29	3300005455	Ga0070663_100193688	Ga0070663_1001936881	177
30	3300005457	Ga0070662_100036149	Ga0070662_1000361493	177
31	3300005468	Ga0070707_100284494	Ga0070707_1002844942	177
32	3300005530	Ga0070679_100107120	Ga0070679_1001071203	177
33	3300005543	Ga0070672_101525415	Ga0070672_1015254151	177
34	3300005547	Ga0070693_100026965	Ga0070693_1000269653	177
35	3300005564	Ga0070664_100010359	Ga0070664_1000103599	177
36	3300005577	Ga0068857_100153153	Ga0068857_1001531533	177
37	3300005578	Ga0068854_100008487	Ga0068854_1000084874	177
38	3300005614	Ga0068856_100045661	Ga0068856_1000456611	177
39	3300005616	Ga0068852_100568805	Ga0068852_1005688052	177
40	3300005618	Ga0068864_100712711	Ga0068864_1007127112	177
41	3300005834	Ga0068851_10016063	Ga0068851_100160633	177
42	3300005843	Ga0068860_100231674	Ga0068860_1002316744	177
43	3300005844	Ga0068862_100691424	Ga0068862_1006914242	177
44	3300006028	Ga0070717_11461280	Ga0070717_114612801	177
45	3300006173	Ga0070716_100126244	Ga0070716_1001262442	177
46	3300006237	Ga0097621_100905651	Ga0097621_1009056512	177
47	3300006358	Ga0068871_100217518	Ga0068871_1002175182	177
48	3300009092	Ga0105250_10087702	Ga0105250_100877022	177
49	3300009093	Ga0105240_10024763	Ga0105240_100247632	177
50	3300009174	Ga0105241_10006198	Ga0105241_100061982	177
51	3300009177	Ga0105248_10816343	Ga0105248_108163431	177
52	3300009553	Ga0105249_10125764	Ga0105249_101257642	177
53	3300013100	Ga0157373_10025035	Ga0157373_100250352	177
54	3300013105	Ga0157369_10031061	Ga0157369_100310612	177
55	3300013296	Ga0157374_10022579	Ga0157374_100225795	177
56	3300013296	Ga0157374_10584604	Ga0157374_105846042	177
57	3300014325	Ga0163163_10222922	Ga0163163_102229222	177
58	3300014325	Ga0163163_10286594	Ga0163163_102865942	177
59	3300014497	Ga0182008_10022217	Ga0182008_100222173	177
60	3300025321	Ga0207656_10104487	Ga0207656_101044872	177
61	3300025898	Ga0207692_10020798	Ga0207692_100207983	177
62	3300025906	Ga0207699_10008682	Ga0207699_100086823	177
63	3300025906	Ga0207699_10225208	Ga0207699_102252082	177
64	3300025911	Ga0207654_10008437	Ga0207654_100084373	177
65	3300025919	Ga0207657_10000404	Ga0207657_1000040418	177
66	3300025922	Ga0207646_10938893	Ga0207646_109388931	177
67	3300025925	Ga0207650_10329791	Ga0207650_103297912	177
68	3300025925	Ga0207650_10331848	Ga0207650_103318481	177
69	3300025928	Ga0207700_11505484	Ga0207700_115054841	177
70	3300025932	Ga0207690_10017756	Ga0207690_100177561	177
71	3300025933	Ga0207706_10078195	Ga0207706_100781953	177
72	3300025961	Ga0207712_10608712	Ga0207712_106087121	177
73	3300025981	Ga0207640_10017402	Ga0207640_100174022	177
74	3300025986	Ga0207658_10732286	Ga0207658_107322862	177
75	3300026023	Ga0207677_10083624	Ga0207677_100836242	177
76	3300026023	Ga0207677_10379780	Ga0207677_103797801	177
77	3300026041	Ga0207639_10042754	Ga0207639_100427543	177
78	3300026067	Ga0207678_10415993	Ga0207678_104159932	177
79	3300026078	Ga0207702_10049945	Ga0207702_100499453	177
80	3300026088	Ga0207641_10022260	Ga0207641_100222602	177
81	3300026088	Ga0207641_10106566	Ga0207641_101065662	177
82	3300026116	Ga0207674_10112609	Ga0207674_101126092	177
83	3300028381	Ga0268264_10090242	Ga0268264_100902422	177
84	3300028800	Ga0265338_10007981	Ga0265338_100079812	177
85	3300031239	Ga0265328_10093485	Ga0265328_100934851	177
86	3300031344	Ga0265316_10038756	Ga0265316_100387562	177
87	3300031711	Ga0265314_10156757	Ga0265314_101567572	177
88	3300035111	Ga0373923_0147946	Ga0373923_0147946_457_990	177
89	3300039438	Ga0436360_0045224	Ga0436360_0045224_90_623	177
90	3300042876	Ga0451577_1289203	Ga0451577_1289203_93_626	177
91	3300044712	Ga0453684_0188194	Ga0453684_0188194_43_588	177
92	3300044712	Ga0453684_1141461	Ga0453684_1141461_157_690	177
93	3300045051	Ga0451576_0034165	Ga0451576_0034165_307_852	177
94	3300045051	Ga0451576_1063944	Ga0451576_1063944_228_761	177
95	3300046472	Ga0495580_0573834	Ga0495580_0573834_196_729	177
96	3300048904	Ga0496101_0143466	Ga0496101_0143466_584_1117	177
97	3300048905	Ga0496102_0302464	Ga0496102_0302464_150_683	177
98	3300048906	Ga0496103_0019225	Ga0496103_0019225_2673_3206	177
99	3300048906	Ga0496103_0217162	Ga0496103_0217162_17_550	177
100	3300048908	Ga0496105_0032445	Ga0496105_0032445_3363_3896	177
101	3300048910	Ga0496107_0194777	Ga0496107_0194777_628_1161	177
102	3300048912	Ga0496109_0049380	Ga0496109_0049380_398_931	177
103	3300048913	Ga0496110_0015709	Ga0496110_0015709_3429_3962	177
104	3300048914	Ga0496111_0017341	Ga0496111_0017341_732_1265	177
105	3300048915	Ga0496112_0223933	Ga0496112_0223933_1256_1789	177
106	3300048915	Ga0496112_0562233	Ga0496112_0562233_274_807	177
107	3300048915	Ga0496112_0625739	Ga0496112_0625739_158_691	177
108	3300005334	Ga0068869_100312501	Ga0068869_1003125012	178
109	3300005338	Ga0068868_100160007	Ga0068868_1001600071	178
110	3300005339	Ga0070660_100157937	Ga0070660_1001579372	178
111	3300005354	Ga0070675_100279395	Ga0070675_1002793952	178
112	3300005355	Ga0070671_100607227	Ga0070671_1006072271	178
113	3300005434	Ga0070709_10253273	Ga0070709_102532731	178
114	3300005456	Ga0070678_100231647	Ga0070678_1002316473	178
115	3300005458	Ga0070681_10148926	Ga0070681_101489262	178
116	3300005458	Ga0070681_10688129	Ga0070681_106881292	178
117	3300005535	Ga0070684_100284314	Ga0070684_1002843142	178
118	3300005547	Ga0070693_100109246	Ga0070693_1001092462	178
119	3300005563	Ga0068855_100077109	Ga0068855_1000771093	178
120	3300005577	Ga0068857_100010855	Ga0068857_1000108552	178
121	3300005618	Ga0068864_100038185	Ga0068864_1000381853	178
122	3300005841	Ga0068863_100047499	Ga0068863_1000474993	178
123	3300005841	Ga0068863_100446367	Ga0068863_1004463672	178
124	3300006237	Ga0097621_100468287	Ga0097621_1004682873	178
125	3300009174	Ga0105241_10074474	Ga0105241_100744743	178
126	3300009174	Ga0105241_10160840	Ga0105241_101608402	178
127	3300009177	Ga0105248_10080585	Ga0105248_100805852	178
128	3300009177	Ga0105248_11091871	Ga0105248_110918712	178
129	3300010375	Ga0105239_10378493	Ga0105239_103784931	178
130	3300013296	Ga0157374_10202122	Ga0157374_102021222	178
131	3300014325	Ga0163163_10029419	Ga0163163_100294193	178
132	3300014325	Ga0163163_10073991	Ga0163163_100739913	178
133	3300025906	Ga0207699_10321796	Ga0207699_103217962	178
134	3300025911	Ga0207654_10051806	Ga0207654_100518061	178
135	3300025911	Ga0207654_10207600	Ga0207654_102076003	178
136	3300025912	Ga0207707_10227573	Ga0207707_102275732	178
137	3300025919	Ga0207657_10299206	Ga0207657_102992062	178
138	3300025931	Ga0207644_10674493	Ga0207644_106744931	178
139	3300025949	Ga0207667_10237004	Ga0207667_102370042	178
140	3300026088	Ga0207641_10072423	Ga0207641_100724232	178
141	3300026095	Ga0207676_10058035	Ga0207676_100580353	178
142	3300026116	Ga0207674_10007195	Ga0207674_100071957	178
143	3300026121	Ga0207683_10135772	Ga0207683_101357722	178
144	3300031852	Ga0307410_10138314	Ga0307410_101383142	178
145	3300031852	Ga0307410_10168867	Ga0307410_101688672	178
146	3300031995	Ga0307409_100015418	Ga0307409_1000154182	178
147	3300031995	Ga0307409_100114160	Ga0307409_1001141602	178
148	3300031995	Ga0307409_100804085	Ga0307409_1008040852	178
149	3300032002	Ga0307416_101560658	Ga0307416_1015606582	178
150	3300035172	Ga0373955_0131681	Ga0373955_0131681_527_1063	178
151	3300035410	Ga0373924_0328462	Ga0373924_0328462_33_569	178
152	3300035692	Ga0373935_0757394	Ga0373935_0757394_28_564	178
153	3300042876	Ga0451577_0445601	Ga0451577_0445601_310_846	178
154	3300045051	Ga0451576_0571072	Ga0451576_0571072_154_690	178
155	3300045976	Ga0466967_0846582	Ga0466967_0846582_310_846	178
156	3300046472	Ga0495580_0072028	Ga0495580_0072028_1761_2297	178
157	3300046499	Ga0495594_0361969	Ga0495594_0361969_171_707	178
158	3300046684	Ga0495669_0009246	Ga0495669_0009246_1049_1585	178
159	3300047319	Ga0495674_0911333	Ga0495674_0911333_48_584	178
160	3300048904	Ga0496101_0632714	Ga0496101_0632714_40_576	178
161	3300048907	Ga0496104_0329983	Ga0496104_0329983_768_1304	178
162	3300048912	Ga0496109_0012174	Ga0496109_0012174_2692_3228	178
163	3300048914	Ga0496111_0662614	Ga0496111_0662614_161_697	178
164	3300048915	Ga0496112_0029257	Ga0496112_0029257_2888_3424	178
165	3300048915	Ga0496112_0188378	Ga0496112_0188378_142_678	178
166	3300049520	Ga0501297_020730	Ga0501297_020730_187_723	178
167	3300053085	Ga0495619_0243474	Ga0495619_0243474_561_1097	178
168	3300005434	Ga0070709_10096616	Ga0070709_100966162	179
169	3300005435	Ga0070714_100000101	Ga0070714_1000001017	179
170	3300005435	Ga0070714_100001746	Ga0070714_10000174611	179
171	3300005435	Ga0070714_100113440	Ga0070714_1001134403	179
172	3300005436	Ga0070713_100000675	Ga0070713_1000006753	179
173	3300005436	Ga0070713_100003078	Ga0070713_10000307812	179
174	3300005437	Ga0070710_10010586	Ga0070710_100105862	179
175	3300005437	Ga0070710_10154923	Ga0070710_101549232	179
176	3300005439	Ga0070711_100000076	Ga0070711_10000007634	179
177	3300005439	Ga0070711_100013225	Ga0070711_1000132252	179
178	3300005439	Ga0070711_100024970	Ga0070711_1000249703	179
179	3300006028	Ga0070717_10013204	Ga0070717_100132041	179
180	3300006028	Ga0070717_10029343	Ga0070717_100293434	179
181	3300006163	Ga0070715_10003961	Ga0070715_100039614	179
182	3300006163	Ga0070715_10017865	Ga0070715_100178652	179
183	3300006175	Ga0070712_100000105	Ga0070712_10000010511	179
184	3300006175	Ga0070712_100000506	Ga0070712_10000050615	179
185	3300006175	Ga0070712_101351303	Ga0070712_1013513031	179
186	3300025898	Ga0207692_10013400	Ga0207692_100134002	179
187	3300025898	Ga0207692_10068348	Ga0207692_100683482	179
188	3300025905	Ga0207685_10009485	Ga0207685_100094853	179
189	3300025906	Ga0207699_10003382	Ga0207699_100033824	179
190	3300025906	Ga0207699_10019119	Ga0207699_100191193	179
191	3300025915	Ga0207693_10000016	Ga0207693_1000001692	179
192	3300025915	Ga0207693_10000065	Ga0207693_1000006554	179
193	3300025915	Ga0207693_10050443	Ga0207693_100504431	179
194	3300025916	Ga0207663_10001491	Ga0207663_100014915	179
195	3300025916	Ga0207663_10041900	Ga0207663_100419003	179
196	3300025928	Ga0207700_10000132	Ga0207700_1000013226	179
197	3300025928	Ga0207700_10000988	Ga0207700_1000098810	179
198	3300025928	Ga0207700_10094351	Ga0207700_100943513	179
199	3300025929	Ga0207664_10000111	Ga0207664_1000011155	179
200	3300025929	Ga0207664_10012656	Ga0207664_100126564	179
201	3300025929	Ga0207664_10314419	Ga0207664_103144192	179
202	3300025939	Ga0207665_10017293	Ga0207665_100172933	179
203	3300028666	Ga0265336_10142818	Ga0265336_101428181	179
204	3300028800	Ga0265338_10005376	Ga0265338_100053762	179
205	3300028800	Ga0265338_10044756	Ga0265338_100447562	179
206	3300028800	Ga0265338_10156884	Ga0265338_101568841	179
207	3300028800	Ga0265338_10375831	Ga0265338_103758312	179
208	3300028800	Ga0265338_10381109	Ga0265338_103811092	179
209	3300031090	Ga0265760_10000582	Ga0265760_100005829	179
210	3300031241	Ga0265325_10013227	Ga0265325_100132271	179
211	3300031241	Ga0265325_10216704	Ga0265325_102167042	179
212	3300031249	Ga0265339_10042361	Ga0265339_100423612	179
213	3300031344	Ga0265316_10022177	Ga0265316_100221775	179
214	3300035083	Ga0373926_0035937	Ga0373926_0035937_36_587	179
215	3300035083	Ga0373926_0038890	Ga0373926_0038890_1072_1617	179
216	3300035086	Ga0373934_0016766	Ga0373934_0016766_1626_2171	179
217	3300035111	Ga0373923_0003346	Ga0373923_0003346_885_1430	179
218	3300035111	Ga0373923_0141963	Ga0373923_0141963_296_847	179
219	3300035113	Ga0373936_0022356	Ga0373936_0022356_1456_2007	179
220	3300035113	Ga0373936_0034995	Ga0373936_0034995_927_1472	179
221	3300035116	Ga0373945_0002730	Ga0373945_0002730_1106_1651	179
222	3300035118	Ga0373954_0192556	Ga0373954_0192556_246_791	179
223	3300035170	Ga0373943_0001484	Ga0373943_0001484_4346_4891	179
224	3300035170	Ga0373943_0184536	Ga0373943_0184536_355_906	179
225	3300035172	Ga0373955_0069027	Ga0373955_0069027_837_1388	179
226	3300035172	Ga0373955_0073940	Ga0373955_0073940_876_1421	179
227	3300035172	Ga0373955_0484267	Ga0373955_0484267_57_596	179
228	3300035692	Ga0373935_0013771	Ga0373935_0013771_1027_1572	179
229	3300035692	Ga0373935_0024666	Ga0373935_0024666_2642_3193	179
230	3300035692	Ga0373935_0584808	Ga0373935_0584808_47_598	179
231	3300035695	Ga0373927_0000016	Ga0373927_0000016_65848_66393	179
232	3300035724	Ga0373933_0007417	Ga0373933_0007417_1293_1844	179
233	3300035724	Ga0373933_0022212	Ga0373933_0022212_2847_3425	179
234	3300035724	Ga0373933_0044419	Ga0373933_0044419_1060_1605	179
235	3300035724	Ga0373933_0134238	Ga0373933_0134238_326_871	179
236	3300035725	Ga0373947_0000154	Ga0373947_0000154_14723_15268	179
237	3300035725	Ga0373947_0195140	Ga0373947_0195140_163_714	179
238	3300035725	Ga0373947_0241610	Ga0373947_0241610_207_752	179
239	3300036401	Ga0373937_0003309	Ga0373937_0003309_8177_8728	179
240	3300036401	Ga0373937_0178760	Ga0373937_0178760_397_942	179
241	3300036401	Ga0373937_0809061	Ga0373937_0809061_261_806	179
242	3300037068	Ga0373925_0023299	Ga0373925_0023299_518_1069	179
243	3300037068	Ga0373925_0585520	Ga0373925_0585520_70_615	179
244	3300044694	Ga0466963_0427932	Ga0466963_0427932_373_915	179
245	3300044735	Ga0466968_0211793	Ga0466968_0211793_139_681	179
246	3300045976	Ga0466967_0030433	Ga0466967_0030433_3679_4221	179
247	3300045976	Ga0466967_0510544	Ga0466967_0510544_261_803	179
248	3300046459	Ga0495629_0013591	Ga0495629_0013591_4539_5090	179
249	3300046462	Ga0495651_0241480	Ga0495651_0241480_388_933	179
250	3300046472	Ga0495580_0000243	Ga0495580_0000243_21637_22188	179
251	3300046472	Ga0495580_0371675	Ga0495580_0371675_21_566	179
252	3300046472	Ga0495580_0429789	Ga0495580_0429789_207_758	179
253	3300046473	Ga0495582_0040561	Ga0495582_0040561_1149_1700	179
254	3300046517	Ga0495630_0016908	Ga0495630_0016908_2346_2897	179
255	3300046531	Ga0495665_0078001	Ga0495665_0078001_615_1154	179
256	3300046531	Ga0495665_0157133	Ga0495665_0157133_529_1080	179
257	3300046683	Ga0495658_0078865	Ga0495658_0078865_1190_1741	179
258	3300046689	Ga0495613_0383975	Ga0495613_0383975_300_851	179
259	3300047319	Ga0495674_0029805	Ga0495674_0029805_308_853	179
260	3300047319	Ga0495674_0032544	Ga0495674_0032544_1562_2113	179
261	3300047319	Ga0495674_0241027	Ga0495674_0241027_536_1075	179
262	3300048907	Ga0496104_0053923	Ga0496104_0053923_1339_1890	179
263	3300048908	Ga0496105_0125545	Ga0496105_0125545_919_1470	179
264	3300048918	Ga0496115_0021346	Ga0496115_0021346_2823_3374	179
265	3300049583	Ga0501067_0320594	Ga0501067_0320594_226_765	179
266	3300049589	Ga0501073_0000938	Ga0501073_0000938_804_1349	179
267	3300049742	Ga0501080_0262336	Ga0501080_0262336_586_1131	179
268	3300053077	Ga0495601_0318333	Ga0495601_0318333_424_975	179
269	3300005329	Ga0070683_101214890	Ga0070683_1012148902	180
270	3300005458	Ga0070681_10060099	Ga0070681_100600993	180
271	3300005530	Ga0070679_100021973	Ga0070679_1000219732	180
272	3300009093	Ga0105240_10049282	Ga0105240_100492823	180
273	3300009174	Ga0105241_10275236	Ga0105241_102752362	180
274	3300009174	Ga0105241_10631344	Ga0105241_106313441	180
275	3300009551	Ga0105238_10696608	Ga0105238_106966082	180
276	3300013100	Ga0157373_10125013	Ga0157373_101250132	180
277	3300013307	Ga0157372_10114715	Ga0157372_101147152	180
278	3300025912	Ga0207707_10117743	Ga0207707_101177433	180
279	3300025913	Ga0207695_10077432	Ga0207695_100774323	180
280	3300025921	Ga0207652_10168731	Ga0207652_101687312	180
281	3300025929	Ga0207664_10655698	Ga0207664_106556982	180
282	3300025929	Ga0207664_10994533	Ga0207664_109945332	180
283	3300025939	Ga0207665_10090926	Ga0207665_100909262	180
284	3300025944	Ga0207661_10441041	Ga0207661_104410412	180
285	3300025949	Ga0207667_10358771	Ga0207667_103587711	180
286	3300035170	Ga0373943_0094508	Ga0373943_0094508_686_1228	180
287	3300035410	Ga0373924_0116894	Ga0373924_0116894_403_945	180
288	3300041496	Ga0451839_0003877	Ga0451839_0003877_29_571	180
289	3300046517	Ga0495630_0518746	Ga0495630_0518746_144_686	180
290	3300048915	Ga0496112_0612753	Ga0496112_0612753_31_573	180
291	3300053085	Ga0495619_0287147	Ga0495619_0287147_29_571	180
292	3300001976	JGI24752J21851_1006134	JGI24752J21851_10061342	181
293	3300001990	JGI24737J22298_10096936	JGI24737J22298_100969362	181
294	3300001991	JGI24743J22301_10032784	JGI24743J22301_100327842	181
295	3300002074	JGI24748J21848_1006896	JGI24748J21848_10068962	181
296	3300002239	JGI24034J26672_10002281	JGI24034J26672_100022813	181
297	3300002459	JGI24751J29686_10001601	JGI24751J29686_100016013	181
298	3300005293	Ga0065715_10328902	Ga0065715_103289022	181
299	3300005327	Ga0070658_10087249	Ga0070658_100872492	181
300	3300005329	Ga0070683_100017661	Ga0070683_1000176616	181
301	3300005331	Ga0070670_100493305	Ga0070670_1004933051	181
302	3300005334	Ga0068869_100049535	Ga0068869_1000495352	181
303	3300005335	Ga0070666_10216035	Ga0070666_102160351	181
304	3300005337	Ga0070682_100072540	Ga0070682_1000725402	181
305	3300005338	Ga0068868_100003132	Ga0068868_1000031323	181
306	3300005339	Ga0070660_100155154	Ga0070660_1001551542	181
307	3300005340	Ga0070689_100013238	Ga0070689_1000132383	181
308	3300005343	Ga0070687_100006689	Ga0070687_1000066895	181
309	3300005344	Ga0070661_100010692	Ga0070661_1000106924	181
310	3300005345	Ga0070692_10287414	Ga0070692_102874142	181
311	3300005347	Ga0070668_100875779	Ga0070668_1008757791	181
312	3300005353	Ga0070669_100008760	Ga0070669_1000087605	181
313	3300005354	Ga0070675_100010707	Ga0070675_1000107073	181
314	3300005355	Ga0070671_100746470	Ga0070671_1007464701	181
315	3300005356	Ga0070674_100814351	Ga0070674_1008143512	181
316	3300005364	Ga0070673_100018214	Ga0070673_1000182143	181
317	3300005365	Ga0070688_100012217	Ga0070688_1000122172	181
318	3300005366	Ga0070659_100269104	Ga0070659_1002691042	181
319	3300005436	Ga0070713_100095360	Ga0070713_1000953602	181
320	3300005436	Ga0070713_100225307	Ga0070713_1002253072	181
321	3300005441	Ga0070700_100219078	Ga0070700_1002190782	181
322	3300005445	Ga0070708_100488108	Ga0070708_1004881081	181
323	3300005457	Ga0070662_100009605	Ga0070662_1000096053	181
324	3300005459	Ga0068867_100008660	Ga0068867_1000086602	181
325	3300005466	Ga0070685_10004250	Ga0070685_100042504	181
326	3300005468	Ga0070707_100035240	Ga0070707_1000352405	181
327	3300005471	Ga0070698_101125257	Ga0070698_1011252572	181
328	3300005535	Ga0070684_100000472	Ga0070684_1000004722	181
329	3300005539	Ga0068853_100017617	Ga0068853_1000176174	181
330	3300005543	Ga0070672_100001294	Ga0070672_10000129416	181
331	3300005544	Ga0070686_100002087	Ga0070686_1000020877	181
332	3300005563	Ga0068855_100003807	Ga0068855_10000380715	181
333	3300005564	Ga0070664_100080129	Ga0070664_1000801292	181
334	3300005577	Ga0068857_100049542	Ga0068857_1000495424	181
335	3300005614	Ga0068856_100004472	Ga0068856_1000044725	181
336	3300005614	Ga0068856_100074256	Ga0068856_1000742562	181
337	3300005615	Ga0070702_100058301	Ga0070702_1000583012	181
338	3300005616	Ga0068852_100003760	Ga0068852_1000037608	181
339	3300005617	Ga0068859_100249758	Ga0068859_1002497582	181
340	3300005618	Ga0068864_100017143	Ga0068864_1000171434	181
341	3300005718	Ga0068866_10000493	Ga0068866_1000049310	181
342	3300005719	Ga0068861_100188243	Ga0068861_1001882432	181
343	3300005834	Ga0068851_10012281	Ga0068851_100122814	181
344	3300005840	Ga0068870_10003777	Ga0068870_100037776	181
345	3300005841	Ga0068863_100265176	Ga0068863_1002651762	181
346	3300005842	Ga0068858_100025230	Ga0068858_1000252303	181
347	3300005844	Ga0068862_100012739	Ga0068862_1000127396	181
348	3300006237	Ga0097621_100073008	Ga0097621_1000730082	181
349	3300006358	Ga0068871_100255497	Ga0068871_1002554972	181
350	3300006881	Ga0068865_100024696	Ga0068865_1000246962	181
351	3300006931	Ga0097620_100249750	Ga0097620_1002497502	181
352	3300009011	Ga0105251_10140365	Ga0105251_101403651	181
353	3300009092	Ga0105250_10039110	Ga0105250_100391101	181
354	3300009098	Ga0105245_10023261	Ga0105245_100232614	181
355	3300009174	Ga0105241_10071223	Ga0105241_100712233	181
356	3300009176	Ga0105242_10058840	Ga0105242_100588403	181
357	3300009177	Ga0105248_10033302	Ga0105248_100333022	181
358	3300009545	Ga0105237_10045001	Ga0105237_100450011	181
359	3300009551	Ga0105238_10289876	Ga0105238_102898762	181
360	3300009553	Ga0105249_10026889	Ga0105249_100268892	181
361	3300010375	Ga0105239_10079328	Ga0105239_100793282	181
362	3300010375	Ga0105239_11528751	Ga0105239_115287512	181
363	3300011119	Ga0105246_10000935	Ga0105246_100009353	181
364	3300013100	Ga0157373_10029545	Ga0157373_100295453	181
365	3300013102	Ga0157371_10013625	Ga0157371_100136254	181
366	3300013105	Ga0157369_10055261	Ga0157369_100552613	181
367	3300013296	Ga0157374_10111825	Ga0157374_101118252	181
368	3300013296	Ga0157374_10252586	Ga0157374_102525862	181
369	3300013297	Ga0157378_10607820	Ga0157378_106078201	181
370	3300013306	Ga0163162_10078233	Ga0163162_100782332	181
371	3300013307	Ga0157372_10039871	Ga0157372_100398714	181
372	3300013308	Ga0157375_10185469	Ga0157375_101854692	181
373	3300014325	Ga0163163_10001888	Ga0163163_1000188817	181
374	3300014326	Ga0157380_10045649	Ga0157380_100456493	181
375	3300014745	Ga0157377_10012137	Ga0157377_100121374	181
376	3300014968	Ga0157379_10082119	Ga0157379_100821192	181
377	3300014969	Ga0157376_10143127	Ga0157376_101431272	181
378	3300015265	Ga0182005_1023414	Ga0182005_10234142	181
379	3300017792	Ga0163161_10001198	Ga0163161_1000119819	181
380	3300025315	Ga0207697_10006536	Ga0207697_100065363	181
381	3300025321	Ga0207656_10012602	Ga0207656_100126023	181
382	3300025893	Ga0207682_10016969	Ga0207682_100169692	181
383	3300025899	Ga0207642_10142576	Ga0207642_101425762	181
384	3300025901	Ga0207688_10022246	Ga0207688_100222463	181
385	3300025903	Ga0207680_10058398	Ga0207680_100583983	181
386	3300025904	Ga0207647_10002605	Ga0207647_100026052	181
387	3300025907	Ga0207645_10002044	Ga0207645_1000204415	181
388	3300025908	Ga0207643_10000248	Ga0207643_1000024820	181
389	3300025909	Ga0207705_10130702	Ga0207705_101307021	181
390	3300025911	Ga0207654_10261478	Ga0207654_102614782	181
391	3300025912	Ga0207707_10412863	Ga0207707_104128631	181
392	3300025917	Ga0207660_10762127	Ga0207660_107621271	181
393	3300025918	Ga0207662_10012154	Ga0207662_100121545	181
394	3300025919	Ga0207657_10002209	Ga0207657_1000220921	181
395	3300025920	Ga0207649_10001159	Ga0207649_1000115911	181
396	3300025922	Ga0207646_10064559	Ga0207646_100645593	181
397	3300025923	Ga0207681_10127018	Ga0207681_101270181	181
398	3300025924	Ga0207694_10187412	Ga0207694_101874122	181
399	3300025925	Ga0207650_10000036	Ga0207650_10000036142	181
400	3300025926	Ga0207659_10019911	Ga0207659_100199113	181
401	3300025927	Ga0207687_10121529	Ga0207687_101215292	181
402	3300025928	Ga0207700_10566609	Ga0207700_105666092	181
403	3300025931	Ga0207644_10048543	Ga0207644_100485431	181
404	3300025933	Ga0207706_10000301	Ga0207706_1000030128	181
405	3300025936	Ga0207670_10016460	Ga0207670_100164604	181
406	3300025939	Ga0207665_10026475	Ga0207665_100264753	181
407	3300025940	Ga0207691_10002309	Ga0207691_100023094	181
408	3300025941	Ga0207711_10004607	Ga0207711_100046074	181
409	3300025942	Ga0207689_10000669	Ga0207689_1000066929	181
410	3300025944	Ga0207661_10011380	Ga0207661_100113805	181
411	3300025945	Ga0207679_10000162	Ga0207679_1000016217	181
412	3300025949	Ga0207667_10388919	Ga0207667_103889192	181
413	3300025960	Ga0207651_10013663	Ga0207651_100136632	181
414	3300025961	Ga0207712_10031706	Ga0207712_100317062	181
415	3300025972	Ga0207668_10030040	Ga0207668_100300403	181
416	3300025981	Ga0207640_10358861	Ga0207640_103588612	181
417	3300025986	Ga0207658_10098328	Ga0207658_100983283	181
418	3300026035	Ga0207703_10068589	Ga0207703_100685893	181
419	3300026067	Ga0207678_10021507	Ga0207678_100215074	181
420	3300026075	Ga0207708_10176804	Ga0207708_101768042	181
421	3300026078	Ga0207702_10002936	Ga0207702_100029368	181
422	3300026078	Ga0207702_10023424	Ga0207702_100234244	181
423	3300026088	Ga0207641_10000153	Ga0207641_1000015338	181
424	3300026089	Ga0207648_10000069	Ga0207648_1000006964	181
425	3300026095	Ga0207676_10000311	Ga0207676_1000031137	181
426	3300026116	Ga0207674_10000016	Ga0207674_1000001630	181
427	3300026118	Ga0207675_100039482	Ga0207675_1000394824	181
428	3300026121	Ga0207683_10000176	Ga0207683_100001763	181
429	3300026142	Ga0207698_10152062	Ga0207698_101520622	181
430	3300028379	Ga0268266_10001571	Ga0268266_100015713	181
431	3300028381	Ga0268264_10164402	Ga0268264_101644022	181
432	3300031249	Ga0265339_10075639	Ga0265339_100756391	181
433	3300031711	Ga0265314_10005392	Ga0265314_100053929	181
434	3300031711	Ga0265314_10069139	Ga0265314_100691392	181
435	3300031711	Ga0265314_10129519	Ga0265314_101295191	181
436	3300044673	Ga0453683_0732660	Ga0453683_0732660_88_633	181
437	3300046472	Ga0495580_0288477	Ga0495580_0288477_211_768	181
438	3300046684	Ga0495669_0198032	Ga0495669_0198032_204_749	181
439	3300048905	Ga0496102_0514763	Ga0496102_0514763_130_675	181
440	3300048910	Ga0496107_0161482	Ga0496107_0161482_80_625	181
441	3300048911	Ga0496108_0000119	Ga0496108_0000119_61426_61971	181
442	3300048912	Ga0496109_0000020	Ga0496109_0000020_87348_87893	181
443	3300048913	Ga0496110_0078237	Ga0496110_0078237_2186_2731	181
444	3300048914	Ga0496111_0005944	Ga0496111_0005944_6828_7373	181
445	3300048915	Ga0496112_0000490	Ga0496112_0000490_22083_22628	181
446	3300048916	Ga0496113_0030923	Ga0496113_0030923_3264_3809	181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07998

Peptidase_M54

Peptidase family M54

72

191

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3zvs-assembly3.cif.gz_C	crystal structure of archaemetzincin (amza) from archaeoglobus fulgidus at 1.4 a resolution complexed with malonate	0.9009	1	171
3zvs-assembly3.cif.gz_C	crystal structure of archaemetzincin (amza) from archaeoglobus fulgidus at 1.4 a resolution complexed with malonate	0.8902	1	171
3lmc-assembly1.cif.gz_A	crystal structure of zinc-dependent peptidase from methanocorpusculum labreanum (strain z), northeast structural genomics consortium target mur16	0.887	4	172
2x7m-assembly1.cif.gz_A	crystal structure of archaemetzincin (amza) from methanopyrus kandleri at 1.5 a resolution	0.8606	2	177
3lmc-assembly1.cif.gz_A	crystal structure of zinc-dependent peptidase from methanocorpusculum labreanum (strain z), northeast structural genomics consortium target mur16	0.8271	4	172

ID	Description	Score	Start	End	Superfamily
2xhqA01	Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain)	0.9206	1	172	3.40.390.10
af_Q57729_6_171_3.40.390.10	Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain)	0.9103	2	172	3.40.390.10
2xhqA01	Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain)	0.9042	1	172	3.40.390.10
af_Q57729_6_171_3.40.390.10	Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain)	0.9	2	172	3.40.390.10
3lmcA00	Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain)	0.8819	4	172	3.40.390.10

ID	Description	Score	Start	End	GO Terms
AF-A0A419EPW0-F1-model_v4	Archemetzincin	0.9797	6	175	GO:0006508 GO:0008237 GO:0008270
AF-Q1INE4-F1-model_v4	Peptidase, zinc-dependent	0.973	1	172	GO:0006508 GO:0008237 GO:0008270
AF-A0A2W6ATV3-F1-model_v4	Peptidase zinc-dependent	0.9683	1	172	GO:0006508 GO:0008237 GO:0008270 GO:0016020
AF-A0A062V6T2-F1-model_v4	Archaemetzincin (EC 3.4.-.-)	0.9644	1	172	GO:0006508 GO:0008237 GO:0008270 GO:0016020
AF-A0A7V2YDH9-F1-model_v4	Matrixin family metalloprotease	0.9644	21	178	GO:0006508 GO:0008237 GO:0008270

Feature Viewer

pLDDT	pTM	Quality
93.2	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F445703

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07998

Peptidase_M54

Peptidase family M54

72

191

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map